2MIIA

Nmr structure of e. coli lpob
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
197
structure length
197
Chain Sequence
GSHMVGQREPAPVEEVKPAPEQPAEPQQPVPTVPSVPTIPQQPGPIEHEDQTAPPAPHIRHYDWNGAMQPMVSKMLGADGVTAGSVLLVDSVNNRTNGSLNAAEATETLRNALANNGKFTLVSAQQLSMAKQQLGLSPQDSLGTRSKAIGIARNVGAHYVLYSSASGNVNAPTLQMQLMLVQTGEIIWSGKGAVSQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein activator LpoB
publication title Outer-membrane lipoprotein LpoB spans the periplasm to stimulate the peptidoglycan synthase PBP1B.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 39
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2013-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ABC-type transport auxiliary lipoprotein component 2miiA01
2MIIA 4HRVA 3W1EA 2IQIA
chains in the Genus database with same CATH superfamily
3QOWA 3D8BA 3AF3A 1Y4UA 2PUTA 3IA2A 2KWIA 3NM6B 1T8SA 4DGSA 4M1YA 2WIDA 4MA4A 4WADA 4ZHQA 2PE5A 1XHFA 2OZLA 1T34A 4MW0A 3AU8A 1YIAA 2BH9A 2OV8A 4D9BA 4ZFNA 4BNXA 1K27A 1ZMTA 3M6FA 2P2YA 2HRQA 1NDHA 2YL2A 1NOJA 3W7VA 3FWPA 4IYJA 3V46A 3LNTA 2HRDA 1NIPA 2I8CA 2OSBA 5EJ2A 1AN0A 1DOZA 1JJFA 1GR0A 4AMUA 4W5TA 3WK4A 4GX5A 1QQ6A 3TOXA 4CLXA 3FFAA 2IZ7A 1E2GA 1JTFA 2LNDA 4DLPA 4PNEA 4YDQA 1RZ3A 3KQMA 2C5LA 5DO9A 3I45A 4EKDA 3SEQA 3GD5A 4UFNA 4NBKA 4M1MA 1KE1A 2HK8A 1JBEA 2HEGA 2FPWA 3K4PA 3O73A 2X14A 4UXIA 4XYGA 3QJYA 2CZGA 3V1LA 4KIWA 2PUEA 4ZRMA 3RVNA 3VU9A 4G5SA 4HWSA 3LL4A 1V45E 3K1AB 3V32A 5KTYA 1RXSA 3ZXXA 1AQLA 2C3PA 2VHWA 4YA6A 2HRZA 2OHXA 5DN9A 2BHRA 2DTXA 1DBIA 1T8YA 3H04A 5I51A 1HFKA 3KAJA 3VC7A 1RHRA 2JI8A 3TF5A 5CG2A 3LZ6A 1SBIA 1Z6ZA 3WHIA 4KQ6A 5HG0A 2Z1MA 4P4UA 2O2HA 4NCBA 3K0BA 2XSZA 4GKAA 5JAOA 2EP5A 3JD0A 1LDYA 2EYQA 2RHTA 2ZJOA 3CLTC 3GVCA 1A8QA 4FFBA 4UNNA 2B35A 1UFOA 5K01A 1E1NA 1THGA 2FW9A 4A8PA 3M6VA 4CIBA 2C0QA 1BYUA 1NF9A 3MJHA 4QEKA 1L9XA 1DWUA 4PSAA 4A6DA 3MRTA 3KU1A 2POCA 1BU8A 1E6UA 2V7BA 2YZMA 4EVSA 4AZWA 3UH1A 3CG0A 3B89A 4TM8A 1UP6A 4CG3A 2VAMA 1YU6A 1FFHA 1VSTA 4HGPA 3RBVA 4OFZA 1JJAA 2J3KA 4O2AA 2P2NA 3ETDA 1ML4A 1CD5A 2ZZMA 2BSQA 2E1RA 4ALMA 1GA6A 1E7YA 3HB1A 5CDYA 2WIGA 3GGJA 2NSHA 1SG0A 4DDMA 3A9CA 3MTIA 4QOJA 4WJKB 1Q84A 3ZWBA 5JAPA 2CE7A 2IEGA 1Z2NX 1YE8A 2OBFA 4U9IS 5DYGA 1LX6A 5TXGA 5EWMA 1CJMA 1TTQB 1UZNA 3JVDA 3FNQA 4CM8B 1R6BX 2Q0HA 3BCHA 3NLLA 4PNZA 4RY0A 5IAJA 4A15A 1E1RD 1Y1KE 1S3IA 4KQEA 4B3CA 4C4ZA 4B46A 3T5GA 3QU5A 1XZFA 1YVUA 3SNHA 3EQZA 2CT8A 1LV7A 1R8SA 1E2QA 4R2IA 1ENYA 2NVOA 4J0JA 5HKKD 2Q4BA 2PGJA 1DZ3A 1V35A 1ILWA 1XLUA 3IB6A 4FHFA 1ULHA 4DA4A 3JQQA 4KZKA 1G5HA 5FEMA 1DO2A 2JJQA 5DXAA 4HNTA 1JH9A 4UXHA 3NM4A 2R8BA 4R51A 1T3ZA 1L6IA 3ONNA 4A0FA 1ORIA 2RD2A 4YUXA 2FMFA 2G71A 3D5TA 4Z4QA 1V8BA 5IX8A 2REQB 5LWHA 4J16A 3WYNA 1ZZGA 3U61B 2XODA 5LDDC 4PLFA 1KNXA 4Z1MD 1P18A 1K4YA 2PQ0A 2IHUA 1EWTA 4GHWA 5DBFA 3FR8A 4V02A 2FMTA 3GXOA 4WKBA 1E1CB 2O7SA 4E32A 1ZBQA 1B43A 5LXTB 1PSZA 2Q1YA 1YQ9A 2ZE8A 4JC4A 1JFFB 3U37A 4GGPA 4Q48A 4ABTA 2JZNA 3HVIA 1TA0A 2Q21A 3LUDA 3M6UA 4HYYA 1HFWA 3AM5A 4WRRA 2WC1A 4ZTUB 2X9QA 1COWD 2XLCA 3CLKA 3SU8A 1A0OA 3LQ1A 4MRNA 5ES4B 1NV9A 3B7PA 4K6CA 2DQ4A 1XRRA 2WPDA 4GZ6A 5A6SB 1ZXLA 5SZKB 2HRRA 2WYIA 3DD1A 5AVQA 1M5TA 1R0RE 1K5PA 1B00A 1K3TA 3A6KA 5A71A 2CEKA 4NAVA 4KMRA 1P6XA 3UH0A 2JPDA 1TMOA 1OFGA 5JU6A 4OA8A 1L5ZA 3S27A 3SX0A 1ZSVA 1MT3A 2WWIA 4FWTA 3EC7A 5KUTA 4DTCA 5JYEA 4IH1A 4GE0A 3DMRA 5I5EA 3NQ41 4KTVE 3RJ5A 5EZSA 1ZX1A 2VDLB 4R41A 3WLKX 1WM1A 5LBIA 5CB6A 5CU7A 1L8XA 1SULA 2NVUA 3AJ9A 3OZAA 1O95C 4RF2A 3BA6A 4C0LA 1RHQA 5BXYA 3CUUA 1KO4A 1JVSA 3JRXA 1JZTA 2GAIA 2QWXA 5AUPB 4YT8A 1EPUA 1E98A 3MJSA 1C0LA 3C4VA 1OI7A 5JBQA 1EE1A 1ZA1A 2QDXA 2FX5A 2HO4A 1WZNA 2H92A 1JR4A 3AJDA 1JECA 3G9XA 4HB2A 4PC6A 1UMCA 1Y37A 3FNRA 4MJ3A 3R5FA 5AIAA 5IVDA 3ZZ0A 1WXIA 3IB3A 2PV7A 4I50A 1N5KA 4JHXA 1W96A 4X7PA 5TQVA 4MUXA 2RARA 3ZW9A 5T64A 2P6OA 1ETUA 1TLFA 2QX7A 5AKKA 1PS8A 1ZIOA 1B42A 2R1UA 3F5QA 3M1IA 4MUMA 4ZQHA 5JS2A 1OH8A 4IDHA 1ISJA 1V1JA 5DNAA 4PXSA 1SUEA 1P1FA 3B3AA 5JFGA 4W5OA 2E5LB 1Y1TA 2X13A 3LUJA 1QH0A 1NONA 1IHXA 4C7MA 4YT2A 3HHEA 2AN9A 5ECDA 4AJHA 3OPVA 2DTEA 4UUNA 3H42B 1WEHA 4O5OA 1NDUA 4DC9A 1HMPA 4WBSA 3K16A 4GRDA 3I1YA 1N2ZA 1TLTA 3CCBA 4HB3A 2Y8EA 3BSSA 3BX1A 3M8KA 1ZJ5A 3N7TA 3OTGA 1XHLA 3D2LA 1GPWB 4DM7A 4B3MB 3NVAA 5K0JA 4H1WA 5FPQA 5IC5A 2PBRA 4A10A 3H5IA 4D8WA 4DCMA 1H2YA 3ZU6A 5MGNA 5C1IA 1Y3DE 4DQKA 2ZJBA 4V0OA 4HX2A 4LOHA 1GP2A 4EBFA 1SOUA 1HQDA 4MRMB 2A9FA 1NJGA 4IZIA 2J3LA 3DWGA 1PVVA 3VA7A 1EE2A 3ZCTA 4NMMA 3KQLA 1E2PA 3HEBA 1PUIA 1XDGA 2RGXA 1U8UA 5ECGC 3HKEA 4RY9A 1LF0A 3CTPA 1FFXB 3Q6IA 3D0OA 1T2UA 4Y9UA 5COAA 3VHRA 5BMVA 1NF8A 1PGOA 4J0HA 4JVLA 1QG6A 1M75A 3D7NA 3CUEF 3DEYX 2ZIZA 1VE7A 3L79A 5EOVA 1JFRA 3LDFA 2FEAA 4R05A 3TLAA 5B57C 1BTOA 1XD9A 3DAOA 4HEQA 1L5SA 5C8VA 5HKBA 3FIJA 4HBZA 2ACWA 2CLSA 2XX3A 4HXYA 3SXJA 2CB0A 1M3SA 2BEVB 2WMDA 3D5EA 3QP9A 1E0JA 5GP1A 2P6PA 3JAWA 5DK4A 1CETA 3MCVA 3ZVLA 4NU0A 1ZK3A 5LP6B 1SPBS 1V11A 2OHIA 4PPNA 1WB4A 3MWGA 1EM6A 4UJ5A 4XZ3A 2VCEA 3JQFC 4JUDX 3V1UA 2OBNA 1CDZA 3QHQA 3PQDA 4OOFA 4O4IF 2PVPA 1Z3IX 3DFIA 3ZNOA 5I7AA 4YRJA 1P7CA 4ML3A 2OA0A 2Z56A 4IICA 4DDTA 3AP3A 1RWKA 4LMBA 3HB5X 2W70A 4HY3A 4I4TB 2QDKA 1OLOA 1QKIA 3ILSA 4Y2VA 1BG6A 5E3HA 1ZH8A 2RHRA 1CR2A 4FBMA 4DM3A 2GH1A 2C9BA 3AF0A 3H9JA 4S1WA 1IY9A 4EA6A 3RAPR 2PY6A 5JZSA 4BCDA 2AKEA 1SOMA 2RGAA 2OY0A 4CT5A 3KU4A 2X1LA 1BA3A 4KYVA 5FFMA 4AF6A 1YRYE 2AVDA 3JQAB 3PUJA 3Q2OA 3OPYA 5A4DA 2YFKA 1XMJA 4C6RA 4N5MA 2YMMA 4CF3A 4I1OA 1IZ7A 1NR7A 2JBAA 3PBKA 5EA2A 2CHEA 5JXIA 2M6SA 3NI2A 3VR6D 2J5QA 4TWJA 3BWVA 1QRSA 4F8JA 4I5EA 2PQ6A 3FHJA 3ZDAA 4YRSA 2DRIA 2G88A 3FNBA 4KO1S 4B6GA 2MCFA 1AA6A 3C3MA 2I6GA 1ZLXA 2CJXA 2I55A 2Y6VA 2WU1A 3DF9A 4PZ9A 4OX9Y 3P2MA 5E0KB 4P9NA 3HKDA 3EEFA 4ASUD 2FN7A 1IM5A 4WBXC 5TR9A 1A97A 3IIKA 4JP3A 3LUBA 2P6NA 2A88A 2QGZA 3DZIA 4HNSA 2ZB2A 1TUBB 5K99A 4G0MA 1VE5A 1JHZA 1YZUA 2D3TA 1GG8A 3N0XA 5LOVF 4AP6A 1XBTA 2Q5QA 1DNPA 1I3MA 2IP4A 1KETA 3GJXC 3LX8A 3NAQA 4AJJA 3VUFA 1ZUHA 4EX6A 4ZOEA 3O0TA 4LXIA 3TJMA 5J4HA 2HHHB 2BMFA 3K70C 3AQ4A 5FNVF 3T61A 5K9ZA 2HI0A 5TEVA 3WLLA 5CB4B 3JSXA 3RPEA 2WD8A 3GP3A 1S02A 1IK6A 1Q1EA 2VXOA 3ICOA 4RJKA 1ZYUA 3ZTWA 4R8LA 5AJXA 1R50A 1VBFA 1JFLA 3E81A 3A4NA 5G4LA 5K3EA 4R98A 3KDSE 4QUDA 4W7IA 4X6XA 1G7RA 2FUCA 1WXFA 2IYLD 4G8JA 1G2OA 4OPMA 1BDIA 3V4VB 1EK1A 4WFJA 4QBHA 2CMHA 5H70A 3C3BA 3TQRA 3HDYA 1Y6FA 5BN5B 4J43A 4BB9A 1TEVA 3EVAA 4PG4A 4GXQA 4JYAB 4FYWA 4CJXA 4IGKA 5CB8A 1EFRA 1SGWA 4K1XA 5AM5A 4XGQA 5I7EA 3IPYA 1V5WA 1UFKA 2Y0DA 1LQTA 4MUJA 2OKCA 3SS9X 4U3JB 5LN1A 5EP1A 5B2EA 4GMHA 2J7PA 2XT6A 3TE6A 5JALA 5KBYA 4MVJP 2Q1TA 3FRJA 1K7FB 1WUJS 2FSVA 2XDAA 3D8SA 1VHJA 5BURA 5LU9A 1ZGGA 2RHBA 4DUGA 1GXSA 4CTJA 4ALKA 2HLDD 3H3FA 4EY6A 1NVDA 3MM4A 4RIIA 1SVKA 4N3NA 4QU5A 2H4WA 4RBNA 4A5SA 4DTIA 5A06A 5B1YA 5CAEA 5I6DA 2B92A 5TGZA 2QUKA 2OHOA 4J3JA 1K66A 1JDZA 4HPXB 3U1BA 1C29B 1ZJZA 3ESCA 4BFSA 4F96A 4CKCB 4TMXA 2WQ7A 1V4NA 2X2OA 3DOIA 2X8JA 4RC9A 5BVGB 1XQVA 4G5YA 4KQWA 3QWFA 4QT4A 2CCJA 3DAPA 2E18A 2PO7A 3IAEA 1U1FA 3PXGA 5JTUA 3LP5A 4NABA 3M7IA 1OA0A 4X1IB 5LUAA 1PFQA 1C9NA 4G37A 3VJRA 4RHYA 1KAQA 1KI6A 2Q4RA 2FHSA 3CZ5A 4YV0A 3DGEC 4XM2A 5E2AA 5KX5A 2AG8A 3A7DA 3F1KA 2VLBA 4XKJA 3VR1A 3V8EA 1TJNA 2D7JA 4C3OB 1KY5A 1ZD3A 1U28A 1NRJB 3DM5A 3KE9A 3DC7A 4J1TA 4OLHA 2VHJA 5KQPA 4PY2A 1YB6A 2HJVA 4LHWA 5IAOA 2O06A 4GUDA 1V9CA 1SOVA 4ZDJA 1T4CB 1X7DA 2Y1KA 1LNQA 3CX6A 3VC2A 2A9JA 1RACA 1U3CA 4YJGA 5JNSA 5BR8B 1KYVA 3R09A 1X1EA 1WU8A 1Z5GA 3SKXA 3F98A 1RI2A 4ZI5A 3ROKA 1DMRA 2H5LA 3FGZA 3V2GA 4EX7A 2YIMA 2J6IA 2CXUA 2FZGA 3U4MA 4WY2A 1T36B 4IF4A 4PYOA 1A9OA 4KDCA 1M1NA 1TPZA 5BW8A 1SO8A 3UKOA 2O2CA 3MQ4A 1JLHA 1SQ0A 2IHYA 4KQ1A 4RTJA 1SC9A 1WS6A 2OGTA 4F4JA 4DS3A 2KBEA 3GOHA 3N7AA 1HRDA 4EMTA 2HWYA 1V16B 3DC2A 2BMVA 3LI2A 4BV2A 4ENUA 2AZXA 3ILHA 5CVJA 1PR0A 1Y48E 3JWEA 3JQ6A 4Z54A 4OMFG 4QE3A 1RJWA 3R4VA 2HZ7A 2W2PA 1R8XA 3O3MB 5K4HA 4JC0A 4BO7A 2G09A 5GVSA 3HSYA 2I2AA 4JGBA 3O84A 3T5MA 1CTQA 3P2KA 1JQJC 3L92A 2E55A 3E22B 2GPJA 2DP4E 3L8YA 4DCNA 1JFVA 2O8DA 2FR0A 2QUHA 2RGBA 2WTNA 4HH1A 3SSMA 5L3SB 1UUFA 4ZQFA 5JNTA 4L0DA 2E7ZA 4Q82A 4D9GA 4LPSA 3AOEA 2CLCX 2ZBQA 2NQTA 3ROTA 1P5ZB 4UEOA 3UFXA 1CR6A 5F1KA 1BD3A 4WOKA 3VISA 3MJEA 3PXDA 1N5JA 3T5PA 4OXRA 3V1KA 1YA8A 5ALYA 4D4JA 3L6CA 4DWOA 3ZKAA 3GLFB 3ZH9B 4LS3A 3ACBA 3DCYA 5BR4A 4TL9A 1BS9A 1WE2A 3GPBA 3AIKA 3O2SB 3O8OA 4KCGA 1UK7A 2QMOA 3HLTA 1WXDA 2Q6KA 2ODWA 2J07A 5D1HA 4ZVKA 3PXEA 3K53A 3KWMA 1ULTA 1WNFA 5B1SA 1DCMA 3RV4A 4NU8X 1LU9A 4QBIA 1J2JA 3O3NB 4P6VF 1DIBA 3VPDA 5C32A 1OVGA 2ILVA 1U4OA 2WHRA 3TO5A 4OM8A 4CU5A 2GJ8A 4JUCA 1E79A 1ORTA 1JG1A 1OT3A 1OZAA 1TVKB 3FNEA 1T8PA 2PIAA 1PNRA 1FDOA 3QX3A 3BM5A 5ADVA 2IDZA 1UQTA 1XAGA 4JZKA 4QDXA 1NR1A 3C43A 4WOCA 4X1OA 4ZCQA 2PL1A 3HACA 1IEWA 4BIIA 4YT4A 4E11A 2Y67A 1GO2A 3U9LA 3HNRA 2YZKA 4P7BA 4BFCA 4LSZA 4MX8A 3KIPA 4KPGA 8AT1A 3TGPA 4KXUA 1F3LA 5IJXA 1KR2A 1M6WA 4FZ3A 3KEQA 4YREA 3QTLA 3QUCA 1CF9A 2QD3A 3HGTA 4TKLA 1DJMA 3EK2A 3UGTA 2C83A 4JEMA 4AT1A 4B71A 3PHJA 2VDNB 1R0BA 3OFSA 4ZT3A 1OHHA 2C7PA 5C52B 5C7IO 5J40A 1VJGA 3HP7A 3JQAD 3K05A 3Q8XB 3R0JA 3DV2A 3U9TA 5I7FA 3QVVA 3Q7PA 1T5DX 2V7EA 3NNDA 4BEJA 2PBLA 2FCAA 4W9RA 5JXGA 5LXTF 4WI1A 2XZPA 2EARA 4YRMA 4NYMR 4MHOA 3DVSX 3OCWA 3OM1A 4RQTA 3COSA 2COUA 3F96A 3R40A 4D2IA 3Q12A 3G68A 5J23A 3VAAA 2LCFA 1JLSA 5JSYA 3HGQA 3DT8A 2IEBA 1VSBA 3G23A 1VFNA 3GGOA 4HTFA 4DZZA 2RGNC 4TOIA 2OUIA 1E6KA 1MIHA 2RC6A 2VF4X 4LJRA 3KLOA 3DXFA 3HUUA 2EGGA 3LDGA 4L27A 4UKDA 5FPYA 1ONPA 3ABSB 4DMKA 2O8FA 1C3OB 3JY6A 2NUTB 1UCFA 1QPGA 5HA5A 4E0BA 3K9HA 3NGLA 4JOSA 3SM3A 1A88A 1JKJB 2AFIB 4PNHA 1WSDA 1IBRA 1DEKA 3AF1A 2J0VA 3PQ8A 3RSSA 4MUKA 1QQ7A 2ORIA 1U0NA 2PH1A 2XD9A 3A0RB 5JDIA 4UTPA 1EWRA 3D8TA 3SR3A 3GZJA 1B0ZA 1U9ZA 4BFTA 1RMYA 1XF1A 2FQWA 2WG2A 2LKCA 4PG8A 5LQCA 5U1PA 1MJNA 2HQRA 4EJSA 2BMWA 4GI1A 4OL0A 1JE1A 1ESMA 1XLTC 3PR3A 4QDJA 3V34A 4I5IA 5K3AA 4NECA 5KTKA 2O8CB 2R96A 2J3JA 2YWDA 2ISSD 1D04A 2FJPA 3WKEA 1A95A 3LE8A 4O2LA 1JTEA 4EGAA 5EJAA 5ICEA 1WD5A 3HYTA 3LYUA 3OZUA 1ZD9A 3IPLA 1DRJA 1LJUA 3N74A 5JIBA 4RETA 3B1KA 4NZZA 2XTAA 4GR9A 2VBGA 3IQGX 5DYWA 3WS7A 2XMPA 1MC5A 5CG1A 4JX8A 3AF6A 1ZAYA 5A7HA 2M9MA 3KJHA 1JJBA 5G0VA 3ZHYA 4HB0A 4PQFA 3QXHA 3FDFA 3EQ9A 5FUYA 1YDGA 2XYGA 3VFDA 4P98A 3AB8A 1EAYA 4AVYA 2FZLA 4RGYA 1SCQA 4J0FA 3BA1A 4UD6A 4ZVVA 3MWLA 2Q1UA 3BE4A 5F3DA 1JG2A 4F71A 1U0HC 3AV0B 2GN4A 2J4FA 5CYOA 1ORVA 2OV6A 2XNDD 1LDEA 121PA 1AGPA 1JHPA 4GM1A 4G0QA 2I6FA 4IDDA 2R8XA 3AV3A 3R6DA 3RANA 4M7RA 3DBOB 5IC6A 5DTJA 1UBOS 2RAVA 1DIRA 3KAKA 4PTLA 1NM5C 1WJGA 4BJ6A 2OO3A 3JR3A 4NG4A 1HQKA 3O95A 4AN1A 3VKFA 1T15A 2QTAA 1ZJ4A 1UZUA 2HWKA 3RU9A 2EFGA 4M1ZA 1H6BA 1YZNA 4G41A 1IIBA 3NBYC 4KYUA 4RU1A 3BHIA 1E5QA 1P4JA 3N5CA 3K3PA 2I4TA 4LQCA 4Z7OB 1U8XX 2IOFK 1GRNA 4TLDA 1WW2A 2IXGA 3L0SA 3Q87B 3PHHA 4KXYA 1YACA 1I1QB 1K8RA 1BE6A 2IYWA 2FOXA 3IP3A 2ID9A 4TMVA 2VBIA 3TDNA 5BN4A 3MB5A 2J3IA 4TM7A 1H8HA 1NUHA 2NO7A 4K1LA 3W1EA 1MXHA 3OKAA 1BOFA 2H57A 1KOGA 4MIYA 4P81A 3AESB 4M89A 3M6IA 2OHJA 4X6YA 3ZDCA 2VJDA 2PZKA 1T0IA 1XWIA 1HRKA 1IY0A 1OBCA 2G67A 3T34A 1OAOC 2RH4A 2W8ZA 4EQ6B 2C5EA 2PUVA 4M2LA 2QF7A 3BH7A 4GPZA 3V8VA 1K8YB 5LP6F 1XQ6A 4B44A 3NZEA 4H1TA 1W44A 2RB4A 2VTBB 1JJIA 1R74A 1VOTA 1O94A 5HCIA 1P7YA 1IZ9A 2B69A 5H4HA 1X1RA 5DNDA 3PL1A 2YVQA 2C7OA 1Z5NA 5FB3A 4I4TF 3QF4B 2IZZA 4FC6A 1P2GA 2OC9A 3E9RA 2FKNA 5IZCA 4TXLA 1NQOA 3NTLA 2FEWB 3EIEA 3K0AA 2JJ2D 4BNDB 3CVVA 2QM8A 4FLFA 1A7KA 1SKYB 1XLWA 3BD9A 1RRGA 5JHGB 1KPHA 4FE3A 4OI2A 1A9XA 3VNQA 3ZQ4A 1EWVA 2BBWA 1P1IA 2ZM5A 3I34X 1B0UA 4A2WA 3BK7A 2ISQA 4RIGA 2GSDA 3KTOA 5J4YA 5ER9A 1E7WA 2ZVDA 4Q9DA 3HB7A 2RH8A 4KAFA 2C1XA 2FE1A 1KIAA 1IWBB 1ORWA 3I9MA 4G1MB 4AM8A 5J2UA 1DO0A 1HKUA 5TQJA 1WQ1R 2JFYA 3FTPA 2RH5A 1GZHB 2IHTA 4YAEA 4PCAA 4FR2A 3AY7A 2BDEA 3RVQA 2WW8A 1AD2A 3N8KA 3TIFA 3ZWCA 2A1UA 4L4YA 3NANA 1WCIB 4U2CA 4LVCA 1I0ZA 4BGVA 3L6OO 4JL8A 1DDIA 2L0XA 4LNHA 3UJHA 1E18A 3RAGA 4FR0A 1DBWA 1L4GA 1UJNA 4DLZA 2J4CA 3WO1A 2WFLA 3QFFA 1A72A 1DKOA 2ZYIA 2IS4A 3ORYA 5CB4F 4JDUA 1XK6A 2I7VA 4G8CA 3VR5A 2R00C 3PWTA 1FRZA 1GVHA 3V2IA 3GHHA 4CRWB 2B4YA 3E7DA 3FSGA 5EXEA 4C7XA 1F5NA 3W34A 1Y5LA 2JFHA 5ER6A 1VL8A 2D0DA 1CF4A 2B3DA 4ZJYA 3IUPA 3S40A 1EU1A 2NOAA 1N6LA 4WCVA 1YE3A 3K35A 1P3JA 2E49A 2I66A 4PEVA 2IXFA 2JLRA 2YVLA 2ZRFA 3DZDA 1JXMA 1NBHA 1YFZA 3RUFA 1TXGA 5K3DA 1P0QA 2AXQA 3PGLA 4HEA6 4BCBA 2YWJA 2AYZA 4HH4A 1ZISA 4UAGA 5FLKA 4CKZA 4MB6A 4IJ6A 3CPJB 1J8FA 2XMDA 4MVJE 5AUOB 3EWNA 2P9HA 3AR3A 1UBNA 4IQ4A 1NJ1A 2LR0A 5BSKA 3ICWA 4N4AA 1UM9A 4S2UA 1B0AA 2PX5A 1GZUA 4M9ZA 2CLIB 3ZW7A 2VP3A 4EVQA 1WCV1 3A3OA 3TZHA 4F3KA 4N41A 2P0AA 4A8JB 4DV3B 3L7AA 4KVAA 2UVPA 1O8CA 1T3HA 1E2MA 1J56A 1JQKA 4NMWA 1Z4JA 2PLAA 2CSUA 4J7XA 1Q95A 3MN1A 1AC5A 1R2QA 1ZOIA 2OCDA 1OFVA 4WWHA 3F9CA 1W5BA 3GLGE 2PXCA 2OBYA 2RAFA 3IKJA 1TJYA 3PFHA 1T1SA 4J3FA 4MH0R 1IN7A 4RMNA 4UU0A 4AY2A 1XRPA 2XGSA 2QTVA 2I5PO 3CN7A 3JRNA 3OICA 3WK5A 2OBLA 2QR2A 2HDWA 3OECA 3LQ2A 1FSPA 5JAQA 1QGED 2NU9B 3WB9A 4G5XA 4QL3A 4Z51A 5AVYA 2WTXA 1KBOA 1PJTA 4WT7A 5K8IA 2NU7A 1G21B 1W25A 1Z7GA 3EARA 3MWYW 3NRBA 4Q24A 4WZAB 4PPFA 3UXMA 3V1MA 3ZV5A 3VZCA 2GF2A 3DMNA 4GDMA 4MAAA 4K6OA 4BLPA 3EH2A 5D5PA 4O25A 3S2EA 2UZIR 1UINA 1YI8A 1K8ZB 4MIOA 4ND6A 1TJ4A 1CVLA 3SMQA 4QXOA 4B7UA 5IJ9B 1D0SA 1FFBA 2CFCA 3ENQA 3OO1A 5F77A 1EVQA 3HYSA 3SXPA 5F21A 3LRPA 4ZZ0A 2WMYA 5T4HA 4RFLA 4C4RA 3I9FA 3GR6A 1OE0A 2J3DA 3EYWA 4RX1A 1VHWA 1XXLA 4P33A 5F23A 3W2GA 3WJAA 1I1HA 3N2YA 1R8JA 3AF4A 1C3LA 3U1TA 4YNBA 4LTMA 4B31A 1NQWA 1RI4A 4O2BB 3GT3A 4F8EA 5B58C 3WYCA 5LQDA 2NZ8A 4H7PA 3TR5A 5JFOA 1XZDA 1G5IA 1M1YE 4DILA 3AJEA 3R7NA 4ZCTA 1J2RA 4YCLA 5C4MA 2BW0A 3UUFA 4A8TA 5KQSA 1ULBA 3GL9A 4O2AB 3EDCA 4A6PA 1NJSA 5BR1A 4HRXA 1WTCA 4D5EA 2GCGA 2ZSFA 3RODA 5KOYA 1UKVY 3NBAA 5IVPA 2UUPA 3KJEA 4WCFB 2Z4TA 2XCOA 3HB9A 3WKBA 1RAAA 3KUKA 3ZJTA 2GLUA 3OM0A 2A0UA 1SXJE 4KXLA 5CJPA 3GF4A 4A5OA 1ZRHA 5HW0A 4LDJA 1T1JA 1KIFA 2V5UA 1XOIA 2CL0X 5KDOA 1RXUA 4DMRA 2DAPA 4LBYA 5BRAA 1EB8A 1F7UA 2ZT6A 5BT9A 3OX2A 3GCDA 5J2TB 4RTSA 1L3BA 2P41A 2FEXA 3KT8A 4YO7A 2MWMA 4S05A 4YALA 1J1IA 1ZHFA 4DDKA 1R9NA 4EYKA 4NFYA 4D0NA 1PTKA 3AIMA 2D8MA 2ZIWB 3IHLA 3GFRA 4OQZA 2NXCA 1OX4B 4UTNA 1U4SA 5BVHA 5GIPE 4RF3A 4G5RA 1WUIS 4PN7A 2B5WA 2X5KO 5KPJA 3A2KA 4REQA 1VM6A 2D5AA 1SD5A 5HM8A 5KYXB 2XJ9A 4ITUA 4NCHA 5DW0A 2YMPA 5CDTA 4EUKA 1O97D 1PJ2A 1NI5A 4RPCA 3SWWA 5KNCA 1RVDA 4DQUA 1T5OA 2ATEA 4JUFA 3R7DA 1LRLA 1XDBA 2WIJA 3QLUC 5JO9A 3UMYA 3G13A 3QEKA 3KPWA 3KD3A 3MTGA 5I48A 1P5RA 3IVCA 1JBQA 4W6QA 3AVTA 2FSHA 2JGJA 3KPUA 4HGZA 4M9UA 3WX0A 4OUDA 4I8DA 3EASA 2GYWA 4BJ1A 1FJHA 2X4LA 1HYHA 2O9JA 2ZIEA 2VZLA 1JDJA 1QUFA 1RPTA 1YMQA 2ZQYA 4M0CA 4G26A 1U9CA 1H2FA 2VBFA 3QF7A 4MKIA 4P4NA 1KSJA 1QZ3A 3EG5A 2GS9A 5FBZA 4XPIB 2IYAA 1L4FA 2A9QA 1N9GA 3HS3A 3HU3A 3RE1A 4ERNA 2HL6A 3C48A 3HY4A 2XNKA 4ZTZB 4CDGA 2MU1A 1QB7A 2NSDA 5AKJA 1E2BA 3W8FA 2GZHA 4X65B 1NJ2A 1TAQA 3CH7A 2AD1A 2OWEA 4UHFA 5CJ2A 1AS2A 1TMGE 2WZBA 1RFGE 4E5NA 1MEOA 4UBIA 1D5CA 3PK0A 4GICA 4GKBA 3DE0X 1TGVA 2FSPA 2ZRCA 2CKMA 1UKEA 3LPDA 4RWZA 3AR9A 4B6RA 2NVUB 4QUAA 1QP4A 3T06B 1Z2OX 2GXQA 3OF5A 4J6FA 5ALWA 3WJ7A 3GFVA 4WXHA 3Q11A 1WO8A 1UK6A 4GEGA 4I36A 2I6QA 2XMGA 3D4NA 5A62A 2G9QA 2W6JD 4AZ0A 1TFUA 3HL0A 1ZIXA 2GAAA 3M83A 4N8SA 4H7HA 1BS1A 2GLXA 4MW6A 1OOEA 2BM0A 4X60A 5D3MA 3RS9A 3IUJA 4N82A 4RORA 3G5MA 2IYQA 2CJPA 1XNJA 3ECCA 3TVDA 3ZOZA 3LPLA 1EA5A 5I9TA 2YHUA 1DV2A 1MB2A 1RJEA 2VF5X 3IOBA 3OU2A 4E21A 1KYTA 5FWDA 4TV8B 1EDBA 2VPXA 1U9JA 2XCUA 3I37X 4PNPA 2ZZKA 3CR7A 4YUZA 1NG9A 3CF0A 4BTVA 4DXDA 4XB2A 2WLSA 1XVIA 2A3RA 1N2IA 1FCJA 1RABA 3KWFA 3ZDRA 3EN0A 2P5UA 1KVTA 1I3KA 4Q9KA 1E7QA 1GLGA 1RLUA 2O7RA 4ZOBA 4CYMA 3VGPA 3C39A 3FPAA 1C9EA 3IUYA 1CY1A 3M49A 2QRQA 4BO4A 3RW9A 1TZCA 4KRXA 1HX7A 2Q3JA 3L6EA 1WKVA 2AW5A 2PZFA 4Z4HA 5EIBD 3THXB 2FWAA 1L5LA 3W7AA 2JGNA 2H54A 1IZYA 4GPD1 4YJ2B 3DCJA 3JPYA 4JLDA 5DHAA 1O57A 1HTBA 2M6LA 4KHPB 1E5DA 4F72A 1MGPA 3B6ZA 4IZ6A 3B9PA 1ISHA 1QO0A 2GEVA 4QDOA 2B5VA 2ZB4A 2LVBA 4I1VA 4BXOA 2FG6C 2BRUC 4H1HA 1UWKA 1ODCA 4YGXB 5AJZA 3UMGA 4CKXA 1ECCA 2AE2A 1TE2A 4MLZA 3R7WB 4ZO4A 3IOEA 4Q3DA 2NQ2C 2E37A 2O52A 1W29A 2LUOA 2FN4A 1NOIA 2OHGA 3O94A 4N40A 3U3XA 4BX0A 1T13A 3PFIA 3EFBA 2NUPB 2C7VA 2R2AA 2PFKA 3PC8A 4RADA 4HNVA 1P8AA 3EA4A 4W9NA 3FRIA 4Q4JB 2FLVA 3V8NA 2D4HA 5SV2A 4DSTA 3KQHA 1WBBA 2E9SA 2FK8A 2DHRA 2HR1A 1PGPA 1DBPA 1MFZA 2HXYA 2APJA 1M9NA 1DIAA 3HA2A 3QE2A 4IKPA 5TMDA 1A76A 2CCKA 2VJNA 4XFKA 3QPCA 2PXHA 5HZHA 1D2NA 3O47A 1ZJYA 2A94A 5HJEA 2B1GA 2C2HA 2UXDB 2K4MA 3U3JA 5J5VA 1UKZA 4YAWA 2PS0A 2QXTA 1E9BA 1UKBA 3ZDDA 2LV8A 1EIWA 2C4NA 1NUPA 1XZEA 1L8QA 4JP1A 1R0WA 4BMNA 4JC5A 2MYTA 1GIAA 2PQMA 4E4YA 3UUWA 1DKRA 2J5RA 3ASZA 5TX7A 5CFOA 1I5EA 1TC2A 1G9TA 3E18A 4EW2A 5JCZA 1YB4A 3GYGA 3O90A 1JQAA 4XFDA 3BIJA 1I13A 1RYMA 2XTZA 3WB0A 4Y1RB 2HJGA 4DRXB 1GDTA 1UOQA 2X7HA 1A50B 1ZY2A 4OH7A 1EAMA 3TN7A 4C76A 2Y3IA 3EWAA 1B6RA 2DWUA 2XYRA 1X80B 3USCS 2D1SA 5IXJA 4X93A 4M7PA 4BNIA 5EERA 3HFGA 4LPKA 4QQRA 1KZ9A 4TVOA 2W37A 3SDBA 1HPLA 4LC1A 1FOEB 1IZ0A 5DISB 1UC4B 2HX1A 5KMGB 1QIDA 2AZTA 2BBOA 2P9YA 4L3VA 1RJGA 3IKMB 4RWEA 1TADA 3IJRA 3LCVB 3IPAA 1ZNYA 2H7CA 2OEPA 4O08A 3OQNA 5B6JA 3STHA 2CLLB 5MHTA 5TQ2B 5BRJA 2MT9A 1PK9A 2G9NA 9ATCA 3I23A 4B3DA 1SPXA 1JGTA 1USKA 3HC7A 2NU6B 4XM0A 4XX1A 2YWGA 5DULA 4CIDA 3U4HA 5K51A 2VWPA 3BDIA 1JTVA 1TT5B 4IDQA 4IXTA 5SICE 4ILKA 1UDCA 2IS2A 3FROA 5BQXA 2GARA 1U6JA 3HPQA 2ZDGA 4QOGA 3EE6A 4RVFA 1N75A 1V3UA 1HNZB 2B8WA 3K7EA 1QRRA 1CEXA 5HJ2A 2XIQA 1FX1A 4GM0A 3OSUA 4HDQB 4NK4A 4UUMA 3SHOA 3TR0A 2ZS7A 3U7QB 1GZSA 1AVTA 2JFGA 3TLGA 4XJXA 2EZ8A 2G04A 3RYFA 1B8PA 3R3HA 4OMCA 3ZX5A 2EQ5A 3KZOA 5EFOA 5ARDA 4EG1A 2SICE 2VK4A 1KC3A 1EQUA 3T0GA 4E3WA 1EXMA 4DFDA 4S1TA 4YMUA 1VCNA 2F9MA 2QVLA 1V26A 2QEQA 3L7YA 3OA0A 4IVPA 4P3OA 5FIUA 2QU7A 2HV9A 2QTCA 1WKCA 5CVCA 5BQOA 2ZWAA 3ADPA 3KJIA 1T9GR 4OXQA 5DIZA 1K6XA 2M1ZA 3AM4A 3R6GA 1P29A 4O29A 3VPBA 3J80A 3T1QA 4H08A 5AYVA 3ABQB 2JFQA 5DGTA 1Z63A 3C5HA 1XPRA 2PMKA 1NZDA 3HPRA 1RMTA 1RM3A 1SELA 4TTIA 2GUWA 2PMCA 2XTMA 3CLUD 3TNLA 1I7SB 2HGSA 3CUTA 1IBKB 2MMCA 5CVDA 1G42A 2ZCVA 3WYDA 5HJ7A 1U8YA 2IU4A 3EHEA 5CLIA 3X1JA 3OCJA 3SE0A 1BMQA 1JMKC 4KODA 2GN9A 2J7KA 3CO0S 3NDIA 1UC9A 2OMKA 3N0WA 3NGMA 3QSGA 4GGOA 4YCJA 2K7ZA 3CMMA 3IQZA 5A4IS 2JAWA 3AF2A 4DWWA 2G63A 4GOLD 3QNWA 1J9GA 5DT9A 2PD6A 1WL8A 2FUKA 3RHFA 4FXOA 2H8KA 3IDAA 3C15C 4R83A 5EWJA 3V8PA 5C5EA 2O2XA 3JZMA 2GPAA 2ASVA 4BNWA 1YFJA 3PR2B 4DNPA 1V5EA 2H07A 5B7GA 1U0JA 2VK1A 1SD2A 2X9GA 2ZWMA 4GKVA 1X3LA 4QZVA 3HR4A 1Z3CA 4EFKA 1EXDA 3ZV4A 4DADA 1D7OA 2AV6A 1E2JA 1QK3A 1UXJA 1I4WA 2BGIA 2FN3A 2FSVC 3AXTA 1V7ZA 1UXKA 2BE9A 2XYPA 1F1JA 2AL7A 3QVOA 2X4DA 1ISMA 1N5RA 3R6LA 5LQRA 1IOVA 1IY2A 5TE9A 3KQNA 2VQSA 1NYTA 5MN6A 1F2UA 3U6KA 1Z33A 4AG6A 4UDOA 1WMFA 5DXJA 2VDWA 1LBHA 3RK0A 4ARZA 1YWGO 4DT1B 4AWAA 1X2EA 2FH5B 4F92B 1PCXA 1ODJA 1J4AA 4PZZA 4FFNA 4GMGA 1UOOA 3A4LA 3G8AA 1G1MA 3NIFB 3EAQA 2X3FA 4FX2A 4CQLB 1YZ3A 1UDRA 3F6PA 3DB2A 4NAUA 3TSAA 3FWKA 2A9PA 2BHLA 4UQOA 5E2BA 3QBEA 3HDJA 3VX4A 2H1LA 3FHCB 1MJGA 2IY8A 2RONA 4JBGA 3PV0A 1E5XA 1XALA 3GA7A 3A6PC 2Q27A 3SR4A 4YAKA 2XUHA 3AEZA 3GRRA 1PT5A 3KTAB 3VNUA 4UATA 3DBVO 1QHXA 3AFMA 2AYXA 4Q37A 4TZTA 2PMDA 1FTGA 3P7MA 5GVRA 4EB0A 4NE7A 4RHFA 1EVKA 1DTWB 1K88A 2CLOB 2CXNA 2V7WA 2UXBB 8GPBA 1IL0A 1XRJA 1OXXK 2GVDC 2W2KB 1I7PA 4HFRA 3CU5A 2XOKA 1TEHA 3SFZA 2VHYA 4QWWA 3SC2B 1LJ8A 2OM2A 4CKEA 2DGDA 1U0OC 4X8MA 3Q9SA 4XYMA 1G38A 1UM8A 4ZCMA 4L57A 3E9ZA 1IXZA 4CFYA 4BVHA 4O2BF 2BGKA 3N58A 1GGNA 1QFJA 3WHKA 1RAIA 1PJAA 1XZ8A 4CMEA 4KE8A 1KHTA 1UXIA 5JRDS 2IYPA 4E5PA 5D87A 3CF2A 1IJFA 3EMKA 2V6FA 3CPEA 1FNDA 2DCUA 5HIJA 4O2AF 3V4FA 3GX1A 2QE6A 4HWPA 1DQSA 4LF5B 2IXEA 4IIJB 1IU9A 3G8CA 3GJ7A 3TLKA 1LW6E 2CUTA 3IMKA 1FS5A 3ZEIA 1NVUQ 1SHLA 3OIUA 3CZ4A 1ZESA 3AUFA 5KTOA 5CBPA 2ZWIA 2EEZA 4RKFA 5GMOA 2VXCA 4EY4A 1CEYA 5KYUA 4Y2PA 2ARKA 3ORFA 1U7PA 4PPGA 4WJZA 1RU3A 1I10A 4KLZA 3WKAA 2BFOA 4OB6A 4NDNE 1KEEB 1T24A 2P9FA 3TTYA 3DHWC 5J2TF 4YMTA 2MINB 1R88A 3AOEC 4MV7A 5K0SA 3TVTA 4AC9A 4YWHA 3T9BA 1K6EA 2UVDA 3ZGLA 4XTCS 5G41A 3CKLA 1IMJA 4ONEA 2GHRA 2F17A 2G28A 3M3DA 2R60A 5BV2P 1ADCA 3C4QA 3OE4A 4DIOA 4YHHB 3QLVA 2ZRGA 3ET5A 4H3KB 1DAKA 3E35A 4NU6A 3QH4A 3H1BA 5COBA 4URXR 1ZSNA 4REOA 3V8RA 3NBQA 3P2YA 1OA1A 3VYTB 3FSEA 1JSCA 4R31A 1GQSA 3JX9A 5IXSA 2QZ9A 2AEFA 2QL5A 4B4UA 2YUTA 4CGZA 3MCTA 1RYNA 1CUCA 3DXXA 4NCIA 2FW7A 4QVKA 3T1VA 4DSOA 1YTUA 3ZHRA 1E4VA 4P3NA 4KFTA 3AEKB 2R62A 4LNUA 3W06A 1W88A 4WGFA 4FYHA 1JWLA 3MS2A 2DFTA 4ZQIA 4Q1FA 1GG9A 4FQ8A 3RB8A 1KTIA 4B85A 3H9QA 4KQHA 5U4QA 3AY3A 2FFBA 3QPBA 5DYNA 3OJEA 5JS8A 1KZ1A 1Q1ZA 2B2XA 4TROA 2PZEA 2W43A 3ASYA 4KACA 1YC5A 1CERA 4M76B 3WQBA 4PN3A 1JUDA 5HQ3B 4Q3EA 2WSSA 4KGZA 3HY3A 3SJBA 4RMHA 5FCDA 4KPFC 1M83A 3NEYA 1S1MA 3LT0A 4FGZA 1FFGA 1OKKA 4BX8A 3GA0A 3ZLJA 2B34A 1UMBB 4PG7A 3RRNA 2FWPA 3F5SA 2ZPAA 1F8UA 1P73A 4POAA 3IEXA 3VYSB 5F9MA 4GXRA 5EPEA 2P9EA 3L0ZA 3QVJA 2BPOA 2GSWA 2ZJ2A 4MLCA 4S1OA 5CM9C 4JI7B 4MW9A 2B4KA 2DH6A 3I1JA 4QRDA 4LC0A 4TKMA 5FYDA 2NSYA 4ZVSA 2IHBA 2C94A 4HXGA 2B4AA 2F1KA 1HDOA 1IAVA 2HMUA 3WADA 2IYEA 5P21A 1XLVA 3MTJA 1NMYA 4IUYA 1W0JD 1FP4B 3PR1A 1U7HA 3PFFA 3UT6A 1KOFA 2HBQA 3ONEA 4EG0A 4EPWA 1ZU5A 2KPOA 4MQ5A 1BXRA 4P08A 1KVSA 5H4GA 4NPHA 1JHRA 4KH1A 2HBRA 1W5SA 4RK4A 4M22A 3A1WA 2IJGX 2C9ZA 1F7VA 1C8LA 3P0EA 4ZPXA 3PKJA 2I34A 3NOVA 2FWNA 2O14A 3QU2A 4TV8F 4TYYA 2F4NA 4TS1A 4ZJUA 1FUEA 2P69A 1NDQA 2VR1A 3SDZA 3VSEA 3P0JA 1N0WA 4E3ZA 4AQYB 3THWA 1NQTA 4DLVA 1EK6A 2MYUA 4KQ2A 3IJPA 2P35A 1TF5A 3SIRA 5B1HA 1X8JA 1YIOA 1Z13A 3X2SA 4DNQA 1QH9A 4TN1A 1HKHA 1V3TA 1GTVA 2HREA 4M0LA 5JANA 3TG2A 1TZJA 3WK7A 4PC3A 4ZIRA 3IQEA 2JLUA 1HOTA 3OURA 3JTEA 2PL3A 4DIEA 4CTMA 5AKXA 1AF7A 5FL7D 5SYMA 2DFLA 2WJIA 2ZBUA 5DLEA 4YJ2F 3UJ6A 3GA5A 4BKUA 2RK3A 4ENVA 4ZZ1A 3IEMA 3JWPA 3UB2A 3PFWO 4OHFA 5I9BA 1BDHA 3G9UA 1W19A 1DRKA 1D2CA 1N2CE 3EVTA 2ZTMA 4GOMD 4UEJA 4UTOA 1GSIA 2ZREA 2QVGA 1N6IA 4L50A 5REQB 3VDQA 3F6EX 4B7XA 5ARCA 3AFOA 4P8RA 5EYPA 1V8PA 3F2IA 2YIJA 4G5QA 1HTWA 4P3XA 1G19A 3I83A 2CUKA 4FLMA 3KC2A 4V0RA 5JD3A 3L7DA 3FOAA 1WCYA 3I4FA 4R16A 1JA0A 2L17A 1X7XA 4W6ZA 3FVWA 3K1JA 3HMKA 1E2FA 3I2IA 1E3EA 3EZXA 3REGA 3SX4A 3WWDA 2E5WA 3GFBA 1TNDA 3OG9A 4MWBA 4RF4A 4MPRA 2PMBA 2ZAMA 4PSCA 1MP0A 2HEIA 2FP4A 1PWZA 1TRHA 1DAPA 1XPJA 3C3EA 3HVHA 5HS6A 4EHFA 1YJ5A 3TZBA 2P7IA 3BPSA 3TL6A 5B3AA 3F9IA 3GFQA 3RTAA 4LV5B 4D1YA 1RS0A 1VKZA 3P19A 3RS3A 3T9DA 5KWIA 2W11A 4Z0PA 1C1YA 1QAQA 1YJBA 3FZYA 4BVFA 4Q19A 4WOPA 5JD6A 1EH5A 5L51A 5EJGA 1Z4NA 3TLZA 2C04A 4QLOA 3UTCA 2F90A 3DAHA 3FCOA 2NV2B 4GPTA 2PD4A 4KO3S 4E5VA 1QG2A 2NTEA 5FUWA 4FW9A 3V4OA 2I7DA 2BFEB 1QXSA 2F3PA 3DL0A 4X71A 3UKJA 5A2QA 4G07A 1YQDA 3ZWPA 1Z8HA 6PFKA 1OLXA 1Y8QA 4LGCA 4B17A 4PG6A 4DA9A 4Y9DA 4IFIA 3C85A 2IELA 4BFZA 1RLJA 4RDCA 1RCUA 2C07A 1DIOB 1XZQA 3GCXA 4YRDA 4EB8A 2R8YA 3WLOA 4TWZA 4FE7A 4HVTA 1QK5A 1CUSA 3TI9A 4IXMA 2RKWA 5DCYA 1I2DA 4KWEA 1OPRA 1QM5A 4LXUA 3ZU4A 1TECE 4E5UA 4DG5A 4IXNA 3ND6A 5C9ZA 4K6HA 4PRKA 1KVUA 1I2AA 3ZIDA 3HCWA 4JVSB 5ITSA 1KMIY 3ES9A 4Q3BA 3WRYA 3CF6R 6REQB 3RM3A 3KYIB 1SZCA 1D1SA 1LQ2A 1I94B 3PI7A 4EH1A 1ZXBA 2DFVA 1H3NA 2PDAA 4DHEA 2V4ZA 2BT4A 2I4IA 3O2NA 1TFRA 2OFOA 5BMOA 4WLUA 3JU3A 1EHYA 5DI9A 2DLCX 2A1UB 3BEOA 2WUFA 2ZUCA 4OA5A 3Q15C 5FD8A 4G63A 3AI3A 5FAKA 5AHXA 2O0JA 3HBAA 3AETB 3NHJA 4JSTA 4LZNA 5DDIP 3CF4G 5EFZA 4ZAVA 4H1UA 4BFUA 1A1VA 3GFPA 3ETEA 4P54A 4PLCA 2VZ0A 4ETNA 5K3CA 1XMOB 1M7BA 1OWNA 2J5KA 1QVWA 4RESA 4CFSA 1G17A 2GK3A 3RAJA 3ORRA 1HETA 1VPTA 2W6NA 3DAGA 3HZHA 3PRKE 5CMLA 3NC1C 2QZ4A 1K6MA 3NO4A 4IHJA 1JNYA 2ZU0C 2QRZA 3P9SA 1H2BA 5PNTA 4O2RA 4B3IA 3M9LA 1W5AA 3JTMA 1I7DA 3OLYA 4DREA 4QYIA 3GQBA 1PX2A 1QIEA 3HMQA 3OZEA 3D4PA 3KJGA 2A4MA 1K63A 521PA 2C03A 2XCLA 4MI3A 1HL7A 3RUDA 2HZBA 4AQDA 1KEUA 4ZVNA 1IXYA 4BNGA 4ENRA 3SOZA 1DJLA 3EOZA 5I3ZA 2D54A 2YTZA 3SHFA 4ETWA 5K8VA 2PRYA 4L2IB 5EEHA 3ZS8A 1FSSA 3IEKA 4RXUA 5F5XA 5JXJA 1GUAA 1YH3A 4FSXA 1TM4E 1UWCA 3ETNA 2LTAA 1YQTA 2VYQA 5GONA 3RIYA 4AJ9A 3B53X 4C6SA 4MW5A 4UU8A 3OQHA 1IN6A 3Q3HA 4JLOA 4F04A 2IS6A 4LFCB 1T9GS 2X9VA 2BHTA 2FF7A 2ZSUA 3T4PA 1XX6A 4MKGA 4AWXA 3PRHA 3PGVA 4AO8A 1C7EA 5DHQA 2J45A 1EX9A 4DUYB 1PV4A 1CQIB 2L69A 3PD0A 1GFSA 2I71A 1OHHD 3GHYA 3WRWA 7YASA 3E4CA 2R1VB 3ZWKA 1MPTA 3PGA1 2NT4A 5E1DA 3TH5A 1XO1A 1LFDB 3I52A 3E9CA 3K9LA 3R3XA 4NENA 4XQCA 2CF6A 5FKJA 1ODKA 5DK6A 3X3HA 5IH3A 3ETGA 2BEJA 1FDWA 3T0IA 4JENA 4RPKA 3HXLA 3KAQA 1EP2B 1M2GA 4E13A 1FMLA 5I3CA 1H4QA 1OXUA 2GESA 2X41A 2G5PA 5EWLB 2DERA 2PRSA 2FQQA 3SR0A 5AK0A 5IWCA 5KS2A 1OIXA 2XCQA 3H83A 5FTWA 3KFLA 4B7ZA 1F20A 2D2XA 3AUXA 4CLOA 1UBGA 5EJ5A 1MAVA 3IULA 4M83A 3ZD6A 4BQEA 3CEJA 4YLEA 3L01A 1FK8A 2XI4A 1U8AA 3FKQA 1T1EA 3TLBA 1WSBA 3MTAA 3Q4GA 3QSYA 1RRVA 3JZDA 4KU4A 3IV9A 3JXEA 3T95A 4DBVO 2XT0A 2R6FA 3H18A 1TVCA 1KJQA 5EI5A 1XI2A 4PQYA 2GCOB 3ENNA 5HZGA 1FDIA 2GPYA 1I4DD 4P84A 1H93A 1SRRA 1DUIA 2F3RA 2H3EA 4AF7A 2TMGA 1KAEA 2HQSA 2WE7A 3I01M 3ORSA 2N47A 4B3SB 3MT0A 4PBTA 2H1FA 3N86A 5HMLA 5JI3E 3KL2A 3VR3A 2Q4TA 3K70B 3BMQB 4ZK6A 5M34A 4FGLA 1RRCA 2G4LA 1ZVJA 2QP4A 1E9VA 2QBYB 1ZGJA 4OHOA 5GGXA 4AKTA 4PCUA 1H1LB 4J03A 5EUCA 1NMSA 3DZJA 2F43A 3OWOA 3D6AA 821PA 3JARA 2HU5A 1C8VB 3KR0A 3I2GA 4IEEA 4ROSA 3TSOA 1WB9A 5EXSA 1CV2A 1SCIA 2PX2A 4FI3C 4RHEA 2VHZA 3FLAA 4OXXA 1YB5A 2CHGA 4Q4AB 1YBFA 1WHSB 3AHHA 1Y3FE 2O7QA 3HQ4O 4JYPA 4BIMA 2DQKA 4G5OA 5ICCA 4D9HA 1D2MA 2GBFA 3SN6A 3VHXA 2QN9A 3FHTA 3ED5A 3NM5A 4M38A 4ESHA 3D7RA 2PJUA 1H1TA 5T5QA 4QG7A 1NUSA 4D8UA 1SC6A 4FB5A 5JI2E 2BP7B 2RHHA 4RTMA 1NGSA 3I6MA 1Z6PA 3GH1A 1R4AA 1U5BA 1I3OA 3AZOA 3SHQA 1J39A 1NFRA 2JI7A 3EXIB 3EIQA 4LOIA 2P6UA 2FEMA 3E0QA 2JEZA 3L0CA 3N2KB 2LZ0A 2H63A 3QE4A 3GFTA 3TQQA 5I9NA 1NULA 4DV7B 3M6WA 3HKBA 4IRMA 1L1RA 2YWHA 1AMOA 4URZR 5IMSA 1OC4A 2JATA 5E6UA 2I76A 4RS3A 1EUDB 3C3AA 5CT5A 4QFDA 3FCXA 2QD5A 3S29A 4F56A 3KYCB 3RIHA 1RE0A 3QEMB 4ZJZA 4KBFA 1LDNA 1KP2A 3PEFA 2C3MA 4XIIA 2WVHA 3U44B 4ZP1A 3D3WA 1OSNA 1XP8A 1E9RA 1X87A 2DPXA 2W2XA 3WL4A 3M4NA 5CXUA 3DH0A 5LNK6 1TI7A 3V6MA 3DMTC 1MOSA 4TS3A 2P1RA 4KYTA 1L5YA 1CKEA 4IGIA 3QITA 4BE4A 5KNDD 3H4TA 4G5HA 4IIJF 4LBWA 3A3KA 4XWOA 2IODA 1Q57A 2H2FA 4GE3A 4K2AA 5GM2A 4G1EB 4TT3A 1M8FA 5DTIA 4JLAA 1SCUB 5BSUA 3TCKA 1NY6A 1O87A 2MSLA 1ELOA 3HADA 1NLZA 2LXNA 2VUSA 1C9JA 2OYSA 2P2ZA 4MQEB 2JGMA 3NG1A 4CTOA 1D6MA 4FNMA 3U5ZB 4S3MA 1OW3B 4TWBA 4MV3A 3SYMA 4BQFA 2O1WA 2IHVA 2OP1A 5GJVC 3R75A 3BFXA 3HUFA 4BNKA 2FSGA 2C7RA 3AG6A 4V39A 4TMWA 2P9GA 4MQ6A 3U62A 1UJ2A 2XEXA 1MW9X 3KALA 1XEAA 2CXRA 1J1UA 3L8GA 4HS9A 2Q6TA 3UWOA 2NLOA 1O95D 4Q3OA 1U7WA 4V03A 3W3AA 1CBUA 3MWDA 4AJNA 3V2UA 4F3RA 4NFSA 2H4YA 1H4SA 1CZOA 1GCAA 1K68A 2AN5A 1P5HA 1ORRA 3A31A 3G1TA 1XTTA 2E2WA 1NXVA 1Y7HA 1C2YA 2P1ZA 2P9QA 2WAOA 2Y99A 3K0CA 3O4RA 4I1RA 3W5DA 1LTQA 3QBVA 2JLWA 2CMDA 1PJ8A 1P1RA 1SVUA 3Q9UA 4FDLA 4QASA 4G25A 4K26A 3EUAA 4LRQA 5B7NA 3M70A 4ECEA 2QNBA 5HIAA 4ENSA 5E4FA 2H48A 3HRIA 2H2WA 3LX4A 1G4UR 3TBFA 5BUSA 4FCTA 3L04A 1E64A 3BC1A 4KOAA 3DKPA 4U00A 4EITA 2W0MA 2X6QA 3CWZA 5JZVA 2XH8A 3W6OA 2OILA 2QSZA 3S8EA 3LA6A 1JSLA 2CNKA 1UEJA 3JVVA 4OO3A 5AOCA 1L5HA 2GLTA 3C70A 3TW8A 2XCIA 3BWDD 1N0HA 1KH1A 4I8XA 1JR3D 3RVPA 2PGAA 2JFNA 2D2VA 4PAGA 3A25A 4GZMA 2RG1A 2GZ2A 3F8TA 5ESDA 4QXPA 1QQ5A 2ZRDA 3JAKB 4BQPA 3I2YX 1IC6A 4ZODA 3ZWNA 3ZGOA 3D0QA 4FSDA 5AHOA 4CEIA 1XD8A 1O03A 4M8KA 3GLTA 2X2PA 4J7CA 3BULA 2QR5A 2DVMA 3CX4A 5AJHA 4YHBA 1AS3A 2FFJA 3HVKA 3TSYA 2PKYX 5FHQA 1GZ7A 5A6SA 1N1GA 3UQZA 1QZXA 2NUAA 3GNTA 3PC3A 4NZMA 4NONA 5ENDA 3B38A 3Q0TA 2HNBA 3Q2KA 1IN4A 1D1TA 3FSGD 4V0ME 2NU8A 4YJ3A 3R8FA 2WSLA 3IDOA 4LXGA 3D6FA 1KEPA 3LUKA 4HAZA 1H69A 3ONVA 1W30A 3KKLA 2ZVJA 4R40A 3FB1A 4Z8XA 1UXHA 1C0PA 2BWJA 4WESA 5JXHA 4NRDA 3I09A 4QICA 4AY4A 3N39C 5EJ6A 3NHMA 1T0JB 4MJLA 3V3KA 1U1DA 1PFYA 3P94A 4MICA 1WD7A 2IEZA 1HF3A 1ZUWA 3EAFA 2JGLA 5DWDA 2PVCA 3FUCA 5DM2A 2VH5R 1UANA 2IYSA 2Y1GA 1LB1B 2PMFA 3SBOA 4CXMA 1P1JA 4R81A 1M34E 3E8XA 3EEIA 3ICVA 1ESNA 3L7OA 4MVJI 4DQ0A 2G40A 1C4WA 2GB4A 2PSJA 3U56A 5EJIA 3NRCA 3ZJUA 3FZEA 4MEJA 1JZSA 4B79A 4CCYB 5JXWA 2OE2A 4ZALA 4MP3A 2OV4A 1KAMA 1US8B 3TUIC 1BHJA 1QHHA 3OA2A 3ETLA 4PVDA 4D3FA 1I51A 9MHTA 3FAKA 3R74A 4K6GA 3RBAA 5IFKA 4W5RA 2JFUA 2Z57A 1EXNA 1L4BA 3WGOA 1A2QA 2FPPA 4I19A 2NPOA 3JQEA 4Y2XA 4F85A 1GTRA 3WIDA 1JR2A 4HQ6A 2B9VA 1CR0A 2OHHA 4DRXA 2J3HA 2JHPA 3ORHA 3ZYCA 1ZR2A 1SXJC 4F3NA 5H81A 2UYOA 5JAIA 3JW8A 5BSTA 5BYJA 4XRGA 2H1HA 3TXXA 4C0QC 4Z4CA 1J0CA 3VBEA 1OFUA 4GOKA 2BFFA 2ODNA 3EIUA 5AW5A 2O4UX 4B48A 1NKTA 3QYJA 3TMKA 1UXOA 2FR1A 3UAGA 3EVGA 6CHYA 3RC8A 1JHAA 2VJCA 3DVLA 4KE9A 3SJZA 3VNVA 4MPDA 1QORA 5CK4A 2WUVA 3D3KA 1GITA 1KXJA 4ZOCA 3D2AA 1JIIA 2WOJA 1PNTA 2PGIA 2WV9A 2X0FA 3WRXA 2XBUA 2HF2A 3K70D 1AKRA 2J46A 4Z7NB 1JHMA 2C9YA 3SQOA 2FPMA 1XV5A 4P31A 3V1YA 2ZOSA 3AKCA 2I99A 3C8DA 3DT6A 4IKEA 2VJBA 1W0KA 5EQTA 1O4VA 4RXTA 1PJZA 1YT5A 2ZR0A 3FPJA 3IHKA 1N33B 1XHEA 1CHNA 4NNOA 2E87A 2ZR7A 2OSVA 4DCPA 4NZOA 3WICA 1H85A 5L3VA 1UBUS 1QYDA 3PDWA 1BKDR 3SYLA 1TPYA 4JB8A 3JQGA 2QRNA 1E8DA 1W1UA 2V5AA 3Q5DA 4Q1AA 1F14A 4RE5A 4XPZA 2IXAA 4YCAA 4YC7A 3F6CA 4YT5A 1E3TA 1P6UA 1FVOA 1QZUA 1Z8FA 3K9WA 4MVWA 4YYEA 2I91A 2O7VA 3CWQA 1DXQA 5FF9A 1GN9A 1U9YA 2X5XA 1OROA 2FGKA 2XTJA 4CMIA 4EFLA 1J8MF 3TLGB 1SUPA 3AWIA 3P2IA 5D3ZA 3PA8A 1G2IA 3O1IC 2DXIA 4H6VA 1KO7A 3TNFA 1SJ9A 2QN2A 3ND9A 3HM2A 2P9BA 4WNAA 4KOEC 5IBCA 3AVUA 4FMDB 4JR1A 1CLEA 5JNWA 1WPQA 2PQ2A 2ZBGA 3UMVA 1CJBA 5AI4A 5K0CA 1POXA 2X6TA 1DKLA 1MDFA 3WGJA 3FWHA 4MQLA 1CY2A 1CRQA 2QORA 5EPOA 3CNOA 1M72A 3MSXA 3MW8A 5CIYA 1PFWA 1AK2A 3IEPA 1M73E 3ZIAD 4V2UA 2JS7A 3ETJA 2A1TR 5DEOA 2F8TA 3GB9A 3LPAA 1RTKA 1AZSC 1YZTA 4K3VA 3RYHB 4FMBB 3GLUA 5T67A 3GJ6A 1KU6A 1FNCA 2FP3A 1QFYA 1VI5A 1W2HA 2UUOA 3PWZA 3HCFA 3DKIA 1VZ2A 3QI7A 3KCQA 4LHXA 4C3VA 5IJWA 1KQFA 5C3MA 1OILA 5D6OA 3KHKA 4XGKA 3ZOKA 4JI8B 3A4VA 3AB7A 4QECA 1XCBA 1CRWG 4GZ5A 3NAMA 2XDYA 3HCBA 4RZSA 2FPGA 4ITRC 3AY6A 3R9WA 1NMEA 4C30A 2IUFA 1DC8A 2R4TA 3N87A 4OJQA 4WL0A 3WJ2A 4HP8A 3UCFA 1XD2B 3MF4A 1DEHA 1Z08A 1K6JA 1EK5A 4I9UA 3S1AA 3WTBA 4BVBA 4LDAA 4D9JA 1FJXA 3CEPB 3LWBA 4C05A 2FRVA 1UZMA 4PGGA 3P2OA 3JQBA 3M1YA 5JJIA 1QFZA 1E77A 2XA9A 4MDEA 2W58A 3WLAA 2W8BB 2WF9A 2XGGA 4LJ6A 4NQRA 4BDSA 4BRWA 2RC5A 2C97A 1I1NA 2QY6A 4YLGA 5ALOA 3KEOA 2OXEA 1TT7A 3ZLVA 1MQ8B 3K4HA 1MJGM 4EK9A 4CLRA 4J2TA 3WWYA 2GBLA 3D3QA 4KXXA 3NYWA 3SKVA 5HFAA 3N2LA 3HZZA 3E2IA 1NNUA 4XLLA 5CRIA 4QG3A 3ENZA 2JJ1A 5DI3B 3OIGA 3LHDA 4FPXA 3TJZA 3ITNA 1H2HA 3ADKA 1JEYB 4DR4B 2OUKA 1U0GA 1XEWY 2VDWB 5AOAA 2JFVA 3E5RA 3K31A 3D4IA 4YRAA 1RZRA 1EUQA 3N3BC 3W2TA 1KBZA 4YR7A 2W4IA 1XU9A 1MOPA 2XGMA 4D0GA 1Q17A 2EFJA 1F8FA 2C00A 1LSSA 2V96A 2XZOA 4OK6A 2AXPA 5FQOA 1XWWA 1TYCA 1G3MA 2YQ5A 3G0CA 2I0FA 3LFHA 1FFWA 2AKYA 4MROA 4XEHA 4EB6A 2H3HA 1U7DA 3WYAA 3C5EA 1PYGA 4C1NA 3S6JA 2LIVA 1R6XA 3I9JA 3DUWA 1VHLA 1R3UA 3LVBA 5M7EA 4LY0A 3GMIA 3ZS9A 4PC7A 2EJCA 2IC5A 3OCZA 2WT4A 5DOVA 2OR3A 1OFIA 1GWNA 3MOSA 1GT91 2PRJA 3PWKA 4BE9A 3RT7A 3ZVRA 1IMOA 3FZGA 1G8MA 3IOYA 1M0TA 1MO2A 1PVDA 3A2NA 1GL9B 1MT0A 2W48A 2G8NA 1ZXXA 2PU7A 1NWCA 2XUZA 3KJNA 4R2KA 4B9AA 1NKVA 5B7QA 4KR7A 1LPNA 3JD4A 4NTZA 4TMFA 4V24A 2CNBA 4J90A 4MEBA 5EKDA 3A58B 5FTMA 1FVXA 2NYAA 3T3OA 2VDKB 4EUNA 4JB3A 4ALIA 3O8QA 4LSGA 1KAHA 4YP9A 3PTLA 4AAYA 4WBNA 1JSXA 1PR4A 1UBFA 2OXTA 3THRA 1OR8A 1NIJA 1KJNA 4ZKDA 5FAXA 2JW5A 3HO8A 4WKGA 2OCKA 3EEOA 4NU5A 4RK0A 3ILYA 2GZRA 5TSDA 4KH0A 3NW9A 4ITVA 4BLVA 4P36A 5DH9A 3K15A 4AECA 3DAYA 5CX1A 3CKKA 1OMOA 1PR6A 1ST2A 2KB0A 3KVRA 1XDWA 3B78A 1QZZA 3QIAA 3ZPXA 4JEHA 5AVOA 4J0EA 4KTTE 1XNGA 2R4UA 4C0JA 3EOBI 3LVRE 4C6TA 4BLQA 1YQXA 5AICA 3BS4A 3EXHB 4RVGA 3RYTC 1JIXA 1KOJA 2D2EA 4FX5A 3ZUGA 3C3CA 3E2PA 1S7GA 1XQ1A 3F8SA 4EJ2A 1E20A 1YVRA 3CN9A 3OOYA 3HM9A 3VH1A 4XCVA 1VJDA 1XMSA 1F2TB 2HGZA 1NZFA 3A6GA 2YWXA 4AY5A 2CCGA 1DEXA 3TE7A 1GUZA 2CFOA 2YXLA 3T1HB 1YQGA 2IF2A 2H5IA 3E7PA 3GUZA 3SNKA 3TQIA 4CNBA 3DVAA 3D7MA 1HR0B 4QXRA 4D45A 3CUSA 3PJFA 3WL3A 1MB9A 2J9FB 3SX2A 4CEJB 4DV2B 4AP9A 2W00A 3G7UA 4WFIA 4ZYYA 1QHYA 1WKBA 4L9SA 1ZNQO 5CXQA 2QVXX 4OEHA 3NATA 1RRFA 3GEMA 2H00A 2WJWA 2IH4A 3MGGA 1NW3A 3DUFB 3PEEA 3IQWA 3V8MA 2F4VB 1G6HA 3BJRA 3NHAA 4LZZA 1QHEA 1SUBA 5EJMA 1J7JA 4E2YA 1YASA 1Z2AA 2XLBA 4OJMX 2P30A 2A1IA 1GTZA 4UD2A 3VPAA 3IERA 4CEHA 1P2UA 5EE5B 1NMZA 4QUGA 1U5AA 3IMGA 4JD5A 2AXEA 3JQCA 3ZWVA 3HKCA 4V3BA 2PJRA 1M74A 3PCTA 4B3GA 5AOVA 3N7UA 3NWOA 1NI4A 4KR9A 1XXHE 1NQVA 2IZ5A 2QW0X 4COKA 4BGDA 5KQLA 4RANA 1VJRA 3ZXIA 4BMPB 2IQ5A 3E5HA 4OJYA 4L4RA 3WIVA 2DKNA 4GOND 3BGWA 2JGAA 4AFNA 4D3YA 1EDDA 2YFHA 2RGDA 1PP4A 4QFCA 2BELA 2OTCA 2GJ4A 1V2GA 1OPXA 4KLAA 4DR2B 4QOSA 5DYYA 4GOJA 2JAQA 3TPFA 4L76A 5AR1A 1KARA 1QF9A 2KMLA 3QLVC 2BV3A 2C4VA 1UJ4A 3NT5A 1RNLA 2CKDA 4XDZA 4ZO6A 4HL6A 1D2HA 5K8TA 4BWVA 4B80A 1M67A 2ZXUA 4DIFA 4JUBA 4XIYA 2J3QA 5GJWC 3T7KA 3W7BA 4CDNA 4YX9A 3WLEA 3HUEA 3QBJA 1Q7RA 2HPHA 2G9UA 2P5SA 2PJDA 2XF2A 4I9FA 1NVEA 2YJGA 1YRWA 4LCEA 4MR8B 4WSOA 1XG5A 2DFPA 2GKGA 3CGGA 4YXWD 3H6HA 3FTFA 1MCZA 2HDNB 2ANBA 5KVSA 5ESRA 1U8EA 5CXSA 1EX1A 1GTG1 1DIGA 3CR3C 3UWMA 1EDEA 2C3UA 5KQMA 5M29A 2VQDA 2JKVA 1GZVA 1YKGA 3HWWA 3NIWA 3RSZA 2VO1A 3SC3A 1WWKA 2NZXA 3MBIA 2FQYA 2VRWA 4ZD6A 3QFSA 3OTQA 4Q21A 1D2GA 2JCYA 4B4VA 3EIXA 3OZFA 2IBTA 4O8ZA 5HTKA 3ESQA 3B48A 1NU6A 1U2DC 4M1KA 5AHKA 2D62A 4KFRA 5ALJA 4X20B 3NPMA 2C59A 4H60A 4JOBA 1D03A 1F06A 2NAFA 1MV8A 5BN3B 1UQRA 3OMWA 4UPVA 4WN3A 3ZY5A 3JS5A 4ZREA 1USIA 4YPFA 2XMZA 3VYVA 2XXAB 2JIZA 5BV0A 3IMFA 2XMCA 3P0IA 1SUWA 2DPHA 1MQSA 2C7BA 3QX9A 4R1TA 2PGXA 2WZQA 1MHTA 1EWYA 1S6YA 1X14A 1P33A 4JI6B 4UE3S 2MMGA 3HDQA 1A96A 3OT1A 4J9UE 3EZGA 4MB0A 4MRRA 4I1PA 5T8KA 1MQAA 3IE1A 2EKPA 4BO6A 2WUEA 4WK2B 3Q8LA 2AEJA 3CRZA 3K1YA 4KHZA 3TAUA 3WG9A 4B2YA 1H8ED 1XZPA 2AFHA 2HT6A 3KJQA 1EM8A 1TTPB 4IZOA 3GLIB 1X7ZB 3HXMA 4UVDA 3SXUB 2VJQA 4L78A 4OQFA 2I2XB 3NXSA 2OECA 4TRJA 4ZT6A 1EGMB 1JHDA 1QOPB 2BDTA 4UASA 4V3CA 3MS7A 1NXQA 1Z2CA 1R4MA 1T9ZA 2DFNA 1EFAA 2CBZA 4UNIA 4Y8VA 2HHAA 1LLCA 4JBLA 3U4QA 3AP2A 2B4TO 3TAHA 3ZHTA 1IQRA 3MD0A 1QX4A 1MAHA 4GRIA 4KPUB 4S35A 4MS3B 5AM4A 5H16A 4CR6A 1G5TA 3CX3A 3CNHA 3KYDB 4FD2A 1KZYC 2WJ4A 4G9BA 3FXAA 4NEQA 4QO7A 1FMFA 2DZDA 1HO3A 3LUFA 2N1BA 2XB6A 3LNCA 1GTSA 1DWPA 4UVHA 1NW4A 1MG5A 3ECAA 3L8DA 2K7FA 1KDRA 2CFTA 4L15A 1I3NA 2XHEA 1AKTA 1W4CA 1MNAA 1CS0B 1IUNA 2BFMA 5I4IA 1VJ5A 4LHSA 2GT1A 3ZV3A 2QT9A 2VYVD 3U7IA 3AUUA 3RNLA 4TMKA 3UJBA 2O6LA 1JLLA 1FPMA 3AK4A 4JJ8A 5KAPA 3H11B 1DC3A 2ZATA 4ZQGA 5CVEA 3SIXA 1DLJA 4F93B 1ENPA 1PZHA 2DQYA 4TUYB 5JROA 5DOZA 1SRQA 3A6LA 5C31A 3UMSA 5L40A 2COKA 2YYZA 3CO5A 3L18A 4LYFA 4NS4A 1JDNA 2DEUA 3EXEB 3LZCA 2I1LA 4BO8A 1I7LA 3X2EA 2ECPA 2WKQA 3WRVA 3PNBA 1Q12A 3T1NA 2C2OA 3PNYA 3QELB 2REXB 2QNRA 3KT6A 4L07A 1G8KA 5IJ0B 3KZ1E 3AU9A 5FWXB 4HC4A 2PSHA 1TF2A 3WGKA 4S1PA 3AHJA 2FG7C 2IEDA 3CBQA 1U7OA 1YRAA 1P2TA 1KC1A 1CULC 2XTNA 2ZI5A 4FZRA 4ZMBA 1MLDA 3GUCA 2H1IA 3CV3A 3IO5A 2JIQA 1L5VA 3ELYA 5C8XA 4OYHA 5EZYB 1SCJA 1BNCA 2PT6A 1PFUA 2EKQA 4LHYA 3LX5A 1IK4A 1VSUA 2CVFA 3KRTA 4LECA 1JIUA 4RH1A 3AZPA 4N76A 2YH2A 3KVYA 1L5RA 1W48A 4WLFA 5ELLA 3GLGA 1BOOA 4E12A 1Z5UA 3IAUA 2WJZB 1T9BA 1R9JA 1NG1A 4RZ2A 4FZVA 5AVZA 3IBCA 4G6ZA 1JILA 5KOIA 1KJZA 2Q5CA 3J7TA 2WM8A 3UK0A 2Y6UA 3OLWA 2EDCA 3A4IA 4JBXA 4U2GA 1DJQA 2GPBA 2XAAA 3GMSA 4M87A 5K0NA 3ROGA 1ZRMA 1SY7A 4ZO8A 3KKKA 1OBFO 4NCXA 1ZGZA 2ORYA 4IIDA 5KNBH 2H06A 5ICSA 2UUCB 1VBMA 3FW1A 1CB7A 1QCYA 1EJ0A 3LDUA 3IR7A 3OJOA 3GW8A 4EECA 4H6WA 1TMKA 1ZD8A 4H7KA 5DM70 3ZGYA 4F2PA 4J07A 3U4DA 3QG5A 1A1SA 4C4OA 5JBNA 3BSFA 1ZM2A 3D7LA 3VO9A 2Z0MA 2ERYA 3C97A 3URKA 4D9IA 4E09A 4KLRA 2FPRA 4DJTA 1L4LA 2RAUA 2QP3A 4FYYA 3KVNA 4AUEA 1KTVA 3UIEA 621PA 3I0ZA 3ZX4A 1N8TA 3E9YA 5BOSA 3DEKA 2E82A 4PFSA 5ENVA 4HRAA 4FMDF 4PLVA 5IABA 1ZM3A 1YBHA 3GYBA 3UQYS 3UPTA 3RIEA 3L0YA 1XP5A 5J1TB 2CMFA 1YI0A 1VCHA 2VA9A 1Z34A 4FEAA 4G01B 3LS2A 5DKFA 3EZFA 4TTTS 2Z95A 4KVGA 3JASA 4K9PA 5M3BA 2OAP1 1G2PA 2UAGA 3CURA 4TLEA 1MDBA 4BO2A 1UBJS 2FPLA 2ZSHA 3VTAA 3HJBA 3ZHCA 4H27A 2P2DA 2P90A 1VPVA 2AIRA 2GPTA 2PMEA 5ALSA 1H4VB 5F76A 4MSUA 3T3DA 2K5UA 2YOGA 4OQ4A 2CJYA 4EHHA 2AN1A 1OCEA 3GT0A 1OLSB 3OETA 3PFBA 4NENB 1ZG3A 1GQYA 2HOQA 5TDHA 2UU9B 1U9IA 3EJWA 1XQ9A 4Z0HO 1KDVA 3A05A 3UVEA 4Y67A 1FZTA 3E3NA 3IPCA 2WWHA 3LT5A 4MHTA 3FCSB 2IZ0A 5KVQA 3G5UA 2DY1A 3F7NA 1Z4KA 2GEJA 4UREA 5AOBA 2A35A 3A9VA 4L6AA 1QFXA 2H59A 2GASA 3B5EA 3BGDA 3NUGA 2C4WA 4QDZA 5D84A 1CY6A 2H1SA 1FFCA 1QGUA 2GEUA 4AJPA 5SZHB 2CWDA 1EQAA 4DLWA 4EHIA 4Z7QB 1Y6GA 4BBZA 1J21A 4B35A 3SQDA 4L85A 5IKXA 5ICGA 1NTRA 1ECLA 2QPAA 3KT3A 1L7PA 3NGXA 3AVWA 1Z39A 2H2AA 4FCCA 1J07A 1CC1S 2VJPA 4Y6PA 2J48A 4X7MA 2W22A 3RHZA 1OV4A 2G0NA 4MWCA 4H15A 1OKKD 3LMKA 4U7TB 3B9QA 2Q0SA 1I0IA 1LF5A 2BTQA 2O2GA 3M33A 1WZEA 2O2ZA 4Q9HA 1DZIA 3CONA 4UHKA 2WR8A 2YYYA 1MC8A 1HDXA 1SVSA 2E4WA 2R6GA 1YS1X 3QVLA 4NFHA 5DHSA 4DLXA 2B6NA 4EI2A 4ZVOA 3HABA 5EVCA 1L6RA 1I6KA 5AW9A 2YN2A 1YRQA 1F6WA 2I3AA 1CG6A 2IIQA 2VT2A 5C8YB 3DTNA 4LZJA 2F43B 2KJQA 3ODPA 4MV6A 4WINA 4CUZA 1ZWLA 4GYYA 1JG3A 2FRDC 3OIVA 1LI4A 4MAFA 3ZJ5A 2HK7A 3NBZC 3ZR4B 3DV0B 2VL7A 3K5IA 3D02A 2LPMA 3VHLB 4H7FA 3TMYA 1II8A 4BLOA 4Q66C 1KERA 4KWTA 3VOTA 1G66A 5KOJB 5A4FS 4TGLA 3E3AA 3RFCA 4CIWA 4AKGA 3RGGA 1HLPA 4FW8A 2CDBA 3OQOA 3CA8A 3FY4A 2YNMD 2VZ9A 1PJ4A 4GAEA 1ZD2P 3KQWA 5KWEA 1U5BB 2DKFA 4UHDA 1UAAA 1E4EB 3GG2A 2P6MA 3MRSA 4DVJA 3A1FA 2OQ2A 1KOLA 1M8PA 4TTAA 4EL5A 2BFDA 1KORA 2OB2A 1WPRA 1QRUA 5B3KA 2C2XA 2PSEA 3M89A 1E3SA 5AO9A 1Q91A 2B83A 3G5LA 2PUJA 4RLFA 1RMQA 5JPDA 5JZMA 3ST7A 4ZI7B 4EPVA 5BYKA 5C1BA 1YJ8A 5DHPA 4F9EA 2HBYA 4HLUA 1UMDA 1V4VA 2W90A 4EFMA 5JW6A 3L82B 4R2HA 4FR5A 1P17A 2PWAA 1QANA 1ZK0A 3RVMA 1E3WB 4BMXA 4CIXA 2ZBEA 1MEEA 2G6BA 5BUZA 1W85B 5LDGA 3W5SA 3PXBA 1KZ6A 1THZA 1P1CA 3DOEA 2Y9MB 5EHNA 3AM1A 1F0NA 3PYLA 4JL5A 4C7OA 2ACKA 1XYVA 3L7CA 5GWXA 3QUTA 4YRCA 3GGSA 5EIXA 4IGAA 3B2EA 4Y0NA 3FBGA 1YZVA 5PGMA 3PXCX 3M0EA 3RYIB 4Q18A 1QX3A 4I9HA 2Y77A 4M4SA 2HSEA 1Z47A 4J1NA 2GJSA 2HCJB 4MUNA 3RSOA 1PZXA 3MMSA 3G0HA 1GTL1 5HBGA 1JEJA 5FO1A 4GR5A 1Q15A 1ISSA 1E1RA 3KBOA 3W0LB 4CM5A 5LZ2A 4BNUA 1K92A 2AQHA 5CIWA 3KZKA 4AI6A 1FYVA 2RJ3A 1NAIA 2YHAA 3AL3A 3NU1A 5AVXA 1SUSA 1PEDA 1V8DA 2GFQA 4OQQA 3EYAA 2WA1A 5HKKA 4O4IA 5CCBA 4Z6KA 1V5GA 3EGDA 3IOCA 3GH3A 4RULA 4EB3A 1T9AA 4J2OA 4P2BA 2WNIA 3HN2A 2WHQA 4F9TA 4FILA 2V7TA 3OQIB 3GPDG 4WH0A 5EUQB 1N2OA 3RIMA 1A5TA 1SIUA 3MB8A 1L5GB 3TTTA 3OCXA 2YCBA 4B3HA 4L28A 4PIPA 2BGTA 3HDTA 5JAUA 2D0IA 4Z1MA 3A6EA 2DLNA 2PH7A 3GBPA 4ROTA 1X9IA 5IDVA 1IHOA 3QEBZ 3IAS1 3HWSA 1C2TA 4R7GA 3P9NA 5EE0A 1Q11A 2Q0QA 4CIVA 2UUBB 1TAGA 2XNSA 2Q8QA 1K2WA 2Y27A 3BMCA 3CZQA 4IINA 5A3SA 2IH2A 4B5LA 5IUJC 3R4CA 3M4ZA 1COWA 2EIXA 2JF0A 4OBWA 4XRRA 3UYLA 2NSLA 3O2JA 4L74A 4ZOLB 1JEDA 2VPYA 3VRHA 3PQ2A 1MRSA 5EE1A 3V9AA 2EG5A 1LVUA 2OXIA 3ZGNA 4EGJA 3H5LA 1QB8A 4H16A 5LOVA 3KT0A 4OSPA 1D07A 1GPMA 3LPNA 3BQ9A 4CDMA 1CNMA 2D7DA 4ND7A 5KO2A 1IB0A 1G2QA 2HSJA 4OAPA 5AQEA 4C7KA 4KN6A 4A0GA 3PYMA 3K6SA 5FNVA 3NT4A 4HDOB 3GEPA 5KNBD 3LTEA 3AHEA 4KN9S 4KNVA 1KQPA 4X8HA 1B3RA 2C1ZA 3CNNA 5T57A 4HAIA 5EZQA 1GNVA 1JIVA 3DTYA 4Q00A 2H2IA 3OJWA 1R0KA 4HAWA 1SVOA 1TQ8A 2H1RA 1WA5A 4U7JA 4B84A 2FW1A 4OI4A 1BGVA 2QMYA 3GLFE 1N34B 5HK8A 3SF8B 3T0FA 4QFBA 5GTDA 3UOAB 1IN8A 1OTHA 1AT1A 1WDWB 2G9RA 1DC6A 1PK7A 2YWBA 4GR4A 1NY5A 2J8ZA 3II6X 3VPGA 4FHDA 1V1MA 2DM6A 4NSNA 2VG8A 4HDMB 4WW0A 5FTKA 4K05A 5JY6A 1SUDA 2R85A 1W4LA 3P5BA 1ZRSA 4ARVA 3NTVA 1ADBA 3EEQA 4RDHA 4JQZA 1M2WA 1DXHA 2VJLA 1Y33E 2WD7A 2YY5A 4PGHA 2BEWB 4IW3B 1ONSA 1W75A 5I5GA 1Q83A 3BZWA 3FX2A 2OD7A 2VH1A 3OCYA 4D0SA 3KD2A 2YJ6A 1Z83A 4L8GA 2J59A 4FONA 4LOJA 1XR3A 4CVNA 4WPGA 2ZSBA 2QPTA 3BBLA 4RFSB 4YP0A 3ILXA 4DAEA 5AKHA 2HJRA 1EEXB 3GJYA 4GPAA 2Q29A 4E08A 1PYOA 3KS9A 1RWNA 2GK7A 1TA4A 1KR5A 4KMSA 5AT1A 5KEIA 4CUKA 4US1R 4RD1A 1KK3A 5AQ1A 2X19A 1KAOA 4D9KA 1UOPA 4B6JA 1U8TA 1EUZA 5EMJA 4EA7A 1YQWA 3S2GA 3WDLA 5LMNB 1H2WA 4TKVA 4OJTA 2QN7A 1EUCB 1D0IA 4GPEA 221PA 1JJVA 4WMLA 4RHCA 3DWFA 1LSOA 1VA5A 3EJ6A 3EG9B 1YB2A 2VI5A 3K09C 2DPYA 3FTDA 5HIKA 5L6MB 3OU7A 4M1QA 3R0QA 3M9XA 1U3DA 6ADHA 2OGWA 1J7KA 3ZNQA 1JG7A 1IG0A 3IL2A 1RADA 3DVQX 3CSDA 2N3ZA 1UT8A 2QX9A 5K6RA 2BKLA 3EGOA 4DQVA 3KKEA 4KR0A 3VI4B 4N0PA 3BHJA 1RDFA 3K9QO 4IV0A 2PA0A 4L16A 5E3JA 1CUUA 1SC1A 1LRJA 1AF4A 2XWBF 2ZRAA 1E1QD 1YL5A 4J1SA 4KXQA 5B7PA 4KV7A 1VI6A 2PLWA 3FM9A 2WF7A 3W90A 2ETVA 3MZ0A 3TKYA 4EO4A 4YRIA 4MKRA 5ALMA 1T4GA 1VA4A 4D9MA 2OCBA 1WXXA 2ZJ7A 2BY4A 3DT9A 1A7AA 3QUSA 2P11A 5IT5A 2V7QD 2QTRA 4A16A 5A9SB 1QZTA 4N8DA 3PUVA 2C9CA 3GLHE 1MMFB 5T6MA 1TD9A 4J0IA 1JAHA 1RLMA 1R18A 4RL4A 3P27A 4RELA 5AP9A 5EHIA 4X63A 1HSOA 5D5QA 2JH8A 3V55A 1Z2PX 5B1IA 2RHJA 1K98A 3HLKA 2B99A 1H42A 3JQ9C 1SIBE 2B36A 1P2BA 4MQMA 2PKQP 1GDHA 2DQZA 3K1AA 4FYVA 4KSBA 3NIGB 2BJHA 1NXOA 3ZCUA 2QJRA 2EZUA 4D25A 4X1KB 2QTTA 3AJAA 4NJMB 3TPZA 5ALGA 2ZIAA 4CN8A 4TUYF 4LSMA 5ICMA 2GAFA 1NYQA 4MZXA 4AROA 4EG4A 4YTEA 4F9GA 3JZAA 1TJ3A 2J6CA