2MJ0A

Spatial structure of p33a mutant of non-conventional toxin wtx from naja kaouthia
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
66
structure length
66
Chain Sequence
MLTCLNCPEMFCGKFQICRNGEKICFKKLHQRRALSWRYIRGCADTCPVGKPYEMIECCSTDKCNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interaction of Weak Toxin from Naja kaouthia with Muscarinic Acetylcholine Receptors: Mutagenesis, NMR and Modeling Study
rcsb
source organism Naja kaouthia
molecule tags Toxin
molecule keywords Weak tryptophan-containing neurotoxin
total genus 8
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mj0A00
1FFJA 4IYEA 1VB0A 2LA1A 1HC9B 2CRTA 2GOOC 2BTXA 1CB9A 1YWHA 3NEQA 1F8UB 4OM4A 3U74U 1CRFA 1HC9A 4QTIU 2UX2A 1ES7B 1IDIA 1HOYA 1JBDA 4FAOE 1IJCA 4UY2C 1FASA 1ONJA 1TGXA 1LXGA 1G6MA 1BXPA 2NBTA 2L03A 4BDTB 2QJBC 2MJ4A 2BHIA 1CXOA 1KFHA 3NDSA 1FSCA 1B41B 2N99A 3BT2U 1CVOA 1JE9A 2UWRA 1BTEA 2VLWA 3EBXA 1NEAA 2X8BB 3LAQU 3BT1U 1ZADA 1FF4A 1KXIA 1IK8A 1CDQA 3NH7A 1CDSA 2J8BA 1NYUA 1IKCA 3KFDI 5IMTD 2L5SA 2CDXA 1CXNA 1QKDA 1I02A 1NXBA 1TFSA 1LX5B 2QJAC 1KS6A 5DZ5A 2JQPA 1KBTA 1PLOA 2H5FA 1CODA 5DO6A 4ZQYA 5EBXA 4XJJA 2H8UA 2MJYA 1REWC 4AEAA 1QKEA 3EVSC 4RUDA 2CTXA 2QJ9C 1XT3A 1ERAA 4LFTA 1KL8A 1V6PA 2ERAA 1IDGA 2H62C 2H62D 3FEVA 1M9ZA 1NYSA 1H0JA 3U73U 5DU1A 1COEA 1NTXA 2QC1A 1TXAA 1KBAA 3QB4B 2MJ0A 1HAJA 1KU6B 1JGKA 1DRSA 1NORA 2ABXA 2GOOB 1KC4A 2H7ZB 2HLQA 2I9BE 1L4WA 2MUOA 4FAOC 1HAAA 1CDRA 1KTZB 1MR6A 1TXBA 5IMYC 4EY8B 1KBSA 2H64B 2OFSA 4BIKB 2MHYA 1UG4A 1FRAA 1CHVS 2HLRA 1RL5A 3ERAA 2K3GA 1S4YA 2CRSA 2CCXA 6EBXA 4OM5A 4P7UA 2PJYC 3PLCA 1F94A 3HH7A 1NTNA 1LJZA 1IDHA 1CCQA 1FSSB 1MAHF 1LSIA 1IDLA 1ABTA 1W6BA 2JVEA 4DO8A 1CREA 1IQ9A 2MUPA 1RGJA 1CDTA 2MFAA 1LXHA 2PJYB 4HQPF 1CTXA 1QM7A 2LCRA 1ERGA 2H7ZA 3VTSA 3KFDE 2H64C 2FD6U
chains in the Genus database with same CATH superfamily
1FFJA 4IYEA 1VB0A 2LA1A 1HC9B 2CRTA 2GOOC 2BTXA 1CB9A 1YWHA 3NEQA 1F8UB 4OM4A 3U74U 1CRFA 1HC9A 4QTIU 2UX2A 1ES7B 1IDIA 1HOYA 1JBDA 4FAOE 1IJCA 4UY2C 1FASA 1ONJA 1TGXA 1LXGA 1G6MA 4KSNA 1BXPA 2NBTA 2L03A 4BDTB 2QJBC 2MJ4A 2BHIA 1CXOA 1KFHA 3NDSA 1FSCA 1B41B 2N99A 3BT2U 1CVOA 1JE9A 2UWRA 1BTEA 2VLWA 3EBXA 1NEAA 2X8BB 3LAQU 3BT1U 1ZADA 1FF4A 1KXIA 1IK8A 1CDQA 3NH7A 1CDSA 2J8BA 1NYUA 1IKCA 3KFDI 5IMTD 2L5SA 2CDXA 1CXNA 1QKDA 1I02A 1NXBA 1TFSA 1LX5B 2QJAC 1KS6A 5DZ5A 2JQPA 1KBTA 1PLOA 2H5FA 1CODA 5DO6A 4ZQYA 5EBXA 4XJJA 2H8UA 2MJYA 1REWC 4AEAA 1QKEA 3EVSC 4RUDA 2CTXA 2QJ9C 1XT3A 1ERAA 4LFTA 1KL8A 1V6PA 2ERAA 1IDGA 2H62C 2H62D 3FEVA 1M9ZA 1NYSA 1H0JA 3U73U 5DU1A 1COEA 1NTXA 2QC1A 1TXAA 1KBAA 3QB4B 2MJ0A 1HAJA 1KU6B 1JGKA 1DRSA 1NORA 2ABXA 2GOOB 1KC4A 2H7ZB 2HLQA 2I9BE 1L4WA 2MUOA 4FAOC 1HAAA 1CDRA 1KTZB 1MR6A 1TXBA 5IMYC 4EY8B 1KBSA 2H64B 2OFSA 4BIKB 2MHYA 1UG4A 1FRAA 1CHVS 2HLRA 1RL5A 3ERAA 2K3GA 1S4YA 2CRSA 2CCXA 6EBXA 4OM5A 4P7UA 2PJYC 3PLCA 1F94A 3HH7A 1NTNA 1LJZA 1IDHA 1CCQA 1FSSB 1MAHF 1LSIA 1IDLA 1ABTA 1W6BA 2JVEA 4DO8A 1CREA 1IQ9A 2MUPA 1RGJA 1CDTA 2MFAA 1LXHA 2PJYB 4HQPF 1CTXA 1QM7A 2LCRA 1ERGA 2H7ZA 3VTSA 3KFDE 2H64C 2FD6U
chains in the Genus database with same CATH topology
1FFJA 4IYEA 1VB0A 2LA1A 1HC9B 2CRTA 2GOOC 2BTXA 1CB9A 1YWHA 3NEQA 1F8UB 4OM4A 3U74U 1CRFA 1HC9A 4QTIU 2UX2A 1ES7B 1IDIA 1HOYA 1JBDA 4FAOE 1IJCA 4UY2C 1FASA 1ONJA 1TGXA 1LXGA 1G6MA 4KSNA 1BXPA 2NBTA 2L03A 4BDTB 2QJBC 2MJ4A 2BHIA 1CXOA 1KFHA 3NDSA 1FSCA 1B41B 2N99A 3BT2U 1CVOA 1JE9A 2UWRA 1BTEA 2VLWA 3EBXA 1NEAA 2X8BB 3LAQU 3BT1U 1ZADA 1FF4A 1KXIA 1IK8A 1CDQA 3NH7A 1CDSA 2J8BA 1NYUA 1IKCA 3KFDI 5IMTD 2L5SA 2CDXA 1CXNA 1QKDA 1I02A 1NXBA 1TFSA 1LX5B 2QJAC 1KS6A 5DZ5A 2JQPA 1KBTA 1PLOA 2H5FA 1CODA 5DO6A 4ZQYA 5EBXA 4XJJA 2H8UA 2MJYA 1REWC 4AEAA 1QKEA 3EVSC 4RUDA 2CTXA 2QJ9C 1XT3A 1ERAA 4LFTA 1KL8A 1V6PA 2ERAA 1IDGA 2H62C 2H62D 3FEVA 1M9ZA 1NYSA 1H0JA 3U73U 5DU1A 1COEA 1NTXA 2QC1A 1TXAA 1KBAA 3QB4B 2MJ0A 1HAJA 1KU6B 1JGKA 1DRSA 1NORA 2ABXA 2GOOB 1KC4A 2H7ZB 2HLQA 2I9BE 1L4WA 2MUOA 4FAOC 1HAAA 1CDRA 1KTZB 1MR6A 1TXBA 5IMYC 4EY8B 1KBSA 2H64B 2OFSA 4BIKB 2MHYA 1UG4A 1FRAA 1CHVS 2HLRA 1RL5A 3ERAA 2K3GA 1S4YA 2CRSA 2CCXA 6EBXA 4OM5A 4P7UA 2PJYC 3PLCA 1F94A 3HH7A 1NTNA 1LJZA 1IDHA 1CCQA 1FSSB 1MAHF 1LSIA 1IDLA 1ABTA 1W6BA 2JVEA 4DO8A 1CREA 1IQ9A 2MUPA 1RGJA 1CDTA 2MFAA 1LXHA 2PJYB 4HQPF 1CTXA 1QM7A 2LCRA 1ERGA 2H7ZA 3VTSA 3KFDE 2H64C 2FD6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFJ A;  4IYE A;  1VB0 A;  2LA1 A;  1HC9 B;  2CRT A;  2GOO C;  2BTX A;  1CB9 A;  1YWH A;  3NEQ A;  1F8U B;  4OM4 A;  3U74 U;  1CRF A;  1HC9 A;  4QTI U;  2UX2 A;  1ES7 B;  1IDI A;  1HOY A;  1JBD A;  4FAO E;  1IJC A;  4UY2 C;  1FAS A;  1ONJ A;  1TGX A;  1LXG A;  1G6M A;  1BXP A;  2NBT A;  2L03 A;  4BDT B;  2QJB C;  2MJ4 A;  2BHI A;  1CXO A;  1KFH A;  3NDS A;  1FSC A;  1B41 B;  2N99 A;  3BT2 U;  1CVO A;  1JE9 A;  2UWR A;  1BTE A;  2VLW A;  3EBX A;  1NEA A;  2X8B B;  3LAQ U;  3BT1 U;  1ZAD A;  1FF4 A;  1KXI A;  1IK8 A;  1CDQ A;  3NH7 A;  1CDS A;  2J8B A;  1NYU A;  1IKC A;  3KFD I;  5IMT D;  2L5S A;  2CDX A;  1CXN A;  1QKD A;  1I02 A;  1NXB A;  1TFS A;  1LX5 B;  2QJA C;  1KS6 A;  5DZ5 A;  2JQP A;  1KBT A;  1PLO A;  2H5F A;  1COD A;  5DO6 A;  4ZQY A;  5EBX A;  4XJJ A;  2H8U A;  2MJY A;  1REW C;  4AEA A;  1QKE A;  3EVS C;  4RUD A;  2CTX A;  2QJ9 C;  1XT3 A;  1ERA A;  4LFT A;  1KL8 A;  1V6P A;  2ERA A;  1IDG A;  2H62 C;  2H62 D;  3FEV A;  1M9Z A;  1NYS A;  1H0J A;  3U73 U;  5DU1 A;  1COE A;  1NTX A;  2QC1 A;  1TXA A;  1KBA A;  3QB4 B;  2MJ0 A;  1HAJ A;  1KU6 B;  1JGK A;  1DRS A;  1NOR A;  2ABX A;  2GOO B;  1KC4 A;  2H7Z B;  2HLQ A;  2I9B E;  1L4W A;  2MUO A;  4FAO C;  1HAA A;  1CDR A;  1KTZ B;  1MR6 A;  1TXB A;  5IMY C;  4EY8 B;  1KBS A;  2H64 B;  2OFS A;  4BIK B;  2MHY A;  1UG4 A;  1FRA A;  1CHV S;  2HLR A;  1RL5 A;  3ERA A;  2K3G A;  1S4Y A;  2CRS A;  2CCX A;  6EBX A;  4OM5 A;  4P7U A;  2PJY C;  3PLC A;  1F94 A;  3HH7 A;  1NTN A;  1LJZ A;  1IDH A;  1CCQ A;  1FSS B;  1MAH F;  1LSI A;  1IDL A;  1ABT A;  1W6B A;  2JVE A;  4DO8 A;  1CRE A;  1IQ9 A;  2MUP A;  1RGJ A;  1CDT A;  2MFA A;  1LXH A;  2PJY B;  4HQP F;  1CTX A;  1QM7 A;  2LCR A;  1ERG A;  2H7Z A;  3VTS A;  3KFD E;  2H64 C;  2FD6 U; 
#chains in the Genus database with same CATH topology
 1FFJ A;  4IYE A;  1VB0 A;  2LA1 A;  1HC9 B;  2CRT A;  2GOO C;  2BTX A;  1CB9 A;  1YWH A;  3NEQ A;  1F8U B;  4OM4 A;  3U74 U;  1CRF A;  1HC9 A;  4QTI U;  2UX2 A;  1ES7 B;  1IDI A;  1HOY A;  1JBD A;  4FAO E;  1IJC A;  4UY2 C;  1FAS A;  1ONJ A;  1TGX A;  1LXG A;  1G6M A;  4KSN A;  1BXP A;  2NBT A;  2L03 A;  4BDT B;  2QJB C;  2MJ4 A;  2BHI A;  1CXO A;  1KFH A;  3NDS A;  1FSC A;  1B41 B;  2N99 A;  3BT2 U;  1CVO A;  1JE9 A;  2UWR A;  1BTE A;  2VLW A;  3EBX A;  1NEA A;  2X8B B;  3LAQ U;  3BT1 U;  1ZAD A;  1FF4 A;  1KXI A;  1IK8 A;  1CDQ A;  3NH7 A;  1CDS A;  2J8B A;  1NYU A;  1IKC A;  3KFD I;  5IMT D;  2L5S A;  2CDX A;  1CXN A;  1QKD A;  1I02 A;  1NXB A;  1TFS A;  1LX5 B;  2QJA C;  1KS6 A;  5DZ5 A;  2JQP A;  1KBT A;  1PLO A;  2H5F A;  1COD A;  5DO6 A;  4ZQY A;  5EBX A;  4XJJ A;  2H8U A;  2MJY A;  1REW C;  4AEA A;  1QKE A;  3EVS C;  4RUD A;  2CTX A;  2QJ9 C;  1XT3 A;  1ERA A;  4LFT A;  1KL8 A;  1V6P A;  2ERA A;  1IDG A;  2H62 C;  2H62 D;  3FEV A;  1M9Z A;  1NYS A;  1H0J A;  3U73 U;  5DU1 A;  1COE A;  1NTX A;  2QC1 A;  1TXA A;  1KBA A;  3QB4 B;  2MJ0 A;  1HAJ A;  1KU6 B;  1JGK A;  1DRS A;  1NOR A;  2ABX A;  2GOO B;  1KC4 A;  2H7Z B;  2HLQ A;  2I9B E;  1L4W A;  2MUO A;  4FAO C;  1HAA A;  1CDR A;  1KTZ B;  1MR6 A;  1TXB A;  5IMY C;  4EY8 B;  1KBS A;  2H64 B;  2OFS A;  4BIK B;  2MHY A;  1UG4 A;  1FRA A;  1CHV S;  2HLR A;  1RL5 A;  3ERA A;  2K3G A;  1S4Y A;  2CRS A;  2CCX A;  6EBX A;  4OM5 A;  4P7U A;  2PJY C;  3PLC A;  1F94 A;  3HH7 A;  1NTN A;  1LJZ A;  1IDH A;  1CCQ A;  1FSS B;  1MAH F;  1LSI A;  1IDL A;  1ABT A;  1W6B A;  2JVE A;  4DO8 A;  1CRE A;  1IQ9 A;  2MUP A;  1RGJ A;  1CDT A;  2MFA A;  1LXH A;  2PJY B;  4HQP F;  1CTX A;  1QM7 A;  2LCR A;  1ERG A;  2H7Z A;  3VTS A;  3KFD E;  2H64 C;  2FD6 U; 
#chains in the Genus database with same CATH homology
 1FFJ A;  4IYE A;  1VB0 A;  2LA1 A;  1HC9 B;  2CRT A;  2GOO C;  2BTX A;  1CB9 A;  1YWH A;  3NEQ A;  1F8U B;  4OM4 A;  3U74 U;  1CRF A;  1HC9 A;  4QTI U;  2UX2 A;  1ES7 B;  1IDI A;  1HOY A;  1JBD A;  4FAO E;  1IJC A;  4UY2 C;  1FAS A;  1ONJ A;  1TGX A;  1LXG A;  1G6M A;  4KSN A;  1BXP A;  2NBT A;  2L03 A;  4BDT B;  2QJB C;  2MJ4 A;  2BHI A;  1CXO A;  1KFH A;  3NDS A;  1FSC A;  1B41 B;  2N99 A;  3BT2 U;  1CVO A;  1JE9 A;  2UWR A;  1BTE A;  2VLW A;  3EBX A;  1NEA A;  2X8B B;  3LAQ U;  3BT1 U;  1ZAD A;  1FF4 A;  1KXI A;  1IK8 A;  1CDQ A;  3NH7 A;  1CDS A;  2J8B A;  1NYU A;  1IKC A;  3KFD I;  5IMT D;  2L5S A;  2CDX A;  1CXN A;  1QKD A;  1I02 A;  1NXB A;  1TFS A;  1LX5 B;  2QJA C;  1KS6 A;  5DZ5 A;  2JQP A;  1KBT A;  1PLO A;  2H5F A;  1COD A;  5DO6 A;  4ZQY A;  5EBX A;  4XJJ A;  2H8U A;  2MJY A;  1REW C;  4AEA A;  1QKE A;  3EVS C;  4RUD A;  2CTX A;  2QJ9 C;  1XT3 A;  1ERA A;  4LFT A;  1KL8 A;  1V6P A;  2ERA A;  1IDG A;  2H62 C;  2H62 D;  3FEV A;  1M9Z A;  1NYS A;  1H0J A;  3U73 U;  5DU1 A;  1COE A;  1NTX A;  2QC1 A;  1TXA A;  1KBA A;  3QB4 B;  2MJ0 A;  1HAJ A;  1KU6 B;  1JGK A;  1DRS A;  1NOR A;  2ABX A;  2GOO B;  1KC4 A;  2H7Z B;  2HLQ A;  2I9B E;  1L4W A;  2MUO A;  4FAO C;  1HAA A;  1CDR A;  1KTZ B;  1MR6 A;  1TXB A;  5IMY C;  4EY8 B;  1KBS A;  2H64 B;  2OFS A;  4BIK B;  2MHY A;  1UG4 A;  1FRA A;  1CHV S;  2HLR A;  1RL5 A;  3ERA A;  2K3G A;  1S4Y A;  2CRS A;  2CCX A;  6EBX A;  4OM5 A;  4P7U A;  2PJY C;  3PLC A;  1F94 A;  3HH7 A;  1NTN A;  1LJZ A;  1IDH A;  1CCQ A;  1FSS B;  1MAH F;  1LSI A;  1IDL A;  1ABT A;  1W6B A;  2JVE A;  4DO8 A;  1CRE A;  1IQ9 A;  2MUP A;  1RGJ A;  1CDT A;  2MFA A;  1LXH A;  2PJY B;  4HQP F;  1CTX A;  1QM7 A;  2LCR A;  1ERG A;  2H7Z A;  3VTS A;  3KFD E;  2H64 C;  2FD6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...