2MJ4A

Neurotoxin ii from snake venom naja oxiana in solution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQPPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short neurotoxin 1
publication title An NMR-based approach for validation of protein side-chains dynamics in silico
rcsb
source organism Naja oxiana
molecule tags Toxin
total genus 8
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mj4A00
1ES7B 1RL5A 1QKEA 1TXAA 1CDSA 2HLQA 2X8BB 5IMTD 2CRTA 1G6MA 1NTNA 1LX5B 2PJYC 1L4WA 1KXIA 1KBAA 1HC9B 1YWHA 1CHVS 3EBXA 2H5FA 5IMYC 1FF4A 1HAAA 2CDXA 5DO6A 1ERGA 1NXBA 2FD6U 1BXPA 1S4YA 3EVSC 4HQPF 2ERAA 4QTIU 4OM5A 1CB9A 2QJBC 5DZ5A 1CDQA 1IJCA 3U73U 1FSSB 3KFDI 1KC4A 2H7ZA 3ERAA 4DO8A 1TGXA 1NYSA 4FAOC 2BTXA 3PLCA 2MHYA 2CTXA 1B41B 4XJJA 1MAHF 3NDSA 2BHIA 3QB4B 4IYEA 2LA1A 1IDGA 3NH7A 1CCQA 2H62C 1IDIA 2HLRA 2JQPA 4OM4A 1CRFA 1ZADA 2UWRA 1KU6B 1CVOA 1CDTA 1CODA 1KS6A 1I02A 4UY2C 1HAJA 2N99A 2MJ4A 1IK8A 2MUPA 1CXNA 1FRAA 1KBSA 3BT1U 4EY8B 1COEA 2L03A 1IDLA 1BTEA 2GOOC 1IQ9A 1NTXA 2JVEA 3LAQU 1NORA 1PLOA 5EBXA 1NYUA 1QM7A 1CTXA 1LXHA 2L5SA 2H8UA 3U74U 2QC1A 2H7ZB 1KBTA 2GOOB 2NBTA 1MR6A 1V6PA 1XT3A 2LCRA 1M9ZA 3VTSA 1JGKA 4RUDA 2MFAA 2K3GA 2J8BA 1KL8A 2CCXA 1HOYA 1IDHA 1QKDA 3KFDE 1NEAA 2QJAC 1CREA 2H64C 1RGJA 5DU1A 1DRSA 2H62D 3HH7A 4ZQYA 1F8UB 2H64B 2I9BE 2QJ9C 1JE9A 4BIKB 1ERAA 1HC9A 1FASA 2UX2A 1LSIA 4AEAA 2CRSA 1KTZB 1W6BA 1KFHA 1UG4A 1H0JA 3BT2U 2MJ0A 1TFSA 1FSCA 1IKCA 2PJYB 2ABXA 1ONJA 2OFSA 1F94A 1REWC 4P7UA 1JBDA 3NEQA 1LJZA 1VB0A 1CXOA 1CDRA 3FEVA 1FFJA 1ABTA 2MJYA 1TXBA 4FAOE 1LXGA 2VLWA 2MUOA 4BDTB 4LFTA 6EBXA
chains in the Genus database with same CATH superfamily
1ES7B 1RL5A 1QKEA 1TXAA 1CDSA 2HLQA 2X8BB 5IMTD 2CRTA 1G6MA 1NTNA 1LX5B 2PJYC 1L4WA 1KXIA 1KBAA 1HC9B 1YWHA 1CHVS 3EBXA 2H5FA 5IMYC 1FF4A 1HAAA 2CDXA 5DO6A 1ERGA 1NXBA 2FD6U 1BXPA 1S4YA 3EVSC 4HQPF 2ERAA 4QTIU 4OM5A 1CB9A 2QJBC 5DZ5A 1CDQA 1IJCA 3U73U 1FSSB 3KFDI 1KC4A 2H7ZA 3ERAA 4DO8A 1TGXA 1NYSA 4FAOC 2BTXA 3PLCA 2MHYA 2CTXA 1B41B 4XJJA 1MAHF 3NDSA 2BHIA 3QB4B 4IYEA 2LA1A 4KSNA 1IDGA 3NH7A 1CCQA 2H62C 1IDIA 2HLRA 2JQPA 4OM4A 1CRFA 1ZADA 2UWRA 1KU6B 1CVOA 1CDTA 1CODA 1KS6A 1I02A 4UY2C 1HAJA 2N99A 2MJ4A 1IK8A 2MUPA 1CXNA 1FRAA 1KBSA 3BT1U 4EY8B 1COEA 2L03A 1IDLA 1BTEA 2GOOC 1IQ9A 1NTXA 2JVEA 3LAQU 1NORA 1PLOA 5EBXA 1NYUA 1QM7A 1CTXA 1LXHA 2L5SA 2H8UA 3U74U 2QC1A 2H7ZB 1KBTA 2GOOB 2NBTA 1MR6A 1V6PA 1XT3A 2LCRA 1M9ZA 3VTSA 1JGKA 4RUDA 2MFAA 2K3GA 2J8BA 1KL8A 2CCXA 1HOYA 1IDHA 1QKDA 3KFDE 1NEAA 2QJAC 1CREA 2H64C 1RGJA 5DU1A 1DRSA 2H62D 3HH7A 4ZQYA 1F8UB 2H64B 2I9BE 2QJ9C 1JE9A 4BIKB 1ERAA 1HC9A 1FASA 2UX2A 1LSIA 4AEAA 2CRSA 1KTZB 1W6BA 1KFHA 1UG4A 1H0JA 3BT2U 2MJ0A 1TFSA 1FSCA 1IKCA 2PJYB 2ABXA 1ONJA 2OFSA 1F94A 1REWC 4P7UA 1JBDA 3NEQA 1LJZA 1VB0A 1CXOA 1CDRA 3FEVA 1FFJA 1ABTA 2MJYA 1TXBA 4FAOE 1LXGA 2VLWA 2MUOA 4BDTB 4LFTA 6EBXA
chains in the Genus database with same CATH topology
1ES7B 1RL5A 1QKEA 1TXAA 1CDSA 2HLQA 2X8BB 5IMTD 2CRTA 1G6MA 1NTNA 1LX5B 2PJYC 1L4WA 1KXIA 1KBAA 1HC9B 1YWHA 1CHVS 3EBXA 2H5FA 5IMYC 1FF4A 1HAAA 2CDXA 5DO6A 1ERGA 1NXBA 2FD6U 1BXPA 1S4YA 3EVSC 4HQPF 2ERAA 4QTIU 4OM5A 1CB9A 2QJBC 5DZ5A 1CDQA 1IJCA 3U73U 1FSSB 3KFDI 1KC4A 2H7ZA 3ERAA 4DO8A 1TGXA 1NYSA 4FAOC 2BTXA 3PLCA 2MHYA 2CTXA 1B41B 4XJJA 1MAHF 3NDSA 2BHIA 3QB4B 4IYEA 2LA1A 4KSNA 1IDGA 3NH7A 1CCQA 2H62C 1IDIA 2HLRA 2JQPA 4OM4A 1CRFA 1ZADA 2UWRA 1KU6B 1CVOA 1CDTA 1CODA 1KS6A 1I02A 4UY2C 1HAJA 2N99A 2MJ4A 1IK8A 2MUPA 1CXNA 1FRAA 1KBSA 3BT1U 4EY8B 1COEA 2L03A 1IDLA 1BTEA 2GOOC 1IQ9A 1NTXA 2JVEA 3LAQU 1NORA 1PLOA 5EBXA 1NYUA 1QM7A 1CTXA 1LXHA 2L5SA 2H8UA 3U74U 2QC1A 2H7ZB 1KBTA 2GOOB 2NBTA 1MR6A 1V6PA 1XT3A 2LCRA 1M9ZA 3VTSA 1JGKA 4RUDA 2MFAA 2K3GA 2J8BA 1KL8A 2CCXA 1HOYA 1IDHA 1QKDA 3KFDE 1NEAA 2QJAC 1CREA 2H64C 1RGJA 5DU1A 1DRSA 2H62D 3HH7A 4ZQYA 1F8UB 2H64B 2I9BE 2QJ9C 1JE9A 4BIKB 1ERAA 1HC9A 1FASA 2UX2A 1LSIA 4AEAA 2CRSA 1KTZB 1W6BA 1KFHA 1UG4A 1H0JA 3BT2U 2MJ0A 1TFSA 1FSCA 1IKCA 2PJYB 2ABXA 1ONJA 2OFSA 1F94A 1REWC 4P7UA 1JBDA 3NEQA 1LJZA 1VB0A 1CXOA 1CDRA 3FEVA 1FFJA 1ABTA 2MJYA 1TXBA 4FAOE 1LXGA 2VLWA 2MUOA 4BDTB 4LFTA 6EBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ES7 B;  1RL5 A;  1QKE A;  1TXA A;  1CDS A;  2HLQ A;  2X8B B;  5IMT D;  2CRT A;  1G6M A;  1NTN A;  1LX5 B;  2PJY C;  1L4W A;  1KXI A;  1KBA A;  1HC9 B;  1YWH A;  1CHV S;  3EBX A;  2H5F A;  5IMY C;  1FF4 A;  1HAA A;  2CDX A;  5DO6 A;  1ERG A;  1NXB A;  2FD6 U;  1BXP A;  1S4Y A;  3EVS C;  4HQP F;  2ERA A;  4QTI U;  4OM5 A;  1CB9 A;  2QJB C;  5DZ5 A;  1CDQ A;  1IJC A;  3U73 U;  1FSS B;  3KFD I;  1KC4 A;  2H7Z A;  3ERA A;  4DO8 A;  1TGX A;  1NYS A;  4FAO C;  2BTX A;  3PLC A;  2MHY A;  2CTX A;  1B41 B;  4XJJ A;  1MAH F;  3NDS A;  2BHI A;  3QB4 B;  4IYE A;  2LA1 A;  1IDG A;  3NH7 A;  1CCQ A;  2H62 C;  1IDI A;  2HLR A;  2JQP A;  4OM4 A;  1CRF A;  1ZAD A;  2UWR A;  1KU6 B;  1CVO A;  1CDT A;  1COD A;  1KS6 A;  1I02 A;  4UY2 C;  1HAJ A;  2N99 A;  2MJ4 A;  1IK8 A;  2MUP A;  1CXN A;  1FRA A;  1KBS A;  3BT1 U;  4EY8 B;  1COE A;  2L03 A;  1IDL A;  1BTE A;  2GOO C;  1IQ9 A;  1NTX A;  2JVE A;  3LAQ U;  1NOR A;  1PLO A;  5EBX A;  1NYU A;  1QM7 A;  1CTX A;  1LXH A;  2L5S A;  2H8U A;  3U74 U;  2QC1 A;  2H7Z B;  1KBT A;  2GOO B;  2NBT A;  1MR6 A;  1V6P A;  1XT3 A;  2LCR A;  1M9Z A;  3VTS A;  1JGK A;  4RUD A;  2MFA A;  2K3G A;  2J8B A;  1KL8 A;  2CCX A;  1HOY A;  1IDH A;  1QKD A;  3KFD E;  1NEA A;  2QJA C;  1CRE A;  2H64 C;  1RGJ A;  5DU1 A;  1DRS A;  2H62 D;  3HH7 A;  4ZQY A;  1F8U B;  2H64 B;  2I9B E;  2QJ9 C;  1JE9 A;  4BIK B;  1ERA A;  1HC9 A;  1FAS A;  2UX2 A;  1LSI A;  4AEA A;  2CRS A;  1KTZ B;  1W6B A;  1KFH A;  1UG4 A;  1H0J A;  3BT2 U;  2MJ0 A;  1TFS A;  1FSC A;  1IKC A;  2PJY B;  2ABX A;  1ONJ A;  2OFS A;  1F94 A;  1REW C;  4P7U A;  1JBD A;  3NEQ A;  1LJZ A;  1VB0 A;  1CXO A;  1CDR A;  3FEV A;  1FFJ A;  1ABT A;  2MJY A;  1TXB A;  4FAO E;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  4LFT A;  6EBX A; 
#chains in the Genus database with same CATH topology
 1ES7 B;  1RL5 A;  1QKE A;  1TXA A;  1CDS A;  2HLQ A;  2X8B B;  5IMT D;  2CRT A;  1G6M A;  1NTN A;  1LX5 B;  2PJY C;  1L4W A;  1KXI A;  1KBA A;  1HC9 B;  1YWH A;  1CHV S;  3EBX A;  2H5F A;  5IMY C;  1FF4 A;  1HAA A;  2CDX A;  5DO6 A;  1ERG A;  1NXB A;  2FD6 U;  1BXP A;  1S4Y A;  3EVS C;  4HQP F;  2ERA A;  4QTI U;  4OM5 A;  1CB9 A;  2QJB C;  5DZ5 A;  1CDQ A;  1IJC A;  3U73 U;  1FSS B;  3KFD I;  1KC4 A;  2H7Z A;  3ERA A;  4DO8 A;  1TGX A;  1NYS A;  4FAO C;  2BTX A;  3PLC A;  2MHY A;  2CTX A;  1B41 B;  4XJJ A;  1MAH F;  3NDS A;  2BHI A;  3QB4 B;  4IYE A;  2LA1 A;  4KSN A;  1IDG A;  3NH7 A;  1CCQ A;  2H62 C;  1IDI A;  2HLR A;  2JQP A;  4OM4 A;  1CRF A;  1ZAD A;  2UWR A;  1KU6 B;  1CVO A;  1CDT A;  1COD A;  1KS6 A;  1I02 A;  4UY2 C;  1HAJ A;  2N99 A;  2MJ4 A;  1IK8 A;  2MUP A;  1CXN A;  1FRA A;  1KBS A;  3BT1 U;  4EY8 B;  1COE A;  2L03 A;  1IDL A;  1BTE A;  2GOO C;  1IQ9 A;  1NTX A;  2JVE A;  3LAQ U;  1NOR A;  1PLO A;  5EBX A;  1NYU A;  1QM7 A;  1CTX A;  1LXH A;  2L5S A;  2H8U A;  3U74 U;  2QC1 A;  2H7Z B;  1KBT A;  2GOO B;  2NBT A;  1MR6 A;  1V6P A;  1XT3 A;  2LCR A;  1M9Z A;  3VTS A;  1JGK A;  4RUD A;  2MFA A;  2K3G A;  2J8B A;  1KL8 A;  2CCX A;  1HOY A;  1IDH A;  1QKD A;  3KFD E;  1NEA A;  2QJA C;  1CRE A;  2H64 C;  1RGJ A;  5DU1 A;  1DRS A;  2H62 D;  3HH7 A;  4ZQY A;  1F8U B;  2H64 B;  2I9B E;  2QJ9 C;  1JE9 A;  4BIK B;  1ERA A;  1HC9 A;  1FAS A;  2UX2 A;  1LSI A;  4AEA A;  2CRS A;  1KTZ B;  1W6B A;  1KFH A;  1UG4 A;  1H0J A;  3BT2 U;  2MJ0 A;  1TFS A;  1FSC A;  1IKC A;  2PJY B;  2ABX A;  1ONJ A;  2OFS A;  1F94 A;  1REW C;  4P7U A;  1JBD A;  3NEQ A;  1LJZ A;  1VB0 A;  1CXO A;  1CDR A;  3FEV A;  1FFJ A;  1ABT A;  2MJY A;  1TXB A;  4FAO E;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  4LFT A;  6EBX A; 
#chains in the Genus database with same CATH homology
 1ES7 B;  1RL5 A;  1QKE A;  1TXA A;  1CDS A;  2HLQ A;  2X8B B;  5IMT D;  2CRT A;  1G6M A;  1NTN A;  1LX5 B;  2PJY C;  1L4W A;  1KXI A;  1KBA A;  1HC9 B;  1YWH A;  1CHV S;  3EBX A;  2H5F A;  5IMY C;  1FF4 A;  1HAA A;  2CDX A;  5DO6 A;  1ERG A;  1NXB A;  2FD6 U;  1BXP A;  1S4Y A;  3EVS C;  4HQP F;  2ERA A;  4QTI U;  4OM5 A;  1CB9 A;  2QJB C;  5DZ5 A;  1CDQ A;  1IJC A;  3U73 U;  1FSS B;  3KFD I;  1KC4 A;  2H7Z A;  3ERA A;  4DO8 A;  1TGX A;  1NYS A;  4FAO C;  2BTX A;  3PLC A;  2MHY A;  2CTX A;  1B41 B;  4XJJ A;  1MAH F;  3NDS A;  2BHI A;  3QB4 B;  4IYE A;  2LA1 A;  4KSN A;  1IDG A;  3NH7 A;  1CCQ A;  2H62 C;  1IDI A;  2HLR A;  2JQP A;  4OM4 A;  1CRF A;  1ZAD A;  2UWR A;  1KU6 B;  1CVO A;  1CDT A;  1COD A;  1KS6 A;  1I02 A;  4UY2 C;  1HAJ A;  2N99 A;  2MJ4 A;  1IK8 A;  2MUP A;  1CXN A;  1FRA A;  1KBS A;  3BT1 U;  4EY8 B;  1COE A;  2L03 A;  1IDL A;  1BTE A;  2GOO C;  1IQ9 A;  1NTX A;  2JVE A;  3LAQ U;  1NOR A;  1PLO A;  5EBX A;  1NYU A;  1QM7 A;  1CTX A;  1LXH A;  2L5S A;  2H8U A;  3U74 U;  2QC1 A;  2H7Z B;  1KBT A;  2GOO B;  2NBT A;  1MR6 A;  1V6P A;  1XT3 A;  2LCR A;  1M9Z A;  3VTS A;  1JGK A;  4RUD A;  2MFA A;  2K3G A;  2J8B A;  1KL8 A;  2CCX A;  1HOY A;  1IDH A;  1QKD A;  3KFD E;  1NEA A;  2QJA C;  1CRE A;  2H64 C;  1RGJ A;  5DU1 A;  1DRS A;  2H62 D;  3HH7 A;  4ZQY A;  1F8U B;  2H64 B;  2I9B E;  2QJ9 C;  1JE9 A;  4BIK B;  1ERA A;  1HC9 A;  1FAS A;  2UX2 A;  1LSI A;  4AEA A;  2CRS A;  1KTZ B;  1W6B A;  1KFH A;  1UG4 A;  1H0J A;  3BT2 U;  2MJ0 A;  1TFS A;  1FSC A;  1IKC A;  2PJY B;  2ABX A;  1ONJ A;  2OFS A;  1F94 A;  1REW C;  4P7U A;  1JBD A;  3NEQ A;  1LJZ A;  1VB0 A;  1CXO A;  1CDR A;  3FEV A;  1FFJ A;  1ABT A;  2MJY A;  1TXB A;  4FAO E;  1LXG A;  2VLW A;  2MUO A;  4BDT B;  4LFT A;  6EBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...