2MJ5B

Structure of the uba domain of human nbr1 in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
b'GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-C
publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mj5B00
5JI2E 1TTEA 1PGYA 1OAIA 2QSFX 1DV0A 1AIPC 2EKKA 3T6PA 2LVQD 3FRHA 4F2LA 4Q7JA 1IFYA 2RRUA 1OQYA 1BVSA 1WR1B 3FRIA 4WP2A 2DAEA 3GLHE 1XB2B 2ZTCA 2KHHA 2O25A 4G3OA 3B89A 2HWJA 2MR9A 2KNAA 3LCUA 1VEGA 1V92A 1WJ7A 3GLGE 1T6OA 1ZMWA 3GLFE 1NV9A 2DENA 1XXHE 2JZ0A 2DAIA 2LVPC 1TR8A 2JY8A 1C7YA 1YLAA 1DO0A 1Q02A 1E94E 1ZV1A 1VG5A 1GO5A 1KYIA 2K0BX 1A5TA 1P3QQ 4HEOA 2DI0A 4UN2B 2JZ1A 1MN3A 3E21A 2JP7A 2MJ5B 1IM2A 1EFUB 1VEJA 2L4FA 1OTRA 3IECA 3IHPA 4R71A 2EKFA 2DZLA 2ZTDA 2HAKA 2L2DA 1T43A 2MROB 4DBGB 3FE3A 1DO2A 2R0IA 2LBCA 1R4GA 2LVOC 2H5XA 1VEKA 3E46A 1WGLA 2QHOB 2K9DA 2JY6B 3BBZA 1Y8GA 4F1IA 1G41A 1HQYE 2DAGA 3MMPA 1VQ1A 1OKSA 1IXSA 2CWBA 2LVNC 2DNAA 2DAMA 2JY5A 1G3IA 2LTUA 2L4EA 2JNHA 1HT2E 1WHCA 2JY7A 1VDLA 2LVAA 2G3QA 1WIVA 1QZEA 1HJPA 2WZJA 1SG9A 3LCVB 4GEWA 2BWEA 2CP8A 2DHYA 2B3TA 1NV8A 1WGNA 5DFLA 2DKLA 1ZMUA 2QNJA 2OO9A 1CUKA 1UFZA 3F92A 2EJSA 3K9OA 3H4JA 1G4AE 1JR3E 2OOAA 2OOBA 2MGWA 1ZMVA 1F4IA 2BWBA 2KNZA 1HT1E 2DAKA 2KNVA 2JUJA 3GLIE 3K9PA
chains in the Genus database with same CATH superfamily
1MX0A 3GQ5A 1TTEA 3U6LA 2QSFX 2RGHA 3GLHB 3I04M 4FW9A 3HY5A 1SXJB 3RGPA 4Q7JA 2LHGA 1OQYA 7CATA 3I01M 4JI1M 3LVWA 3SC3A 3HZJA 2LNHC 3GLHA 1TH2A 3GLGB 2ZTCA 1HNXM 2KHHA 3IG5A 4G3OA 1D2NA 4CGYB 1E9SA 2Z3XA 1XXHB 2MR9A 1FNNA 3RFWA 1W5SA 2X4AA 3HHXA 3KW6A 3LCUA 2P5TA 2CHGA 3AOEC 4M0WA 3GLFE 2HCBA 2XEPA 5LMNM 3TWMA 2DENA 1J7KA 2F5OA 1FJGM 1PM5A 1TDZA 3C9PA 2X49A 1R2YA 4REZA 1E94E 2ERCA 5EJCA 3GLIA 1VG5A 4Z6YA 3L25A 3W0FA 2KA6B 2KXEA 5ITQA 4QOSA 4GHAA 3E9SA 3FUUA 1AUAA 3SBJA 4CJ6A 4GHLA 2DI0A 3GPYA 1Z5BA 4UN2B 3I4YA 2KEBA 2DZOB 4B3RM 2ZAOA 5IWAM 1IN7A 4GKJM 4QNMA 1IM2A 4GC5A 1TDHA 3CF0A 3EIHA 5IREB 3IECA 3IHPA 4IBCA 4R71A 2EKFA 2RGOA 5A2QS 4OVZB 1EE8A 1N32M 2JWSA 3JR4A 1MU5A 1I4WA 1T43A 3J2PB 3FE3A 1DO2A 2C99A 4IJFA 4OVZA 4L78A 5ITYA 1NSFA 1R7RA 4M9XA 3W67A 3PXGA 2D7GA 2KZUA 4G4RA 3E46A 2W82A 3AOEA 3TE6A 2R62A 4D81A 2JY6B 2R18A 5IZ7D 1DGHA 2EA0A 5EP3A 3BBZA 4NXMM 4LFBM 3KSJA 3CTWB 3VLFB 4LG2A 4LJ4A 4L4UA 2WSFF 1GLNA 2BNKA 1VQ1A 1L1TA 3EIEA 1IXSA 2CWBA 2DNAA 3GPPA 2M5ZA 3SMPA 4IBDA 1PJQA 3T1HM 2JY5A 4LCBA 3E4RA 1NHWC 3WHLA 1IBMM 4FVMA 3HHYA 3TPZA 1V34A 3ZH9B 2C5RA 4X66M 1QAOA 1DGFA 2DWZB 3UGJA 2OQ4A 5EXSA 2BJVA 2DXIA 1XNQM 2JY7A 1QUSA 4NOOB 4P17A 2Z4SA 1QZEA 2WZJA 5BR8M 3NBIA 3K8ZA 4GEWA 4L6V6 2DWNA 2VF8A 2DHYA 1Z5CA 4DUYM 1XHBA 1R2ZA 4RKUF 4X62M 4W5WA 1I94M 3NWLA 2Z7JA 3HHWA 4LJ8A 2CUZA 3FYDA 4IBFA 1GL7A 3HWSA 4YY3M 3HU3A 2DVWB 2OO9A 2VF7A 1CUKA 3F92A 4I8OA 3U6SA 2QZ4A 4IIWA 3FTCA 2VQEM 1G8PA 2R4JA 3DA1A 2FOIC 4ZPXA 5C1BA 1JR3E 2OOAA 2GQFA 3R8FA 1PJJA 3NBXX 4CHTB 2K6BA 1W5TA 4HL4A 3U5ZA 1XMQM 1R6BX 3K2LA 2BWBA 1SXJD 3U6CA 4B7GA 1KSFX 4JYAM 2QQ8A 2V6ZM 4QHTA 1SXJC 3SFZA 1JB0F 4M0DA 1OAOC 2EKKA 4G4QA 3FRHA 5KO3A 1X37A 4B7FA 1Z5AA 3BXWA 4F2LA 1HR0M 1IFYA 1BVSA 3OTOM 1WR1B 4IBEA 4WP2A 2DAEA 3A45A 4NRVA 1RU3A 2QENA 3SYLA 3TQSA 4A3VB 1K82A 2FH0A 1XB2B 3B7NA 2LHCA 3SMSA 4BBAA 4JI0M 3GLFB 5C18A 4IBKA 4JI5M 3GPUA 1QANA 3C3DA 5FLXS 4NRWA 1VEGA 1WJ7A 3SASA 1D0LA 1ZAEA 2R6FA 4XK8F 1N34M 2UXDM 4X65M 4AG5A 2FNAA 4LZJA 3B9PA 4LGMA 3KOWE 4LJ7A 2DAIA 2LVPC 1TR8A 2CHQA 2JY8A 1N33M 1TH3A 1TGUA 3J80S 3A98B 2Q2EB 3ZCBB 1GO5A 1IXZA 1N77A 4RNAA 2CFOA 4CIZA 5FTLA 4WURA 2D7HA 3SATA 2L09A 1QVRA 2G5GX 2JZ1A 3DOAA 4LF6M 3E21A 2HL7A 2JP7A 3FKEA 4FWDA 4MH0E 1SXJA 3TWLA 3AFHA 2Z4RA 2L4FA 2XFTA 3SAVA 2EO2A 2DZLA 4QNRA 4OU7A 3GLGA 5DYGA 1PJIA 4LRTA 4G4NA 2I7NA 2I7PA 3RE8A 3MK6A 1XXHA 3WHKA 4IBGA 2R0IA 2APLA 2LBCA 4GMQA 4B08A 2BJWA 3W0LB 4P16A 2H5XA 3T15A 4MGKE 1VEKA 4D82A 2F4VM 4AKIA 3GRVA 3LMMA 3VDUA 1WGLA 3CF6E 3FUVA 3J81S 3J27B 1G59A 3QYEA 3M0EA 1NY5A 5KPZA 3M7GA 2HHHM 4BB9A 3FYCA 4F1IA 3MHVC 3QYBA 1GJSA 2DAGA 4LJ6A 3UZUA 4AG6A 1IBKM 3SARA 3MMPA 3SHFA 1GKIA 1OKSA 2N35A 2LVNC 2KRKA 3L29A 3MJ5A 2R4EA 2L6OA 2L7IA 1L8QA 3TWKA 4B3SM 3HHZA 2L4EA 3HKPA 3KS4A 4IBBA 3VDPA 4ITQA 2R65A 3L26A 2C96A 1VDLA 4LJ9A 1S3SA 4D80A 3H4MA 1QAMA 4I81A 1SG9A 3KVWA 2QCUA 2YFQA 3LCVB 4LRSA 3SYKA 2X8AA 3I4VA 4JI3M 5ITTA 3HGIA 4DV7M 2B3TA 5EXXA 3T38A 2G8LA 5DFLA 2DKLA 2QP9X 5KQ8A 3ZQJA 5H37D 4AW4A 3KFUG 1UFZA 4CISA 4QHSA 2F5NA 3THGA 2CEAA 3H4JA 2A5YB 1IY0A 2F5QA 2XF3A 2XGNA 3GRRA 1JR3A 2OOBA 4JN6A 1OIZA 4LFAM 1KFVA 3M6AA 4PDGA 2UUBM 3GQ4A 2MGWA 4FCTA 2J5YA 1OIPA 2Z8YM 3PNVA 4AKHA 2KNZA 2O01F 4IJEA 5FTNA 1MJGM 1UM8A 1QUTA 4DV1M 2JUJA 3GLIE 1DGBA 5BPVA 5F3WA 4LF4M 5JI2E 2FFJA 4GC9A 4IBJA 4JI4M 4JXJA 1OAIA 5GKNA 1IBLM 3AJIB 1AIPC 2LVQD 3BOSA 1NNJA 2VQFM 2RRUA 4FCVA 1NNUC 2GNOA 2ZANA 3FRIA 3KOXE 3U6MA 1Q3CA 1R5LA 5DYIA 1XMOM 1XC8A 3UK6A 2MH8A 1IY2A 2EUCA 4R7GA 2VDBB 4KLNA 3JAMS 1ZMWA 1QDTA 2HKJA 1GABA 3W68A 3Q8XA 4BLCA 3R9XB 4WW0A 2JZ0A 2D7EA 3UJNA 1L2DA 4JV5M 4DUZM 3U6PA 4GITA 4NL4H 4KODA 5ITXE 1ZV1A 3FUWA 2RKOA 2V1CA 1QYRA 1KYIA 1A5TA 1P3QQ 4DV3M 2Y0TA 2WSEF 2Y0QA 4HEOA 1IN6A 2ZBKB 3FD9A 2XSZD 5EXPA 3DFZA 4MGYE 2UUCM 3KXEC 2WSCF 4PCZA 2MJ5B 4DV4M 3KP0E 2KRUA 5KQDA 3DZDA 2LWXA 4NXNM 4DV0M 1QAQA 2C9CA 1Z6TA 4B3MM 2UXCM 3SAUA 1L2CA 2ZTDA 1V33A 3GLFA 1IN4A 4Y28F 3Q8GA 3VKGA 1YSYA 2LVOC 5EQTA 3SAWA 3FTEA 2CE7A 4DR4M 1YUBA 8CATA 1T3TA 4KT0F 1QQWA 1Y8GA 4M9ZA 1G41A 2O5RA 1D0KA 2KDLA 4DV6M 2UXBM 1LV7A 1ZQ9A 4DR5M 1C1KA 2QBYB 2DAMA 3B7ZA 2F5PA 3CGWA 3QAUA 3U60B 2CV0A 4II7A 2LTUA 2LXEA 1QDRA 2J7NA 2JNHA 4LF9M 2YR0A 4AKGA 3SHGB 5L8RF 3FTDA 3U60A 2XFSA 2ZAMA 3A42A 1DGGA 5KPRA 2XSZA 2LVAA 3D8LA 3UMMA 1N78A 2G3QA 4AQYM 1WIVA 3L2AA 1HJPA 3GP1A 1JR3D 4RF1A 3L27A 2BWEA 2CP8A 3U6OA 3VKHA 5IT9S 1IQPA 3J7BA 1NV8A 1WGNA 3PNYA 4PT5A 1J5EM 3U6QA 4L8RC 3T1YM 1ZMUA 1WXQA 2UU9M 1OFIA 4RF0A 1K3XA 2Y21A 4YHHM 3GPXA 4GKKM 4IBIA 3FTFA 4DR7M 1NY6A 1PJSA 2CV1A 4GH9A 3L28A 4OW0A 3GRYA 1YE9A 3U61B 4NSRA 4MM3B 1ZMVA 2QPAA 2DZNB 3V76A 3GLIB 3VK8A 4LFCM 1XNRM 1F4IA 3IG8A 4HLQA 4AZFA 1QZMA 5DNYA 1EIJA 1HT1E 2DAKA 3KDSE 3U61A 3FUTA 3PVSA 4K0KM 4LF8M 2KZSA 3LQQA 3U6DA 2FS1A 4G4OA 1ORYB 3QWLA 4MGIE 2DWMA 1Z59A 4NC6A 1PGYA 4Z8XA 1PRBA 1DV0A 5FSWA 3T6PA 2CHVA 1IXRC 2CRUA 2DWLA 4LJ5A 1GVNA 3AOGA 1XWIA 2XZFA 3KP1E 5FTJA 2Y20A 3GLHE 4PD2A 1SXJE 3D8BA 2O25A 2FE8A 3C58A 2DHRA 3B89A 2HWJA 5EP1A 2KNAA 3ILKA 4GRIA 1V92A 1GL6A 3GLGE 1NHGC 1T6OA 2J7OA 3HX3A 1NV9A 3FUXA 2R45A 1NJFA 1XXHE 4DV2M 2C98A 3PFIA 3B7QA 5EXTA 4FWHA 4JI2M 4DR1M 1HQCA 1C7YA 1YLAA 1DO0A 1DGHB 1PJTA 2R46A 5ITXA 1E9RA 1Q02A 4L15A 4LY6A 2XLJA 3GQ3A 2AHMA 5E6JA 4LF5M 4DV5M 1NO1A 2K0BX 1IXSB 1NVMA 1IN8A 3HJ8A 2KW0A 3I51A 4FWGA 4I5SA 4MB7A 2C9OA 3VFDA 4PDIA 3JR5A 1MN3A 3GRUA 1HNWM 5ITUA 4B3TM 1IY1A 4GIPA 5KPTA 1EFUB 3AKZA 1VEJA 3ZC7B 1OTRA 2XZUA 3U6EA 3RGSA 2ZM6M 2JA2A 2HAKA 2L2DA 4MGZE 5E26A 4X64M 1VDDA 2MROB 2VIIA 3KOYE 2H1RA 4DBGB 1E32A 2F5SA 1JQJC 3LQRA 2LH0A 3KOZE 1R4GA 3LW5F 4EIWA 4ANRA 5LMUM 1L1ZA 3HJQA 2QHOB 2K9DA 1H6UA 3CF2A 3K1JA 4L16A 4JI7M 3J7AS 4DR3M 1N75A 1HQYE 4I4LA 2JXNA 4LJAA 4XGIA 3AV0A 3C3EA 3K92A 1TF0B 3GO8A 3U5ZB 3HU1A 1HNZM 4JI6M 1OFHA 2CV2A 3LVVA 1Q3BA 1G3IA 4S12A 4FD2A 1GJTA 1D0MA 4DR2M 5EP2A 1HT2E 2OPFA 2YQZA 4JI8M 4R3DA 1LTMA 2V1UA 1WHCA 3HU2A 1TH4A 4G6ZA 4TUWA 4B7HA 4XBOA 4OX9M 4QOZC 4KHPM 4LGYA 5EP4A 5JI3E 5FTMA 2XH9A 3KSXA 2YNMD 4LZZA 4NSOB 3A46A 2R44A 4LF7M 1IN5A 2M60A 1NJGA 2QNJA 5ITRA 2K47A 1L2BA 4DR6M 3VK7A 2UUAM 4AI6A 4M9SA 2EJSA 1J09A 3K9OA 3HJSA 1G71A 1Q39A 4MGHA 1G4AE 3TL4X 4FCWA 2E5LM 3KS8A 2NQ8C 1OJLA 1N36M 2L7HA 4KO8A 2QBYA 1K3WA 3AL0C 3B74A 5FTKA 2KNVA 3K9PA
chains in the Genus database with same CATH topology
5JI2E 1TTEA 1PGYA 1OAIA 2QSFX 1DV0A 1AIPC 2EKKA 3T6PA 2LVQD 3FRHA 4F2LA 4Q7JA 1IFYA 2RRUA 1OQYA 1BVSA 1WR1B 3FRIA 4WP2A 2DAEA 3GLHE 1XB2B 2ZTCA 2KHHA 2O25A 4G3OA 3B89A 2HWJA 2MR9A 2KNAA 3LCUA 1VEGA 1V92A 1WJ7A 3GLGE 1T6OA 1ZMWA 3GLFE 1NV9A 2DENA 1XXHE 2JZ0A 2DAIA 2LVPC 1TR8A 2JY8A 1C7YA 1YLAA 1DO0A 1Q02A 1E94E 1ZV1A 1VG5A 1GO5A 1KYIA 2K0BX 1A5TA 1P3QQ 4HEOA 2DI0A 4UN2B 2JZ1A 1MN3A 3E21A 2JP7A 2MJ5B 1IM2A 1EFUB 1VEJA 2L4FA 1OTRA 3IECA 3IHPA 4R71A 2EKFA 2DZLA 2ZTDA 2HAKA 2L2DA 1T43A 2MROB 4DBGB 3FE3A 1DO2A 2R0IA 2LBCA 1R4GA 2LVOC 2H5XA 1VEKA 3E46A 1WGLA 2QHOB 2K9DA 2JY6B 3BBZA 1Y8GA 4F1IA 1G41A 1HQYE 2DAGA 3MMPA 1VQ1A 1OKSA 1IXSA 2CWBA 2LVNC 2DNAA 2DAMA 2JY5A 1G3IA 2LTUA 2L4EA 2JNHA 1HT2E 1WHCA 2JY7A 1VDLA 2LVAA 2G3QA 1WIVA 1QZEA 1HJPA 2WZJA 1SG9A 3LCVB 4GEWA 2BWEA 2CP8A 2DHYA 2B3TA 1NV8A 1WGNA 5DFLA 2DKLA 1ZMUA 2QNJA 2OO9A 1CUKA 1UFZA 3F92A 2EJSA 3K9OA 3H4JA 1G4AE 1JR3E 2OOAA 2OOBA 2MGWA 1ZMVA 1F4IA 2BWBA 2KNZA 1HT1E 2DAKA 2KNVA 2JUJA 3GLIE 3K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JI2 E;  1TTE A;  1PGY A;  1OAI A;  2QSF X;  1DV0 A;  1AIP C;  2EKK A;  3T6P A;  2LVQ D;  3FRH A;  4F2L A;  4Q7J A;  1IFY A;  2RRU A;  1OQY A;  1BVS A;  1WR1 B;  3FRI A;  4WP2 A;  2DAE A;  3GLH E;  1XB2 B;  2ZTC A;  2KHH A;  2O25 A;  4G3O A;  3B89 A;  2HWJ A;  2MR9 A;  2KNA A;  3LCU A;  1VEG A;  1V92 A;  1WJ7 A;  3GLG E;  1T6O A;  1ZMW A;  3GLF E;  1NV9 A;  2DEN A;  1XXH E;  2JZ0 A;  2DAI A;  2LVP C;  1TR8 A;  2JY8 A;  1C7Y A;  1YLA A;  1DO0 A;  1Q02 A;  1E94 E;  1ZV1 A;  1VG5 A;  1GO5 A;  1KYI A;  2K0B X;  1A5T A;  1P3Q Q;  4HEO A;  2DI0 A;  4UN2 B;  2JZ1 A;  1MN3 A;  3E21 A;  2JP7 A;  2MJ5 B;  1IM2 A;  1EFU B;  1VEJ A;  2L4F A;  1OTR A;  3IEC A;  3IHP A;  4R71 A;  2EKF A;  2DZL A;  2ZTD A;  2HAK A;  2L2D A;  1T43 A;  2MRO B;  4DBG B;  3FE3 A;  1DO2 A;  2R0I A;  2LBC A;  1R4G A;  2LVO C;  2H5X A;  1VEK A;  3E46 A;  1WGL A;  2QHO B;  2K9D A;  2JY6 B;  3BBZ A;  1Y8G A;  4F1I A;  1G41 A;  1HQY E;  2DAG A;  3MMP A;  1VQ1 A;  1OKS A;  1IXS A;  2CWB A;  2LVN C;  2DNA A;  2DAM A;  2JY5 A;  1G3I A;  2LTU A;  2L4E A;  2JNH A;  1HT2 E;  1WHC A;  2JY7 A;  1VDL A;  2LVA A;  2G3Q A;  1WIV A;  1QZE A;  1HJP A;  2WZJ A;  1SG9 A;  3LCV B;  4GEW A;  2BWE A;  2CP8 A;  2DHY A;  2B3T A;  1NV8 A;  1WGN A;  5DFL A;  2DKL A;  1ZMU A;  2QNJ A;  2OO9 A;  1CUK A;  1UFZ A;  3F92 A;  2EJS A;  3K9O A;  3H4J A;  1G4A E;  1JR3 E;  2OOA A;  2OOB A;  2MGW A;  1ZMV A;  1F4I A;  2BWB A;  2KNZ A;  1HT1 E;  2DAK A;  2KNV A;  2JUJ A;  3GLI E;  3K9P A; 
#chains in the Genus database with same CATH topology
 1MX0 A;  3GQ5 A;  1TTE A;  3U6L A;  2QSF X;  2RGH A;  3GLH B;  3I04 M;  4FW9 A;  3HY5 A;  1SXJ B;  3RGP A;  4Q7J A;  2LHG A;  1OQY A;  7CAT A;  3I01 M;  4JI1 M;  3LVW A;  3SC3 A;  3HZJ A;  2LNH C;  3GLH A;  1TH2 A;  3GLG B;  2ZTC A;  1HNX M;  2KHH A;  3IG5 A;  4G3O A;  1D2N A;  4CGY B;  1E9S A;  2Z3X A;  1XXH B;  2MR9 A;  1FNN A;  3RFW A;  1W5S A;  2X4A A;  3HHX A;  3KW6 A;  3LCU A;  2P5T A;  2CHG A;  3AOE C;  4M0W A;  3GLF E;  2HCB A;  2XEP A;  5LMN M;  3TWM A;  2DEN A;  1J7K A;  2F5O A;  1FJG M;  1PM5 A;  1TDZ A;  3C9P A;  2X49 A;  1R2Y A;  4REZ A;  1E94 E;  2ERC A;  5EJC A;  3GLI A;  1VG5 A;  4Z6Y A;  3L25 A;  3W0F A;  2KA6 B;  2KXE A;  5ITQ A;  4QOS A;  4GHA A;  3E9S A;  3FUU A;  1AUA A;  3SBJ A;  4CJ6 A;  4GHL A;  2DI0 A;  3GPY A;  1Z5B A;  4UN2 B;  3I4Y A;  2KEB A;  2DZO B;  4B3R M;  2ZAO A;  5IWA M;  1IN7 A;  4GKJ M;  4QNM A;  1IM2 A;  4GC5 A;  1TDH A;  3CF0 A;  3EIH A;  5IRE B;  3IEC A;  3IHP A;  4IBC A;  4R71 A;  2EKF A;  2RGO A;  5A2Q S;  4OVZ B;  1EE8 A;  1N32 M;  2JWS A;  3JR4 A;  1MU5 A;  1I4W A;  1T43 A;  3J2P B;  3FE3 A;  1DO2 A;  2C99 A;  4IJF A;  4OVZ A;  4L78 A;  5ITY A;  1NSF A;  1R7R A;  4M9X A;  3W67 A;  3PXG A;  2D7G A;  2KZU A;  4G4R A;  3E46 A;  2W82 A;  3AOE A;  3TE6 A;  2R62 A;  4D81 A;  2JY6 B;  2R18 A;  5IZ7 D;  1DGH A;  2EA0 A;  5EP3 A;  3BBZ A;  4NXM M;  4LFB M;  3KSJ A;  3CTW B;  3VLF B;  4LG2 A;  4LJ4 A;  4L4U A;  2WSF F;  1GLN A;  2BNK A;  1VQ1 A;  1L1T A;  3EIE A;  1IXS A;  2CWB A;  2DNA A;  3GPP A;  2M5Z A;  3SMP A;  4IBD A;  1PJQ A;  3T1H M;  2JY5 A;  4LCB A;  3E4R A;  1NHW C;  3WHL A;  1IBM M;  4FVM A;  3HHY A;  3TPZ A;  1V34 A;  3ZH9 B;  2C5R A;  4X66 M;  1QAO A;  1DGF A;  2DWZ B;  3UGJ A;  2OQ4 A;  5EXS A;  2BJV A;  2DXI A;  1XNQ M;  2JY7 A;  1QUS A;  4NOO B;  4P17 A;  2Z4S A;  1QZE A;  2WZJ A;  5BR8 M;  3NBI A;  3K8Z A;  4GEW A;  4L6V 6;  2DWN A;  2VF8 A;  2DHY A;  1Z5C A;  4DUY M;  1XHB A;  1R2Z A;  4RKU F;  4X62 M;  4W5W A;  1I94 M;  3NWL A;  2Z7J A;  3HHW A;  4LJ8 A;  2CUZ A;  3FYD A;  4IBF A;  1GL7 A;  3HWS A;  4YY3 M;  3HU3 A;  2DVW B;  2OO9 A;  2VF7 A;  1CUK A;  3F92 A;  4I8O A;  3U6S A;  2QZ4 A;  4IIW A;  3FTC A;  2VQE M;  1G8P A;  2R4J A;  3DA1 A;  2FOI C;  4ZPX A;  5C1B A;  1JR3 E;  2OOA A;  2GQF A;  3R8F A;  1PJJ A;  3NBX X;  4CHT B;  2K6B A;  1W5T A;  4HL4 A;  3U5Z A;  1XMQ M;  1R6B X;  3K2L A;  2BWB A;  1SXJ D;  3U6C A;  4B7G A;  1KSF X;  4JYA M;  2QQ8 A;  2V6Z M;  4QHT A;  1SXJ C;  3SFZ A;  1JB0 F;  4M0D A;  1OAO C;  2EKK A;  4G4Q A;  3FRH A;  5KO3 A;  1X37 A;  4B7F A;  1Z5A A;  3BXW A;  4F2L A;  1HR0 M;  1IFY A;  1BVS A;  3OTO M;  1WR1 B;  4IBE A;  4WP2 A;  2DAE A;  3A45 A;  4NRV A;  1RU3 A;  2QEN A;  3SYL A;  3TQS A;  4A3V B;  1K82 A;  2FH0 A;  1XB2 B;  3B7N A;  2LHC A;  3SMS A;  4BBA A;  4JI0 M;  3GLF B;  5C18 A;  4IBK A;  4JI5 M;  3GPU A;  1QAN A;  3C3D A;  5FLX S;  4NRW A;  1VEG A;  1WJ7 A;  3SAS A;  1D0L A;  1ZAE A;  2R6F A;  4XK8 F;  1N34 M;  2UXD M;  4X65 M;  4AG5 A;  2FNA A;  4LZJ A;  3B9P A;  4LGM A;  3KOW E;  4LJ7 A;  2DAI A;  2LVP C;  1TR8 A;  2CHQ A;  2JY8 A;  1N33 M;  1TH3 A;  1TGU A;  3J80 S;  3A98 B;  2Q2E B;  3ZCB B;  1GO5 A;  1IXZ A;  1N77 A;  4RNA A;  2CFO A;  4CIZ A;  5FTL A;  4WUR A;  2D7H A;  3SAT A;  2L09 A;  1QVR A;  2G5G X;  2JZ1 A;  3DOA A;  4LF6 M;  3E21 A;  2HL7 A;  2JP7 A;  3FKE A;  4FWD A;  4MH0 E;  1SXJ A;  3TWL A;  3AFH A;  2Z4R A;  2L4F A;  2XFT A;  3SAV A;  2EO2 A;  2DZL A;  4QNR A;  4OU7 A;  3GLG A;  5DYG A;  1PJI A;  4LRT A;  4G4N A;  2I7N A;  2I7P A;  3RE8 A;  3MK6 A;  1XXH A;  3WHK A;  4IBG A;  2R0I A;  2APL A;  2LBC A;  4GMQ A;  4B08 A;  2BJW A;  3W0L B;  4P16 A;  2H5X A;  3T15 A;  4MGK E;  1VEK A;  4D82 A;  2F4V M;  4AKI A;  3GRV A;  3LMM A;  3VDU A;  1WGL A;  3CF6 E;  3FUV A;  3J81 S;  3J27 B;  1G59 A;  3QYE A;  3M0E A;  1NY5 A;  5KPZ A;  3M7G A;  2HHH M;  4BB9 A;  3FYC A;  4F1I A;  3MHV C;  3QYB A;  1GJS A;  2DAG A;  4LJ6 A;  3UZU A;  4AG6 A;  1IBK M;  3SAR A;  3MMP A;  3SHF A;  1GKI A;  1OKS A;  2N35 A;  2LVN C;  2KRK A;  3L29 A;  3MJ5 A;  2R4E A;  2L6O A;  2L7I A;  1L8Q A;  3TWK A;  4B3S M;  3HHZ A;  2L4E A;  3HKP A;  3KS4 A;  4IBB A;  3VDP A;  4ITQ A;  2R65 A;  3L26 A;  2C96 A;  1VDL A;  4LJ9 A;  1S3S A;  4D80 A;  3H4M A;  1QAM A;  4I81 A;  1SG9 A;  3KVW A;  2QCU A;  2YFQ A;  3LCV B;  4LRS A;  3SYK A;  2X8A A;  3I4V A;  4JI3 M;  5ITT A;  3HGI A;  4DV7 M;  2B3T A;  5EXX A;  3T38 A;  2G8L A;  5DFL A;  2DKL A;  2QP9 X;  5KQ8 A;  3ZQJ A;  5H37 D;  4AW4 A;  3KFU G;  1UFZ A;  4CIS A;  4QHS A;  2F5N A;  3THG A;  2CEA A;  3H4J A;  2A5Y B;  1IY0 A;  2F5Q A;  2XF3 A;  2XGN A;  3GRR A;  1JR3 A;  2OOB A;  4JN6 A;  1OIZ A;  4LFA M;  1KFV A;  3M6A A;  4PDG A;  2UUB M;  3GQ4 A;  2MGW A;  4FCT A;  2J5Y A;  1OIP A;  2Z8Y M;  3PNV A;  4AKH A;  2KNZ A;  2O01 F;  4IJE A;  5FTN A;  1MJG M;  1UM8 A;  1QUT A;  4DV1 M;  2JUJ A;  3GLI E;  1DGB A;  5BPV A;  5F3W A;  4LF4 M;  5JI2 E;  2FFJ A;  4GC9 A;  4IBJ A;  4JI4 M;  4JXJ A;  1OAI A;  5GKN A;  1IBL M;  3AJI B;  1AIP C;  2LVQ D;  3BOS A;  1NNJ A;  2VQF M;  2RRU A;  4FCV A;  1NNU C;  2GNO A;  2ZAN A;  3FRI A;  3KOX E;  3U6M A;  1Q3C A;  1R5L A;  5DYI A;  1XMO M;  1XC8 A;  3UK6 A;  2MH8 A;  1IY2 A;  2EUC A;  4R7G A;  2VDB B;  4KLN A;  3JAM S;  1ZMW A;  1QDT A;  2HKJ A;  1GAB A;  3W68 A;  3Q8X A;  4BLC A;  3R9X B;  4WW0 A;  2JZ0 A;  2D7E A;  3UJN A;  1L2D A;  4JV5 M;  4DUZ M;  3U6P A;  4GIT A;  4NL4 H;  4KOD A;  5ITX E;  1ZV1 A;  3FUW A;  2RKO A;  2V1C A;  1QYR A;  1KYI A;  1A5T A;  1P3Q Q;  4DV3 M;  2Y0T A;  2WSE F;  2Y0Q A;  4HEO A;  1IN6 A;  2ZBK B;  3FD9 A;  2XSZ D;  5EXP A;  3DFZ A;  4MGY E;  2UUC M;  3KXE C;  2WSC F;  4PCZ A;  2MJ5 B;  4DV4 M;  3KP0 E;  2KRU A;  5KQD A;  3DZD A;  2LWX A;  4NXN M;  4DV0 M;  1QAQ A;  2C9C A;  1Z6T A;  4B3M M;  2UXC M;  3SAU A;  1L2C A;  2ZTD A;  1V33 A;  3GLF A;  1IN4 A;  4Y28 F;  3Q8G A;  3VKG A;  1YSY A;  2LVO C;  5EQT A;  3SAW A;  3FTE A;  2CE7 A;  4DR4 M;  1YUB A;  8CAT A;  1T3T A;  4KT0 F;  1QQW A;  1Y8G A;  4M9Z A;  1G41 A;  2O5R A;  1D0K A;  2KDL A;  4DV6 M;  2UXB M;  1LV7 A;  1ZQ9 A;  4DR5 M;  1C1K A;  2QBY B;  2DAM A;  3B7Z A;  2F5P A;  3CGW A;  3QAU A;  3U60 B;  2CV0 A;  4II7 A;  2LTU A;  2LXE A;  1QDR A;  2J7N A;  2JNH A;  4LF9 M;  2YR0 A;  4AKG A;  3SHG B;  5L8R F;  3FTD A;  3U60 A;  2XFS A;  2ZAM A;  3A42 A;  1DGG A;  5KPR A;  2XSZ A;  2LVA A;  3D8L A;  3UMM A;  1N78 A;  2G3Q A;  4AQY M;  1WIV A;  3L2A A;  1HJP A;  3GP1 A;  1JR3 D;  4RF1 A;  3L27 A;  2BWE A;  2CP8 A;  3U6O A;  3VKH A;  5IT9 S;  1IQP A;  3J7B A;  1NV8 A;  1WGN A;  3PNY A;  4PT5 A;  1J5E M;  3U6Q A;  4L8R C;  3T1Y M;  1ZMU A;  1WXQ A;  2UU9 M;  1OFI A;  4RF0 A;  1K3X A;  2Y21 A;  4YHH M;  3GPX A;  4GKK M;  4IBI A;  3FTF A;  4DR7 M;  1NY6 A;  1PJS A;  2CV1 A;  4GH9 A;  3L28 A;  4OW0 A;  3GRY A;  1YE9 A;  3U61 B;  4NSR A;  4MM3 B;  1ZMV A;  2QPA A;  2DZN B;  3V76 A;  3GLI B;  3VK8 A;  4LFC M;  1XNR M;  1F4I A;  3IG8 A;  4HLQ A;  4AZF A;  1QZM A;  5DNY A;  1EIJ A;  1HT1 E;  2DAK A;  3KDS E;  3U61 A;  3FUT A;  3PVS A;  4K0K M;  4LF8 M;  2KZS A;  3LQQ A;  3U6D A;  2FS1 A;  4G4O A;  1ORY B;  3QWL A;  4MGI E;  2DWM A;  1Z59 A;  4NC6 A;  1PGY A;  4Z8X A;  1PRB A;  1DV0 A;  5FSW A;  3T6P A;  2CHV A;  1IXR C;  2CRU A;  2DWL A;  4LJ5 A;  1GVN A;  3AOG A;  1XWI A;  2XZF A;  3KP1 E;  5FTJ A;  2Y20 A;  3GLH E;  4PD2 A;  1SXJ E;  3D8B A;  2O25 A;  2FE8 A;  3C58 A;  2DHR A;  3B89 A;  2HWJ A;  5EP1 A;  2KNA A;  3ILK A;  4GRI A;  1V92 A;  1GL6 A;  3GLG E;  1NHG C;  1T6O A;  2J7O A;  3HX3 A;  1NV9 A;  3FUX A;  2R45 A;  1NJF A;  1XXH E;  4DV2 M;  2C98 A;  3PFI A;  3B7Q A;  5EXT A;  4FWH A;  4JI2 M;  4DR1 M;  1HQC A;  1C7Y A;  1YLA A;  1DO0 A;  1DGH B;  1PJT A;  2R46 A;  5ITX A;  1E9R A;  1Q02 A;  4L15 A;  4LY6 A;  2XLJ A;  3GQ3 A;  2AHM A;  5E6J A;  4LF5 M;  4DV5 M;  1NO1 A;  2K0B X;  1IXS B;  1NVM A;  1IN8 A;  3HJ8 A;  2KW0 A;  3I51 A;  4FWG A;  4I5S A;  4MB7 A;  2C9O A;  3VFD A;  4PDI A;  3JR5 A;  1MN3 A;  3GRU A;  1HNW M;  5ITU A;  4B3T M;  1IY1 A;  4GIP A;  5KPT A;  1EFU B;  3AKZ A;  1VEJ A;  3ZC7 B;  1OTR A;  2XZU A;  3U6E A;  3RGS A;  2ZM6 M;  2JA2 A;  2HAK A;  2L2D A;  4MGZ E;  5E26 A;  4X64 M;  1VDD A;  2MRO B;  2VII A;  3KOY E;  2H1R A;  4DBG B;  1E32 A;  2F5S A;  1JQJ C;  3LQR A;  2LH0 A;  3KOZ E;  1R4G A;  3LW5 F;  4EIW A;  4ANR A;  5LMU M;  1L1Z A;  3HJQ A;  2QHO B;  2K9D A;  1H6U A;  3CF2 A;  3K1J A;  4L16 A;  4JI7 M;  3J7A S;  4DR3 M;  1N75 A;  1HQY E;  4I4L A;  2JXN A;  4LJA A;  4XGI A;  3AV0 A;  3C3E A;  3K92 A;  1TF0 B;  3GO8 A;  3U5Z B;  3HU1 A;  1HNZ M;  4JI6 M;  1OFH A;  2CV2 A;  3LVV A;  1Q3B A;  1G3I A;  4S12 A;  4FD2 A;  1GJT A;  1D0M A;  4DR2 M;  5EP2 A;  1HT2 E;  2OPF A;  2YQZ A;  4JI8 M;  4R3D A;  1LTM A;  2V1U A;  1WHC A;  3HU2 A;  1TH4 A;  4G6Z A;  4TUW A;  4B7H A;  4XBO A;  4OX9 M;  4QOZ C;  4KHP M;  4LGY A;  5EP4 A;  5JI3 E;  5FTM A;  2XH9 A;  3KSX A;  2YNM D;  4LZZ A;  4NSO B;  3A46 A;  2R44 A;  4LF7 M;  1IN5 A;  2M60 A;  1NJG A;  2QNJ A;  5ITR A;  2K47 A;  1L2B A;  4DR6 M;  3VK7 A;  2UUA M;  4AI6 A;  4M9S A;  2EJS A;  1J09 A;  3K9O A;  3HJS A;  1G71 A;  1Q39 A;  4MGH A;  1G4A E;  3TL4 X;  4FCW A;  2E5L M;  3KS8 A;  2NQ8 C;  1OJL A;  1N36 M;  2L7H A;  4KO8 A;  2QBY A;  1K3W A;  3AL0 C;  3B74 A;  5FTK A;  2KNV A;  3K9P A; 
#chains in the Genus database with same CATH homology
 5JI2 E;  1TTE A;  1PGY A;  1OAI A;  2QSF X;  1DV0 A;  1AIP C;  2EKK A;  3T6P A;  2LVQ D;  3FRH A;  4F2L A;  4Q7J A;  1IFY A;  2RRU A;  1OQY A;  1BVS A;  1WR1 B;  3FRI A;  4WP2 A;  2DAE A;  3GLH E;  1XB2 B;  2ZTC A;  2KHH A;  2O25 A;  4G3O A;  3B89 A;  2HWJ A;  2MR9 A;  2KNA A;  3LCU A;  1VEG A;  1V92 A;  1WJ7 A;  3GLG E;  1T6O A;  1ZMW A;  3GLF E;  1NV9 A;  2DEN A;  1XXH E;  2JZ0 A;  2DAI A;  2LVP C;  1TR8 A;  2JY8 A;  1C7Y A;  1YLA A;  1DO0 A;  1Q02 A;  1E94 E;  1ZV1 A;  1VG5 A;  1GO5 A;  1KYI A;  2K0B X;  1A5T A;  1P3Q Q;  4HEO A;  2DI0 A;  4UN2 B;  2JZ1 A;  1MN3 A;  3E21 A;  2JP7 A;  2MJ5 B;  1IM2 A;  1EFU B;  1VEJ A;  2L4F A;  1OTR A;  3IEC A;  3IHP A;  4R71 A;  2EKF A;  2DZL A;  2ZTD A;  2HAK A;  2L2D A;  1T43 A;  2MRO B;  4DBG B;  3FE3 A;  1DO2 A;  2R0I A;  2LBC A;  1R4G A;  2LVO C;  2H5X A;  1VEK A;  3E46 A;  1WGL A;  2QHO B;  2K9D A;  2JY6 B;  3BBZ A;  1Y8G A;  4F1I A;  1G41 A;  1HQY E;  2DAG A;  3MMP A;  1VQ1 A;  1OKS A;  1IXS A;  2CWB A;  2LVN C;  2DNA A;  2DAM A;  2JY5 A;  1G3I A;  2LTU A;  2L4E A;  2JNH A;  1HT2 E;  1WHC A;  2JY7 A;  1VDL A;  2LVA A;  2G3Q A;  1WIV A;  1QZE A;  1HJP A;  2WZJ A;  1SG9 A;  3LCV B;  4GEW A;  2BWE A;  2CP8 A;  2DHY A;  2B3T A;  1NV8 A;  1WGN A;  5DFL A;  2DKL A;  1ZMU A;  2QNJ A;  2OO9 A;  1CUK A;  1UFZ A;  3F92 A;  2EJS A;  3K9O A;  3H4J A;  1G4A E;  1JR3 E;  2OOA A;  2OOB A;  2MGW A;  1ZMV A;  1F4I A;  2BWB A;  2KNZ A;  1HT1 E;  2DAK A;  2KNV A;  2JUJ A;  3GLI E;  3K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...