2MJ5B

Structure of the uba domain of human nbr1 in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Polyubiquitin-C
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mj5B00
1OTRA 2OOBA 1VEGA 4DBGB 1OQYA 2LVOC 2DAKA 2MROB 1DV0A 2G3QA 3BBZA 1Q02A 1SG9A 1TTEA 1VEJA 1KYIA 1WGNA 1IM2A 3LCVB 4WP2A 2DAEA 2LVQD 3K9PA 4UN2B 3K9OA 1AIPC 2LVNC 1G4AE 1BVSA 2KHHA 5DFLA 2O25A 1GO5A 1VQ1A 3B89A 2CP8A 1R4GA 3IECA 1Y8GA 2JY8A 2MR9A 2MGWA 1WIVA 2DHYA 1V92A 2ZTDA 2CWBA 2DI0A 1E94E 1T43A 3F92A 1VDLA 3LCUA 2OO9A 3H4JA 2KNZA 1DO2A 1JR3E 2EJSA 2HAKA 1XB2B 1XXHE 1OKSA 1WR1B 1UFZA 2QNJA 3E46A 3MMPA 1A5TA 1QZEA 1VG5A 2MJ5B 2LTUA 4Q7JA 1YLAA 1CUKA 1HQYE 3GLIE 2R0IA 1IFYA 2H5XA 2DAIA 2EKFA 2B3TA 2JNHA 2JY5A 4F2LA 3E21A 3GLGE 1C7YA 4HEOA 2WZJA 3FRHA 1WGLA 2JY7A 1HJPA 1TR8A 3IHPA 1PGYA 1HT2E 2OOAA 2DZLA 1IXSA 1OAIA 2QSFX 2L4EA 1NV9A 4F1IA 1ZMVA 2K9DA 1DO0A 2HWJA 2JY6B 2ZTCA 3FRIA 4G3OA 1ZMWA 2DAGA 2BWBA 2JZ0A 2KNAA 2DNAA 2LVAA 2EKKA 2DAMA 3GLHE 2LBCA 2RRUA 1NV8A 2BWEA 2KNVA 5JI2E 1MN3A 2K0BX 2QHOB 1ZMUA 2JP7A 2DKLA 2JZ1A 4GEWA 1G3IA 1EFUB 1WHCA 1WJ7A 1G41A 2L2DA 1P3QQ 2LVPC 1VEKA 1ZV1A 4R71A 3FE3A 2JUJA 3T6PA 1HT1E 1F4IA 2L4FA 1T6OA 2DENA 3GLFE
chains in the Genus database with same CATH superfamily
1QAQA 4YHHM 4JV5M 1WXQA 2JWSA 4NSRA 4FCVA 4P16A 4PD2A 2N35A 2DZOB 3U6SA 2BNKA 3HU3A 3QWLA 3ZH9B 3GLIA 4QOSA 3FYDA 4JXJA 1IN4A 3T15A 3W67A 1GL7A 1Z59A 1IN5A 3B7NA 2YR0A 3C3DA 4I8OA 1IM2A 4AI6A 3A46A 4BLCA 5FTNA 3KOWE 3E4RA 3MJ5A 2DAEA 3U60A 4JI7M 3K9OA 2Y0QA 3DFZA 3L28A 4MM3B 1IY1A 3HWSA 1GO5A 3GP1A 4LGYA 5LMNM 1VQ1A 5ITXA 4L8RC 1QDRA 1Y8GA 3MK6A 5IZ7D 4JI1M 3CF6E 1R5LA 1J5EM 2DHYA 2KRUA 1V92A 4ANRA 4LJ5A 2V1CA 2G8LA 3DA1A 3W0FA 3T38A 1I4WA 2I7NA 1K3XA 2VF8A 3W0LB 3I4YA 5ITRA 3C58A 4GIPA 5EP1A 1VDLA 1HR0M 1I94M 1VDDA 5ITYA 2OO9A 3H4JA 3GPUA 4CJ6A 2KNZA 1JR3E 2EJSA 2XFTA 3ILKA 3GO8A 1XB2B 5EXPA 1OKSA 1XWIA 2APLA 1NNUC 5KO3A 4DUZM 3MMPA 1S3SA 3VKHA 2KRKA 2HKJA 4MGYE 5FSWA 3U5ZA 3HHZA 1TH3A 2MJ5B 5EJCA 2H1RA 3A45A 4Q7JA 1YSYA 1CUKA 5EXXA 4AG6A 5FTJA 3TL4X 3R8FA 4MGZE 3VK7A 3L2AA 2R46A 2Y21A 2DAIA 2YFQA 4FD2A 3SMSA 3UMMA 4DR7M 4GH9A 1XMOM 2UXBM 5BPVA 4ITQA 3E21A 4CIZA 1GABA 1TGUA 4R3DA 3PVSA 4G4OA 3U6PA 1N32M 4HEOA 5IREB 2WZJA 2XSZD 3FRHA 4FWHA 3J2PB 1JR3A 2FH0A 3BXWA 1HT2E 2OOAA 3GPYA 2DZLA 4OU7A 4G4NA 3TE6A 1NHWC 4AW4A 2RGHA 4TUWA 3DZDA 3ZCBB 2L4EA 2Z7JA 2X4AA 3TPZA 1NV9A 3GLIB 1HNXM 7CATA 3E9SA 3SAVA 2VF7A 4EIWA 4LZZA 3GQ5A 2K9DA 1DO0A 1PM5A 3L27A 3FRIA 2VIIA 2QBYB 1HQCA 1Q3CA 4LJ9A 2C99A 4NL4H 3HHYA 1AUAA 2DVWB 2JZ0A 3KOZE 2KNAA 2LVAA 1OFHA 4JI6M 4FWDA 2RGOA 3SAWA 4LY6A 5FTKA 3SMPA 4M9SA 3VKGA 1TDHA 3GLHE 2LBCA 4MGKE 3W68A 4A3VB 3J7BA 4DR2M 2MH8A 1NJGA 2BWEA 1IXRC 2QZ4A 3GRYA 3U6OA 1QANA 1SXJB 3RFWA 2QENA 1ZMUA 2JP7A 2GNOA 4IBBA 4QHTA 1PJJA 1OIPA 4G4QA 1PJSA 4REZA 5C1BA 2CE7A 3K1JA 1IXZA 3FD9A 2LVPC 3PXGA 2HHHM 3FE3A 1ZQ9A 2ZM6M 1N33M 4LZJA 4MGHA 4Y28F 2UU9M 1HT1E 1GJSA 1EE8A 2OOBA 3GLFE 3B9PA 1XHBA 5ITQA 3GLHA 1SXJE 2LVOC 2DAKA 1Z6TA 2MROB 3I4VA 2XZUA 1DV0A 1R7RA 3R9XB 2QQ8A 1Q02A 3HJ8A 2Z4RA 4L4UA 1NSFA 1QUTA 3KOYE 3Q8XA 2KZUA 4B7GA 4B08A 1R2YA 4GHAA 3WHKA 2R6FA 2F4VM 2CV1A 3FTEA 3SASA 3HKPA 2C9CA 3TWKA 1C1KA 1QUSA 3FTDA 4WP2A 3VDPA 3GLFA 4GKKM 4MH0E 4UN2B 1K82A 1UM8A 4KLNA 2LVNC 4NC6A 1MJGM 2GQFA 4FCTA 4D82A 5FTLA 2CV2A 4JI5M 1ZAEA 2WSCF 1JR3D 2C96A 4GKJM 2CP8A 3HU1A 2LH0A 3IECA 2JY8A 2MR9A 2MGWA 3NBXX 1FJGM 4NXNM 3HY5A 4W5WA 3CF2A 4NRWA 2CWBA 2V1UA 1E94E 1TH2A 3UK6A 2XEPA 3F92A 2FS1A 5A2QS 4XBOA 3FUUA 1IQPA 4LJ7A 4OVZA 3LCUA 3H4MA 3KS4A 3PNYA 3OTOM 2KW0A 1NNJA 4PT5A 2QCUA 3VLFB 2QNJA 1UFZA 3E46A 4DV7M 3CF0A 1TH4A 2ZAOA 2JA2A 2ZBKB 3DOAA 3AL0C 4L6V6 4X66M 2Y20A 4DV3M 2ZAMA 1HQYE 1MU5A 4R7GA 5KPRA 2R18A 4CGYB 2EA0A 3PFIA 3THGA 2LNHC 1J7KA 3NWLA 4KODA 4LG2A 2V6ZM 1KSFX 1MX0A 4I4LA 3HJSA 3SHFA 3GLGE 4LFAM 2EO2A 1C7YA 2K6BA 2YNMD 4LRSA 3QYBA 4LJ8A 4M0WA 4I81A 1WGLA 2JY7A 4JI0M 3LQQA 1HJPA 3HHXA 4D80A 3A98B 1G59A 2C98A 1PGYA 3KSJA 3SHGB 4DUYM 1DGFA 1OAIA 2K47A 3J27B 2QSFX 1DGHB 2DWMA 2Z3XA 4IBEA 1L2CA 1ZMVA 1JB0F 3D8BA 4G3OA 3J81S 1HNZM 2BWBA 2LXEA 2A5YB 3TQSA 5E26A 4KHPM 1RU3A 3L29A 2DNAA 5E6JA 3WHLA 4WW0A 4B7HA 4B3MM 2VQFM 5JI3E 3GRUA 2DXIA 2VDBB 3HJQA 5DNYA 2RRUA 4LJ6A 5KQ8A 4HL4A 2L7HA 1OIZA 4IBGA 3SC3A 4DV1M 1NV8A 2KNVA 4B3SM 3U5ZB 1GLNA 2KA6B 2DWNA 1R6BX 4L15A 3U61B 5EP4A 4IJEA 4LCBA 4DV5M 2JZ1A 4LGMA 1DGHA 1NJFA 3GQ4A 4M9XA 1XMQM 4GEWA 1FNNA 1G3IA 3L26A 1L1TA 4JYAM 1EFUB 1WHCA 2F5PA 1WJ7A 4QNMA 1N77A 2L2DA 4NOOB 1QYRA 1ZV1A 1HNWM 1Z5AA 4LF7M 3T6PA 5DYIA 4Z6YA 2X49A 3UJNA 3HU2A 3EIHA 3GLFB 1PJTA 4B3TM 3UZUA 3U6QA 3FTCA 3CGWA 1VEGA 4DBGB 2CUZA 2DWLA 2WSEF 4NSOB 1VEJA 4CHTB 3B74A 3I51A 1KYIA 3LVVA 5IT9S 3KP0E 1K3WA 1E32A 3KDSE 3K8ZA 4WURA 2D7EA 3LCVB 2UXCM 1IBLM 3VK8A 4DR4M 3SAUA 4LFBM 2M5ZA 2R65A 4YY3M 1AIPC 2WSFF 2C9OA 1G4AE 1Z5CA 2W82A 4M9ZA 2KHHA 3T1HM 4PDIA 3VFDA 1OJLA 3B89A 1R4GA 3L25A 4RNAA 4D81A 2FE8A 4LJ4A 1WIVA 1DGBA 5ITTA 4LF8M 4B7FA 2KDLA 2ZTDA 2CRUA 1QZMA 1TF0B 3IG5A 3GLGA 4XGIA 1T43A 1Q39A 3M6AA 5L8RF 4JI8M 2UXDM 2P5TA 4L78A 1NO1A 2DHRA 1V34A 3D8LA 4DR1M 1QQWA 2F5SA 4JI4M 1V33A 4DR5M 3AJIB 4KO8A 1GKIA 1IXSB 1OFIA 3UGJA 3FUWA 1QAMA 1A5TA 1QZEA 1NVMA 1VG5A 2BJWA 3FUTA 2E5LM 4LF9M 4MB7A 4AQYM 4NXMM 3QYEA 5ITUA 2UUAM 2G5GX 2X8AA 4DV2M 5KQDA 3LMMA 4B3RM 4IBFA 2XZFA 2H5XA 1IFYA 2QP9X 4BBAA 3JAMS 3U6EA 2KZSA 2L09A 2JNHA 2JY5A 3QAUA 3U61A 3J7AS 4AKIA 2Z4SA 4S12A 3ZC7B 1NHGC 1N75A 4RKUF 1X37A 1NY6A 1G71A 3IHPA 4IBDA 2J7NA 3AOEC 1L8QA 1IXSA 2LWXA 2O01F 2HCBA 1PJIA 1XNQM 3AV0A 3FUVA 1H6UA 1LTMA 3HZJA 4F1IA 1Z5BA 4IBCA 4PCZA 3U6MA 1EIJA 1IN7A 2JY6B 2ZTCA 4FVMA 5ITXE 2R4EA 3GLGB 3SBJA 1ZMWA 4X62M 2KEBA 4DV6M 2CHGA 1IY0A 1N36M 3RE8A 1NY5A 3U6LA 4LRTA 3C9PA 2EKKA 1SXJD 4FWGA 3KXEC 2XGNA 3U6CA 8CATA 3SARA 2Y0TA 4P17A 2CEAA 3I04M 1PRBA 4GRIA 2Q2EB 4IBIA 4LF6M 4QNRA 4AZFA 2XH9A 1MN3A 2K0BX 3C3EA 1IBMM 4L16A 2DKLA 4QOZC 3GRVA 4LF5M 3EIEA 4G6ZA 5BR8M 3SATA 4XK8F 3SYLA 2KXEA 3FTFA 1IY2A 4GC9A 1IN6A 4AKGA 1P3QQ 1VEKA 2M60A 4JI2M 3LQRA 3JR4A 4I5SA 3U60B 5DYGA 3KSXA 4RF0A 4X65M 4RF1A 5EQTA 2I7PA 3SYKA 2RKOA 2L4FA 2DWZB 2JXNA 1T6OA 5EXTA 2DENA 1XXHB 1OAOC 4NRVA 1OTRA 4IBJA 3HGIA 4OVZB 1OQYA 3AKZA 4AG5A 2G3QA 3BBZA 3ZQJA 1QAOA 3Q8GA 3A42A 3GPXA 1J09A 1SG9A 2NQ8C 1TTEA 1D0KA 1E9SA 2QPAA 4X64M 3IG8A 3JR5A 1WGNA 3PNVA 3RGSA 1YUBA 5GKNA 3GRRA 4G4RA 2CHQA 1N78A 2LVQD 3K9PA 2ZANA 4II7A 4GHLA 1D0MA 3GQ3A 4FCWA 1BVSA 5DFLA 2OPFA 2O25A 4KT0F 1GJTA 3SFZA 3KS8A 2R45A 1XXHA 2L7IA 2J7OA 4OX9M 3U6DA 1D2NA 3AFHA 3FUXA 3KVWA 2DI0A 1XC8A 1TDZA 2VQEM 2LHCA 1KFVA 2UUBM 3TWMA 3AOGA 4OW0A 2ERCA 5KPTA 2Z8YM 5F3WA 2UUCM 3TWLA 1DO2A 2D7GA 3K2LA 4IBKA 2HAKA 1XXHE 2XSZA 1WR1B 2F5QA 5H37D 2FNAA 2AHMA 2BJVA 2LTUA 1D0LA 2XF3A 1YLAA 4HLQA 2R44A 1L2DA 3HHWA 3GLIE 4CISA 1T3TA 2FOIC 2R0IA 3T1YM 4LF4M 1QVRA 1YE9A 2R4JA 3B7QA 2EKFA 1LV7A 1W5TA 3RGPA 1IN8A 1QDTA 2CFOA 3MHVC 2B3TA 4M0DA 2CV0A 3KP1E 4F2LA 3KOXE 4FW9A 4AKHA 4IIWA 1DGGA 3FKEA 1GL6A 1JQJC 1SXJC 4LJAA 3CTWB 2OQ4A 2D7HA 1TR8A 4IJFA 2FFJA 5EXSA 4DR6M 1L2BA 3GLHB 3V76A 2YQZA 2J5YA 5EP2A 4Z8XA 1G8PA 1IBKM 4JN6A 2O5RA 2EUCA 2C5RA 2QBYA 1PJQA 4DV0M 3KW6A 2L6OA 3FYCA 4K0KM 5KPZA 2CHVA 2HWJA 2HL7A 3M7GA 4GMQA 2DAGA 2XLJA 4GC5A 4DR3M 3B7ZA 5FLXS 2DZNB 2DAMA 1E9RA 1Q3BA 3GPPA 1L1ZA 1XNRM 4LFCM 3M0EA 5IWAM 1GVNA 5FTMA 4ZPXA 2XFSA 4MGIE 4QHSA 2R62A 3I01M 5JI2E 1N34M 3KFUG 2QHOB 4GITA 3AOEA 3NBIA 5C18A 4JI3M 1SXJA 1W5SA 1R2ZA 5EP3A 5LMUM 1G41A 4DV4M 4R71A 2JUJA 3LVWA 3LW5F 3K92A 3VDUA 4BB9A 2F5OA 3BOSA 3HX3A 4PDGA 2LHGA 3J80S 2F5NA 1F4IA 1ORYB
chains in the Genus database with same CATH topology
1OTRA 2OOBA 1VEGA 4DBGB 1OQYA 2LVOC 2DAKA 2MROB 1DV0A 2G3QA 3BBZA 1Q02A 1SG9A 1TTEA 1VEJA 1KYIA 1WGNA 1IM2A 3LCVB 4WP2A 2DAEA 2LVQD 3K9PA 4UN2B 3K9OA 1AIPC 2LVNC 1G4AE 1BVSA 2KHHA 5DFLA 2O25A 1GO5A 1VQ1A 3B89A 2CP8A 1R4GA 3IECA 1Y8GA 2JY8A 2MR9A 2MGWA 1WIVA 2DHYA 1V92A 2ZTDA 2CWBA 2DI0A 1E94E 1T43A 3F92A 1VDLA 3LCUA 2OO9A 3H4JA 2KNZA 1DO2A 1JR3E 2EJSA 2HAKA 1XB2B 1XXHE 1OKSA 1WR1B 1UFZA 2QNJA 3E46A 3MMPA 1A5TA 1QZEA 1VG5A 2MJ5B 2LTUA 4Q7JA 1YLAA 1CUKA 1HQYE 3GLIE 2R0IA 1IFYA 2H5XA 2DAIA 2EKFA 2B3TA 2JNHA 2JY5A 4F2LA 3E21A 3GLGE 1C7YA 4HEOA 2WZJA 3FRHA 1WGLA 2JY7A 1HJPA 1TR8A 3IHPA 1PGYA 1HT2E 2OOAA 2DZLA 1IXSA 1OAIA 2QSFX 2L4EA 1NV9A 4F1IA 1ZMVA 2K9DA 1DO0A 2HWJA 2JY6B 2ZTCA 3FRIA 4G3OA 1ZMWA 2DAGA 2BWBA 2JZ0A 2KNAA 2DNAA 2LVAA 2EKKA 2DAMA 3GLHE 2LBCA 2RRUA 1NV8A 2BWEA 2KNVA 5JI2E 1MN3A 2K0BX 2QHOB 1ZMUA 2JP7A 2DKLA 2JZ1A 4GEWA 1G3IA 1EFUB 1WHCA 1WJ7A 1G41A 2L2DA 1P3QQ 2LVPC 1VEKA 1ZV1A 4R71A 3FE3A 2JUJA 3T6PA 1HT1E 1F4IA 2L4FA 1T6OA 2DENA 3GLFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTR A;  2OOB A;  1VEG A;  4DBG B;  1OQY A;  2LVO C;  2DAK A;  2MRO B;  1DV0 A;  2G3Q A;  3BBZ A;  1Q02 A;  1SG9 A;  1TTE A;  1VEJ A;  1KYI A;  1WGN A;  1IM2 A;  3LCV B;  4WP2 A;  2DAE A;  2LVQ D;  3K9P A;  4UN2 B;  3K9O A;  1AIP C;  2LVN C;  1G4A E;  1BVS A;  2KHH A;  5DFL A;  2O25 A;  1GO5 A;  1VQ1 A;  3B89 A;  2CP8 A;  1R4G A;  3IEC A;  1Y8G A;  2JY8 A;  2MR9 A;  2MGW A;  1WIV A;  2DHY A;  1V92 A;  2ZTD A;  2CWB A;  2DI0 A;  1E94 E;  1T43 A;  3F92 A;  1VDL A;  3LCU A;  2OO9 A;  3H4J A;  2KNZ A;  1DO2 A;  1JR3 E;  2EJS A;  2HAK A;  1XB2 B;  1XXH E;  1OKS A;  1WR1 B;  1UFZ A;  2QNJ A;  3E46 A;  3MMP A;  1A5T A;  1QZE A;  1VG5 A;  2MJ5 B;  2LTU A;  4Q7J A;  1YLA A;  1CUK A;  1HQY E;  3GLI E;  2R0I A;  1IFY A;  2H5X A;  2DAI A;  2EKF A;  2B3T A;  2JNH A;  2JY5 A;  4F2L A;  3E21 A;  3GLG E;  1C7Y A;  4HEO A;  2WZJ A;  3FRH A;  1WGL A;  2JY7 A;  1HJP A;  1TR8 A;  3IHP A;  1PGY A;  1HT2 E;  2OOA A;  2DZL A;  1IXS A;  1OAI A;  2QSF X;  2L4E A;  1NV9 A;  4F1I A;  1ZMV A;  2K9D A;  1DO0 A;  2HWJ A;  2JY6 B;  2ZTC A;  3FRI A;  4G3O A;  1ZMW A;  2DAG A;  2BWB A;  2JZ0 A;  2KNA A;  2DNA A;  2LVA A;  2EKK A;  2DAM A;  3GLH E;  2LBC A;  2RRU A;  1NV8 A;  2BWE A;  2KNV A;  5JI2 E;  1MN3 A;  2K0B X;  2QHO B;  1ZMU A;  2JP7 A;  2DKL A;  2JZ1 A;  4GEW A;  1G3I A;  1EFU B;  1WHC A;  1WJ7 A;  1G41 A;  2L2D A;  1P3Q Q;  2LVP C;  1VEK A;  1ZV1 A;  4R71 A;  3FE3 A;  2JUJ A;  3T6P A;  1HT1 E;  1F4I A;  2L4F A;  1T6O A;  2DEN A;  3GLF E; 
#chains in the Genus database with same CATH topology
 1QAQ A;  4YHH M;  4JV5 M;  1WXQ A;  2JWS A;  4NSR A;  4FCV A;  4P16 A;  4PD2 A;  2N35 A;  2DZO B;  3U6S A;  2BNK A;  3HU3 A;  3QWL A;  3ZH9 B;  3GLI A;  4QOS A;  3FYD A;  4JXJ A;  1IN4 A;  3T15 A;  3W67 A;  1GL7 A;  1Z59 A;  1IN5 A;  3B7N A;  2YR0 A;  3C3D A;  4I8O A;  1IM2 A;  4AI6 A;  3A46 A;  4BLC A;  5FTN A;  3KOW E;  3E4R A;  3MJ5 A;  2DAE A;  3U60 A;  4JI7 M;  3K9O A;  2Y0Q A;  3DFZ A;  3L28 A;  4MM3 B;  1IY1 A;  3HWS A;  1GO5 A;  3GP1 A;  4LGY A;  5LMN M;  1VQ1 A;  5ITX A;  4L8R C;  1QDR A;  1Y8G A;  3MK6 A;  5IZ7 D;  4JI1 M;  3CF6 E;  1R5L A;  1J5E M;  2DHY A;  2KRU A;  1V92 A;  4ANR A;  4LJ5 A;  2V1C A;  2G8L A;  3DA1 A;  3W0F A;  3T38 A;  1I4W A;  2I7N A;  1K3X A;  2VF8 A;  3W0L B;  3I4Y A;  5ITR A;  3C58 A;  4GIP A;  5EP1 A;  1VDL A;  1HR0 M;  1I94 M;  1VDD A;  5ITY A;  2OO9 A;  3H4J A;  3GPU A;  4CJ6 A;  2KNZ A;  1JR3 E;  2EJS A;  2XFT A;  3ILK A;  3GO8 A;  1XB2 B;  5EXP A;  1OKS A;  1XWI A;  2APL A;  1NNU C;  5KO3 A;  4DUZ M;  3MMP A;  1S3S A;  3VKH A;  2KRK A;  2HKJ A;  4MGY E;  5FSW A;  3U5Z A;  3HHZ A;  1TH3 A;  2MJ5 B;  5EJC A;  2H1R A;  3A45 A;  4Q7J A;  1YSY A;  1CUK A;  5EXX A;  4AG6 A;  5FTJ A;  3TL4 X;  3R8F A;  4MGZ E;  3VK7 A;  3L2A A;  2R46 A;  2Y21 A;  2DAI A;  2YFQ A;  4FD2 A;  3SMS A;  3UMM A;  4DR7 M;  4GH9 A;  1XMO M;  2UXB M;  5BPV A;  4ITQ A;  3E21 A;  4CIZ A;  1GAB A;  1TGU A;  4R3D A;  3PVS A;  4G4O A;  3U6P A;  1N32 M;  4HEO A;  5IRE B;  2WZJ A;  2XSZ D;  3FRH A;  4FWH A;  3J2P B;  1JR3 A;  2FH0 A;  3BXW A;  1HT2 E;  2OOA A;  3GPY A;  2DZL A;  4OU7 A;  4G4N A;  3TE6 A;  1NHW C;  4AW4 A;  2RGH A;  4TUW A;  3DZD A;  3ZCB B;  2L4E A;  2Z7J A;  2X4A A;  3TPZ A;  1NV9 A;  3GLI B;  1HNX M;  7CAT A;  3E9S A;  3SAV A;  2VF7 A;  4EIW A;  4LZZ A;  3GQ5 A;  2K9D A;  1DO0 A;  1PM5 A;  3L27 A;  3FRI A;  2VII A;  2QBY B;  1HQC A;  1Q3C A;  4LJ9 A;  2C99 A;  4NL4 H;  3HHY A;  1AUA A;  2DVW B;  2JZ0 A;  3KOZ E;  2KNA A;  2LVA A;  1OFH A;  4JI6 M;  4FWD A;  2RGO A;  3SAW A;  4LY6 A;  5FTK A;  3SMP A;  4M9S A;  3VKG A;  1TDH A;  3GLH E;  2LBC A;  4MGK E;  3W68 A;  4A3V B;  3J7B A;  4DR2 M;  2MH8 A;  1NJG A;  2BWE A;  1IXR C;  2QZ4 A;  3GRY A;  3U6O A;  1QAN A;  1SXJ B;  3RFW A;  2QEN A;  1ZMU A;  2JP7 A;  2GNO A;  4IBB A;  4QHT A;  1PJJ A;  1OIP A;  4G4Q A;  1PJS A;  4REZ A;  5C1B A;  2CE7 A;  3K1J A;  1IXZ A;  3FD9 A;  2LVP C;  3PXG A;  2HHH M;  3FE3 A;  1ZQ9 A;  2ZM6 M;  1N33 M;  4LZJ A;  4MGH A;  4Y28 F;  2UU9 M;  1HT1 E;  1GJS A;  1EE8 A;  2OOB A;  3GLF E;  3B9P A;  1XHB A;  5ITQ A;  3GLH A;  1SXJ E;  2LVO C;  2DAK A;  1Z6T A;  2MRO B;  3I4V A;  2XZU A;  1DV0 A;  1R7R A;  3R9X B;  2QQ8 A;  1Q02 A;  3HJ8 A;  2Z4R A;  4L4U A;  1NSF A;  1QUT A;  3KOY E;  3Q8X A;  2KZU A;  4B7G A;  4B08 A;  1R2Y A;  4GHA A;  3WHK A;  2R6F A;  2F4V M;  2CV1 A;  3FTE A;  3SAS A;  3HKP A;  2C9C A;  3TWK A;  1C1K A;  1QUS A;  3FTD A;  4WP2 A;  3VDP A;  3GLF A;  4GKK M;  4MH0 E;  4UN2 B;  1K82 A;  1UM8 A;  4KLN A;  2LVN C;  4NC6 A;  1MJG M;  2GQF A;  4FCT A;  4D82 A;  5FTL A;  2CV2 A;  4JI5 M;  1ZAE A;  2WSC F;  1JR3 D;  2C96 A;  4GKJ M;  2CP8 A;  3HU1 A;  2LH0 A;  3IEC A;  2JY8 A;  2MR9 A;  2MGW A;  3NBX X;  1FJG M;  4NXN M;  3HY5 A;  4W5W A;  3CF2 A;  4NRW A;  2CWB A;  2V1U A;  1E94 E;  1TH2 A;  3UK6 A;  2XEP A;  3F92 A;  2FS1 A;  5A2Q S;  4XBO A;  3FUU A;  1IQP A;  4LJ7 A;  4OVZ A;  3LCU A;  3H4M A;  3KS4 A;  3PNY A;  3OTO M;  2KW0 A;  1NNJ A;  4PT5 A;  2QCU A;  3VLF B;  2QNJ A;  1UFZ A;  3E46 A;  4DV7 M;  3CF0 A;  1TH4 A;  2ZAO A;  2JA2 A;  2ZBK B;  3DOA A;  3AL0 C;  4L6V 6;  4X66 M;  2Y20 A;  4DV3 M;  2ZAM A;  1HQY E;  1MU5 A;  4R7G A;  5KPR A;  2R18 A;  4CGY B;  2EA0 A;  3PFI A;  3THG A;  2LNH C;  1J7K A;  3NWL A;  4KOD A;  4LG2 A;  2V6Z M;  1KSF X;  1MX0 A;  4I4L A;  3HJS A;  3SHF A;  3GLG E;  4LFA M;  2EO2 A;  1C7Y A;  2K6B A;  2YNM D;  4LRS A;  3QYB A;  4LJ8 A;  4M0W A;  4I81 A;  1WGL A;  2JY7 A;  4JI0 M;  3LQQ A;  1HJP A;  3HHX A;  4D80 A;  3A98 B;  1G59 A;  2C98 A;  1PGY A;  3KSJ A;  3SHG B;  4DUY M;  1DGF A;  1OAI A;  2K47 A;  3J27 B;  2QSF X;  1DGH B;  2DWM A;  2Z3X A;  4IBE A;  1L2C A;  1ZMV A;  1JB0 F;  3D8B A;  4G3O A;  3J81 S;  1HNZ M;  2BWB A;  2LXE A;  2A5Y B;  3TQS A;  5E26 A;  4KHP M;  1RU3 A;  3L29 A;  2DNA A;  5E6J A;  3WHL A;  4WW0 A;  4B7H A;  4B3M M;  2VQF M;  5JI3 E;  3GRU A;  2DXI A;  2VDB B;  3HJQ A;  5DNY A;  2RRU A;  4LJ6 A;  5KQ8 A;  4HL4 A;  2L7H A;  1OIZ A;  4IBG A;  3SC3 A;  4DV1 M;  1NV8 A;  2KNV A;  4B3S M;  3U5Z B;  1GLN A;  2KA6 B;  2DWN A;  1R6B X;  4L15 A;  3U61 B;  5EP4 A;  4IJE A;  4LCB A;  4DV5 M;  2JZ1 A;  4LGM A;  1DGH A;  1NJF A;  3GQ4 A;  4M9X A;  1XMQ M;  4GEW A;  1FNN A;  1G3I A;  3L26 A;  1L1T A;  4JYA M;  1EFU B;  1WHC A;  2F5P A;  1WJ7 A;  4QNM A;  1N77 A;  2L2D A;  4NOO B;  1QYR A;  1ZV1 A;  1HNW M;  1Z5A A;  4LF7 M;  3T6P A;  5DYI A;  4Z6Y A;  2X49 A;  3UJN A;  3HU2 A;  3EIH A;  3GLF B;  1PJT A;  4B3T M;  3UZU A;  3U6Q A;  3FTC A;  3CGW A;  1VEG A;  4DBG B;  2CUZ A;  2DWL A;  2WSE F;  4NSO B;  1VEJ A;  4CHT B;  3B74 A;  3I51 A;  1KYI A;  3LVV A;  5IT9 S;  3KP0 E;  1K3W A;  1E32 A;  3KDS E;  3K8Z A;  4WUR A;  2D7E A;  3LCV B;  2UXC M;  1IBL M;  3VK8 A;  4DR4 M;  3SAU A;  4LFB M;  2M5Z A;  2R65 A;  4YY3 M;  1AIP C;  2WSF F;  2C9O A;  1G4A E;  1Z5C A;  2W82 A;  4M9Z A;  2KHH A;  3T1H M;  4PDI A;  3VFD A;  1OJL A;  3B89 A;  1R4G A;  3L25 A;  4RNA A;  4D81 A;  2FE8 A;  4LJ4 A;  1WIV A;  1DGB A;  5ITT A;  4LF8 M;  4B7F A;  2KDL A;  2ZTD A;  2CRU A;  1QZM A;  1TF0 B;  3IG5 A;  3GLG A;  4XGI A;  1T43 A;  1Q39 A;  3M6A A;  5L8R F;  4JI8 M;  2UXD M;  2P5T A;  4L78 A;  1NO1 A;  2DHR A;  1V34 A;  3D8L A;  4DR1 M;  1QQW A;  2F5S A;  4JI4 M;  1V33 A;  4DR5 M;  3AJI B;  4KO8 A;  1GKI A;  1IXS B;  1OFI A;  3UGJ A;  3FUW A;  1QAM A;  1A5T A;  1QZE A;  1NVM A;  1VG5 A;  2BJW A;  3FUT A;  2E5L M;  4LF9 M;  4MB7 A;  4AQY M;  4NXM M;  3QYE A;  5ITU A;  2UUA M;  2G5G X;  2X8A A;  4DV2 M;  5KQD A;  3LMM A;  4B3R M;  4IBF A;  2XZF A;  2H5X A;  1IFY A;  2QP9 X;  4BBA A;  3JAM S;  3U6E A;  2KZS A;  2L09 A;  2JNH A;  2JY5 A;  3QAU A;  3U61 A;  3J7A S;  4AKI A;  2Z4S A;  4S12 A;  3ZC7 B;  1NHG C;  1N75 A;  4RKU F;  1X37 A;  1NY6 A;  1G71 A;  3IHP A;  4IBD A;  2J7N A;  3AOE C;  1L8Q A;  1IXS A;  2LWX A;  2O01 F;  2HCB A;  1PJI A;  1XNQ M;  3AV0 A;  3FUV A;  1H6U A;  1LTM A;  3HZJ A;  4F1I A;  1Z5B A;  4IBC A;  4PCZ A;  3U6M A;  1EIJ A;  1IN7 A;  2JY6 B;  2ZTC A;  4FVM A;  5ITX E;  2R4E A;  3GLG B;  3SBJ A;  1ZMW A;  4X62 M;  2KEB A;  4DV6 M;  2CHG A;  1IY0 A;  1N36 M;  3RE8 A;  1NY5 A;  3U6L A;  4LRT A;  3C9P A;  2EKK A;  1SXJ D;  4FWG A;  3KXE C;  2XGN A;  3U6C A;  8CAT A;  3SAR A;  2Y0T A;  4P17 A;  2CEA A;  3I04 M;  1PRB A;  4GRI A;  2Q2E B;  4IBI A;  4LF6 M;  4QNR A;  4AZF A;  2XH9 A;  1MN3 A;  2K0B X;  3C3E A;  1IBM M;  4L16 A;  2DKL A;  4QOZ C;  3GRV A;  4LF5 M;  3EIE A;  4G6Z A;  5BR8 M;  3SAT A;  4XK8 F;  3SYL A;  2KXE A;  3FTF A;  1IY2 A;  4GC9 A;  1IN6 A;  4AKG A;  1P3Q Q;  1VEK A;  2M60 A;  4JI2 M;  3LQR A;  3JR4 A;  4I5S A;  3U60 B;  5DYG A;  3KSX A;  4RF0 A;  4X65 M;  4RF1 A;  5EQT A;  2I7P A;  3SYK A;  2RKO A;  2L4F A;  2DWZ B;  2JXN A;  1T6O A;  5EXT A;  2DEN A;  1XXH B;  1OAO C;  4NRV A;  1OTR A;  4IBJ A;  3HGI A;  4OVZ B;  1OQY A;  3AKZ A;  4AG5 A;  2G3Q A;  3BBZ A;  3ZQJ A;  1QAO A;  3Q8G A;  3A42 A;  3GPX A;  1J09 A;  1SG9 A;  2NQ8 C;  1TTE A;  1D0K A;  1E9S A;  2QPA A;  4X64 M;  3IG8 A;  3JR5 A;  1WGN A;  3PNV A;  3RGS A;  1YUB A;  5GKN A;  3GRR A;  4G4R A;  2CHQ A;  1N78 A;  2LVQ D;  3K9P A;  2ZAN A;  4II7 A;  4GHL A;  1D0M A;  3GQ3 A;  4FCW A;  1BVS A;  5DFL A;  2OPF A;  2O25 A;  4KT0 F;  1GJT A;  3SFZ A;  3KS8 A;  2R45 A;  1XXH A;  2L7I A;  2J7O A;  4OX9 M;  3U6D A;  1D2N A;  3AFH A;  3FUX A;  3KVW A;  2DI0 A;  1XC8 A;  1TDZ A;  2VQE M;  2LHC A;  1KFV A;  2UUB M;  3TWM A;  3AOG A;  4OW0 A;  2ERC A;  5KPT A;  2Z8Y M;  5F3W A;  2UUC M;  3TWL A;  1DO2 A;  2D7G A;  3K2L A;  4IBK A;  2HAK A;  1XXH E;  2XSZ A;  1WR1 B;  2F5Q A;  5H37 D;  2FNA A;  2AHM A;  2BJV A;  2LTU A;  1D0L A;  2XF3 A;  1YLA A;  4HLQ A;  2R44 A;  1L2D A;  3HHW A;  3GLI E;  4CIS A;  1T3T A;  2FOI C;  2R0I A;  3T1Y M;  4LF4 M;  1QVR A;  1YE9 A;  2R4J A;  3B7Q A;  2EKF A;  1LV7 A;  1W5T A;  3RGP A;  1IN8 A;  1QDT A;  2CFO A;  3MHV C;  2B3T A;  4M0D A;  2CV0 A;  3KP1 E;  4F2L A;  3KOX E;  4FW9 A;  4AKH A;  4IIW A;  1DGG A;  3FKE A;  1GL6 A;  1JQJ C;  1SXJ C;  4LJA A;  3CTW B;  2OQ4 A;  2D7H A;  1TR8 A;  4IJF A;  2FFJ A;  5EXS A;  4DR6 M;  1L2B A;  3GLH B;  3V76 A;  2YQZ A;  2J5Y A;  5EP2 A;  4Z8X A;  1G8P A;  1IBK M;  4JN6 A;  2O5R A;  2EUC A;  2C5R A;  2QBY A;  1PJQ A;  4DV0 M;  3KW6 A;  2L6O A;  3FYC A;  4K0K M;  5KPZ A;  2CHV A;  2HWJ A;  2HL7 A;  3M7G A;  4GMQ A;  2DAG A;  2XLJ A;  4GC5 A;  4DR3 M;  3B7Z A;  5FLX S;  2DZN B;  2DAM A;  1E9R A;  1Q3B A;  3GPP A;  1L1Z A;  1XNR M;  4LFC M;  3M0E A;  5IWA M;  1GVN A;  5FTM A;  4ZPX A;  2XFS A;  4MGI E;  4QHS A;  2R62 A;  3I01 M;  5JI2 E;  1N34 M;  3KFU G;  2QHO B;  4GIT A;  3AOE A;  3NBI A;  5C18 A;  4JI3 M;  1SXJ A;  1W5S A;  1R2Z A;  5EP3 A;  5LMU M;  1G41 A;  4DV4 M;  4R71 A;  2JUJ A;  3LVW A;  3LW5 F;  3K92 A;  3VDU A;  4BB9 A;  2F5O A;  3BOS A;  3HX3 A;  4PDG A;  2LHG A;  3J80 S;  2F5N A;  1F4I A;  1ORY B; 
#chains in the Genus database with same CATH homology
 1OTR A;  2OOB A;  1VEG A;  4DBG B;  1OQY A;  2LVO C;  2DAK A;  2MRO B;  1DV0 A;  2G3Q A;  3BBZ A;  1Q02 A;  1SG9 A;  1TTE A;  1VEJ A;  1KYI A;  1WGN A;  1IM2 A;  3LCV B;  4WP2 A;  2DAE A;  2LVQ D;  3K9P A;  4UN2 B;  3K9O A;  1AIP C;  2LVN C;  1G4A E;  1BVS A;  2KHH A;  5DFL A;  2O25 A;  1GO5 A;  1VQ1 A;  3B89 A;  2CP8 A;  1R4G A;  3IEC A;  1Y8G A;  2JY8 A;  2MR9 A;  2MGW A;  1WIV A;  2DHY A;  1V92 A;  2ZTD A;  2CWB A;  2DI0 A;  1E94 E;  1T43 A;  3F92 A;  1VDL A;  3LCU A;  2OO9 A;  3H4J A;  2KNZ A;  1DO2 A;  1JR3 E;  2EJS A;  2HAK A;  1XB2 B;  1XXH E;  1OKS A;  1WR1 B;  1UFZ A;  2QNJ A;  3E46 A;  3MMP A;  1A5T A;  1QZE A;  1VG5 A;  2MJ5 B;  2LTU A;  4Q7J A;  1YLA A;  1CUK A;  1HQY E;  3GLI E;  2R0I A;  1IFY A;  2H5X A;  2DAI A;  2EKF A;  2B3T A;  2JNH A;  2JY5 A;  4F2L A;  3E21 A;  3GLG E;  1C7Y A;  4HEO A;  2WZJ A;  3FRH A;  1WGL A;  2JY7 A;  1HJP A;  1TR8 A;  3IHP A;  1PGY A;  1HT2 E;  2OOA A;  2DZL A;  1IXS A;  1OAI A;  2QSF X;  2L4E A;  1NV9 A;  4F1I A;  1ZMV A;  2K9D A;  1DO0 A;  2HWJ A;  2JY6 B;  2ZTC A;  3FRI A;  4G3O A;  1ZMW A;  2DAG A;  2BWB A;  2JZ0 A;  2KNA A;  2DNA A;  2LVA A;  2EKK A;  2DAM A;  3GLH E;  2LBC A;  2RRU A;  1NV8 A;  2BWE A;  2KNV A;  5JI2 E;  1MN3 A;  2K0B X;  2QHO B;  1ZMU A;  2JP7 A;  2DKL A;  2JZ1 A;  4GEW A;  1G3I A;  1EFU B;  1WHC A;  1WJ7 A;  1G41 A;  2L2D A;  1P3Q Q;  2LVP C;  1VEK A;  1ZV1 A;  4R71 A;  3FE3 A;  2JUJ A;  3T6P A;  1HT1 E;  1F4I A;  2L4F A;  1T6O A;  2DEN A;  3GLF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...