2MJ5B

Structure of the uba domain of human nbr1 in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-C
publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mj5B00
2JY8A 2OO9A 1PGYA 1ZMWA 1TTEA 1UFZA 2JY5A 2ZTCA 1VEGA 1XB2B 1WJ7A 2JNHA 3MMPA 2QHOB 2JUJA 3GLGE 3B89A 1WR1B 1OQYA 2DKLA 2DAEA 5JI2E 2BWBA 2KNVA 2JZ0A 2K9DA 1R4GA 2DI0A 1HJPA 1WIVA 1EFUB 1XXHE 1P3QQ 4HEOA 1IXSA 2EKKA 2MGWA 1BVSA 1Q02A 2HWJA 1YLAA 2LVAA 4F1IA 2L2DA 2B3TA 3IECA 1IM2A 2LVQD 2KNAA 2MJ5B 1E94E 2KHHA 2KNZA 1VDLA 1VQ1A 2BWEA 4GEWA 1VEKA 3BBZA 1WGLA 1G41A 3FRIA 2DAKA 1HQYE 3LCVB 1F4IA 3E21A 1VEJA 2MR9A 1GO5A 2L4FA 1NV9A 2JZ1A 1T43A 1OTRA 4DBGB 1AIPC 1MN3A 4R71A 2DAIA 4WP2A 2LVOC 1C7YA 2K0BX 2DAMA 1WHCA 3K9PA 3GLHE 2LBCA 2ZTDA 2OOBA 1HT2E 3IHPA 2DNAA 2OOAA 3FRHA 1G4AE 3LCUA 1NV8A 3GLFE 4F2LA 3GLIE 1OKSA 1HT1E 1V92A 1QZEA 1ZV1A 2JY6B 2WZJA 1A5TA 2L4EA 2QNJA 2G3QA 1DV0A 1JR3E 2JP7A 2HAKA 1DO2A 2EKFA 1DO0A 1VG5A 2DENA 3E46A 2R0IA 1G3IA 1KYIA 4Q7JA 1OAIA 2LTUA 2QSFX 3F92A 1T6OA 2LVNC 1CUKA 1TR8A 3FE3A 4UN2B 3K9OA 2RRUA 1IFYA 2DZLA 3H4JA 2CP8A 1WGNA 1SG9A 2JY7A 2MROB 1Y8GA 1ZMVA 2O25A 1ZMUA 2DHYA 3T6PA 2LVPC 2EJSA 2H5XA 5DFLA 2CWBA 2DAGA 4G3OA
chains in the Genus database with same CATH superfamily
1E9SA 3TWKA 3RGPA 1R7RA 4FWDA 3OTOM 1ZQ9A 4OU7A 4IBCA 1VEGA 2UU9M 1VDDA 4S12A 1G71A 3AOGA 1IN5A 5ITUA 1QVRA 3U61A 2FH0A 2JUJA 2V1UA 4M9ZA 3UMMA 2DAEA 3HJQA 2KZSA 4DV1M 2YNMD 2YR0A 2FOIC 2VIIA 2J7OA 1SXJB 2DZNB 4IBBA 1R4GA 4AW4A 5EP4A 1HJPA 1T3TA 4PT5A 1MJGM 5KO3A 4HEOA 4X66M 4A3VB 3B7QA 2VQFM 3HJSA 1SXJA 2KW0A 4BBAA 2DWLA 1Q02A 1D0KA 1K3XA 1HR0M 1NJGA 1IXRC 2BJWA 1QAMA 3FUUA 1XNQM 4LCBA 4NRVA 4NRWA 1GJSA 2MJ5B 2R44A 3B7ZA 4NSRA 1EIJA 4JV5M 1VEKA 4B7FA 3CF2A 1WGLA 2OPFA 4LF8M 1G41A 1QDRA 2LWXA 3FRIA 4LJ4A 5BPVA 4LF9M 3PNVA 2HCBA 4L16A 1VEJA 4AQYM 1OIPA 2KRUA 2D7HA 2JZ1A 4JI2M 4LRSA 2K47A 1TH4A 3SYKA 4DBGB 5EJCA 1Z59A 1MN3A 4Z6YA 4QOZC 2DAIA 3B7NA 4WP2A 4FWGA 4AKIA 2K0BX 4B3RM 3SAUA 4QHTA 2CUZA 2OOBA 2Y0QA 4DV4M 1C1KA 2R4JA 2EA0A 3NBXX 3NWLA 4ANRA 5C18A 1D0MA 1Q3CA 4NL4H 3GPYA 2CV0A 4DV2M 3SASA 4M9SA 1K3WA 4G4QA 1OKSA 1HT1E 1LV7A 4MGHA 4W5WA 4R7GA 1FJGM 4DR7M 1A5TA 2Z8YM 2L4EA 3SMSA 4LFCM 2XSZD 2G3QA 2P5TA 4AI6A 2CV1A 3FKEA 2M5ZA 3VK7A 2HAKA 4CJ6A 5KQDA 5A2QS 4K0KM 1DO2A 2QZ4A 3TQSA 2EKFA 1D2NA 4MM3B 3L2AA 4AG6A 3ILKA 2XLJA 4JI3M 1IN6A 3KOYE 1DGGA 3SATA 4IBDA 4CHTB 2O01F 4LJ9A 2RGOA 3F92A 3GLGA 1CUKA 5KPTA 1J5EM 3M6AA 3FE3A 1QUSA 2ZAMA 3K9OA 3FTFA 2RRUA 1OFHA 3KOXE 4LFBM 1D0LA 3J27B 3KOZE 4II7A 2QBYB 1L2DA 1IN8A 4FCTA 4MB7A 2VF7A 5ITXE 3TPZA 4TUWA 4QHSA 1XMOM 5C1BA 5ITQA 3AL0C 4IJFA 1ZMVA 2O25A 2QBYA 2DHYA 1TH2A 2EUCA 3Q8GA 2Y0TA 3CF0A 4X64M 3T6PA 2DWMA 3HY5A 1R2YA 2X49A 2H5XA 3SARA 4L78A 3K2LA 5DFLA 3A98B 1UM8A 3LMMA 4NXNM 4KHPM 1GABA 3M7GA 2N35A 4G3OA 2JY8A 1JB0F 1TDHA 1UFZA 5EP2A 5ITRA 2AHMA 1XB2B 1R5LA 4JI0M 2UXDM 4DR3M 3HJ8A 1WR1B 1JQJC 1IBKM 2DWZB 3KDSE 3D8BA 1PJTA 5JI2E 1LTMA 2KNVA 4IIWA 2BNKA 3GLHB 4B7HA 2XGNA 3U60B 4RKUF 4B3TM 2DI0A 3EIHA 4BLCA 4QNRA 5FTJA 4X62M 1DGBA 4X65M 3SBJA 3GLFB 1I4WA 1XXHE 1P3QQ 3L28A 3TWLA 3UJNA 3VDUA 3GLHA 2EKKA 2MGWA 3U60A 1BVSA 2KRKA 5EP1A 3AKZA 2B3TA 3GLFA 2FFJA 4LZZA 4I8OA 4GRIA 1IM2A 3I4YA 2ERCA 2KNAA 3T15A 4MGKE 3GLIA 4GKJM 1OAOC 4YY3M 3A45A 3KXEC 3QWLA 3KVWA 5E6JA 5E26A 5KQ8A 4KT0F 1I94M 1W5TA 4PCZA 1IBLM 4HL4A 4IBJA 2DAKA 4GMQA 4M0WA 4FWHA 4PDGA 2QCUA 1QZMA 1X37A 3AOEC 1F4IA 3HU3A 3HWSA 3V76A 4PDIA 1GO5A 4JYAM 5IREB 3VKGA 3R8FA 1YUBA 4GKKM 3JAMS 1T43A 2CV2A 2C96A 2C9OA 4OW0A 1EE8A 4FW9A 1AIPC 4G6ZA 3HHYA 2C98A 4NXMM 4G4NA 2DAMA 1WHCA 1WXQA 3DZDA 4DV0M 3WHLA 2LH0A 1QAOA 2L7HA 2ZTDA 3I51A 4FCWA 4KODA 1KFVA 2DNAA 2OOAA 3FRHA 4MGIE 2XF3A 1N36M 2V6ZM 4F2LA 4DUZM 1MU5A 1V92A 4JI7M 2NQ8C 4GHLA 1N32M 1GL7A 2J7NA 3KSXA 1JR3E 4I81A 2ZM6M 4JI8M 5EXXA 2FS1A 3UGJA 1XMQM 2H1RA 4DR1M 2Q2EB 3KP0E 2X8AA 3PXGA 1VG5A 4LF6M 3RE8A 1GLNA 4LGYA 3KSJA 2UXCM 3DA1A 4NSOB 4I5SA 4GH9A 4R3DA 2CEAA 3C3DA 3HZJA 3QYEA 1E32A 2R0IA 3VFDA 3ZC7B 4Q7JA 3R9XB 1OAIA 2LTUA 3GRYA 2F5QA 3W0LB 2C99A 3FTCA 2UUBM 3HKPA 1S3SA 5IT9S 4DUYM 3W0FA 1ORYB 4P17A 4QNMA 4AKGA 1AUAA 3VKHA 1JR3D 3K8ZA 3KW6A 4D82A 5IWAM 4D81A 2F5NA 2E5LM 1KSFX 1HNWM 3FYCA 1Q39A 1ZMUA 2LHCA 3EIEA 4GIPA 4MH0E 3GQ4A 3U6CA 2KDLA 1L2CA 2LVPC 5BR8M 1NY5A 2YFQA 3GQ3A 1MX0A 1PJSA 3GLGB 3AOEA 3L25A 3I04M 4L8RC 2OO9A 4YHHM 2UUAM 3SHGB 2C5RA 4HLQA 4QOSA 1PGYA 1ZMWA 1TTEA 4LJ6A 2JY5A 4KO8A 4P16A 2ZTCA 3HGIA 3BOSA 4DV5M 3A42A 4CIZA 3U6DA 1WJ7A 5LMNM 2KA6B 1G8PA 1QAQA 2QENA 2QHOB 3MMPA 1H6UA 4JXJA 4LG2A 3B89A 5KPZA 3TE6A 3LW5F 2CHGA 2L7IA 1PJIA 2XSZA 2BWBA 2CRUA 2QQ8A 3NBIA 4AG5A 3E4RA 1NSFA 3I4VA 2Y21A 2JZ0A 1IXSB 4DV6M 3I01M 2K9DA 1NO1A 1N34M 2R4EA 3HHZA 1QYRA 1WIVA 2XEPA 2XFSA 2WSEF 3D8LA 2R45A 4IBGA 4OX9M 4EIWA 1XC8A 4Y28F 3PNYA 3TL4X 1IXSA 2MH8A 3GPUA 2HWJA 4M9XA 1YLAA 4F1IA 3VK8A 3KS8A 2L2DA 3M0EA 2Z3XA 3W68A 3IECA 3JR5A 3CTWB 5L8RF 3A46A 3GRRA 1YE9A 1FNNA 1V33A 2LVQD 4GC9A 1N75A 4KLNA 1NVMA 3GQ5A 1E94E 2J5YA 2KHHA 3MJ5A 2KNZA 5FLXS 1VDLA 1IY1A 4GEWA 4DV7M 3U6QA 3Q8XA 4L4UA 3VLFB 3GRUA 1L1TA 4LRTA 4RF1A 1HQYE 2GNOA 5KPRA 1G59A 2DHRA 2Z4SA 3U5ZB 4MGZE 2V1CA 3W67A 3T1HM 1HNZM 2KEBA 2L4FA 3J80S 4NC6A 1IN7A 1J09A 1NV9A 3KFUG 4FVMA 1OTRA 1N77A 3GLIB 4IBKA 1QANA 3U5ZA 2L09A 2L6OA 2LVOC 4I4LA 3B9PA 2GQFA 5EXTA 4FD2A 3FTDA 3ZCBB 2CHVA 4CGYB 2DXIA 1SXJE 2LBCA 1N33M 3L27A 3GPPA 3FYDA 3LVVA 2XH9A 5EQTA 1TH3A 1G4AE 1XHBA 3LCUA 5ITYA 3SAWA 3SC3A 2LHGA 1Z5BA 1QDTA 1ZV1A 4M0DA 5ITXA 2JY6B 5EXSA 3HU2A 3WHKA 2XFTA 4JN6A 4L15A 1QUTA 2QNJA 3ZH9B 3DFZA 4G4RA 3T1YM 1IY0A 1QQWA 2JP7A 3T38A 5H37D 1K82A 3AFHA 2W82A 4CISA 1N78A 4LF7M 3H4MA 2EO2A 3HHWA 4JI5M 1DO0A 1Z6TA 1Z5CA 2JXNA 3GO8A 3E46A 4GC5A 4GITA 3LVWA 2DWNA 2XZUA 1GVNA 1W5SA 1SXJD 1Z5AA 2WSFF 1G3IA 2Y20A 3L29A 3AJIB 4B08A 4IBIA 1NY6A 3HHXA 2QSFX 4LF4M 2XZFA 3VDPA 2RGHA 2LVNC 4ZPXA 2KZUA 4UN2B 2CE7A 3PFIA 4ITQA 4REZA 1XXHB 3KOWE 4LJAA 1IFYA 4G4OA 1GL6A 3J2PB 3H4JA 3FUVA 3C9PA 1Q3BA 3LQRA 5EP3A 2CP8A 3SYLA 1SG9A 4B7GA 4AKHA 2MROB 3U6EA 1Y8GA 2C9CA 2I7PA 4BB9A 1IN4A 1DGHB 1XXHA 3MHVC 4PD2A 5FSWA 2UUCM 4GHAA 1OFIA 2F5OA 2OQ4A 2G8LA 4RF0A 4FCVA 3FTEA 2DAGA 1YSYA 1DGHA 5FTNA 2ZANA 3E9SA 2QPAA 4Z8XA 3AV0A 3BXWA 3K92A 3KS4A 2R46A 4LF5M 2A5YB 2I7NA 2JNHA 2FE8A 2Z4RA 3GLGE 1PJJA 1RU3A 2VF8A 1L8QA 2RKOA 4B3SM 1OQYA 3J7BA 1V34A 2DKLA 3J7AS 2UXBM 2QP9X 4LZJA 4WW0A 1HNXM 3HX3A 3GP1A 1DGFA 1TF0B 1E9RA 2DVWB 2WSCF 1IY2A 1EFUB 4NOOB 4LJ5A 4MGYE 3FUXA 5FTLA 5ITTA 4OVZB 2LVAA 3MK6A 2R62A 4IBFA 4XGIA 2R6FA 1NNUC 3RGSA 2X4AA 4OVZA 2BWEA 1VQ1A 1HQCA 3CGWA 2HHHM 2HL7A 4XBOA 4LY6A 2F5SA 5DYGA 1J7KA 1JR3A 1NHGC 3BBZA 1ZAEA 3TWMA 2JWSA 3FD9A 4JI1M 2G5GX 4AZFA 3J81S 3U6LA 3LCVB 1IBMM 3E21A 2MR9A 5DNYA 4JI6M 2YQZA 2F5PA 3U6OA 2D7GA 1XWIA 1TGUA 3PVSA 1R2ZA 1R6BX 2F4VM 4XK8F 1IQPA 4D80A 4R71A 3U6MA 2DZOB 1C7YA 2BJVA 3SAVA 1OIZA 2ZAOA 3K9PA 1GKIA 3GLHE 3K1JA 1L1ZA 4DR6M 1HT2E 2VDBB 3IHPA 3C58A 5F3WA 3HU1A 1XNRM 4DR4M 2FNAA 1NV8A 4RNAA 3GLFE 1IXZA 3GLIE 1NJFA 3C3EA 5IZ7D 1QZEA 2JA2A 3QYBA 2LNHC 2WZJA 5DYIA 2KXEA 1DV0A 1SXJC 3B74A 2R18A 2VQEM 1PM5A 1PRBA 4JI4M 2K6BA 1L2BA 5FTMA 4LJ7A 2LXEA 4DR5M 2DENA 4IJEA 3L26A 3FUWA 3SHFA 2M60A 3FUTA 4DV3M 3DOAA 2Z7JA 1PJQA 1TDZA 3RFWA 1NNJA 4IBEA 7CATA 4DR2M 1KYIA 5EXPA 3CF6E 2ZBKB 3U6SA 1NHWC 3LQQA 2R65A 1T6OA 3IG8A 3SMPA 3GPXA 3IG5A 2D7EA 3KP1E 3JR4A 1TR8A 5JI3E 3ZQJA 5LMUM 2DZLA 3U6PA 4LGMA 2CFOA 1GJTA 2O5RA 5GKNA 4LJ8A 1WGNA 2JY7A 4B3MM 2HKJA 2CHQA 3SFZA 4WURA 3QAUA 3UZUA 3GRVA 4L6V6 3THGA 2EJSA 4LFAM 5FTKA 2APLA 3UK6A 8CATA 2CWBA 3U61B 1OJLA
chains in the Genus database with same CATH topology
2JY8A 2OO9A 1PGYA 1ZMWA 1TTEA 1UFZA 2JY5A 2ZTCA 1VEGA 1XB2B 1WJ7A 2JNHA 3MMPA 2QHOB 2JUJA 3GLGE 3B89A 1WR1B 1OQYA 2DKLA 2DAEA 5JI2E 2BWBA 2KNVA 2JZ0A 2K9DA 1R4GA 2DI0A 1HJPA 1WIVA 1EFUB 1XXHE 1P3QQ 4HEOA 1IXSA 2EKKA 2MGWA 1BVSA 1Q02A 2HWJA 1YLAA 2LVAA 4F1IA 2L2DA 2B3TA 3IECA 1IM2A 2LVQD 2KNAA 2MJ5B 1E94E 2KHHA 2KNZA 1VDLA 1VQ1A 2BWEA 4GEWA 1VEKA 3BBZA 1WGLA 1G41A 3FRIA 2DAKA 1HQYE 3LCVB 1F4IA 3E21A 1VEJA 2MR9A 1GO5A 2L4FA 1NV9A 2JZ1A 1T43A 1OTRA 4DBGB 1AIPC 1MN3A 4R71A 2DAIA 4WP2A 2LVOC 1C7YA 2K0BX 2DAMA 1WHCA 3K9PA 3GLHE 2LBCA 2ZTDA 2OOBA 1HT2E 3IHPA 2DNAA 2OOAA 3FRHA 1G4AE 3LCUA 1NV8A 3GLFE 4F2LA 3GLIE 1OKSA 1HT1E 1V92A 1QZEA 1ZV1A 2JY6B 2WZJA 1A5TA 2L4EA 2QNJA 2G3QA 1DV0A 1JR3E 2JP7A 2HAKA 1DO2A 2EKFA 1DO0A 1VG5A 2DENA 3E46A 2R0IA 1G3IA 1KYIA 4Q7JA 1OAIA 2LTUA 2QSFX 3F92A 1T6OA 2LVNC 1CUKA 1TR8A 3FE3A 4UN2B 3K9OA 2RRUA 1IFYA 2DZLA 3H4JA 2CP8A 1WGNA 1SG9A 2JY7A 2MROB 1Y8GA 1ZMVA 2O25A 1ZMUA 2DHYA 3T6PA 2LVPC 2EJSA 2H5XA 5DFLA 2CWBA 2DAGA 4G3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY8 A;  2OO9 A;  1PGY A;  1ZMW A;  1TTE A;  1UFZ A;  2JY5 A;  2ZTC A;  1VEG A;  1XB2 B;  1WJ7 A;  2JNH A;  3MMP A;  2QHO B;  2JUJ A;  3GLG E;  3B89 A;  1WR1 B;  1OQY A;  2DKL A;  2DAE A;  5JI2 E;  2BWB A;  2KNV A;  2JZ0 A;  2K9D A;  1R4G A;  2DI0 A;  1HJP A;  1WIV A;  1EFU B;  1XXH E;  1P3Q Q;  4HEO A;  1IXS A;  2EKK A;  2MGW A;  1BVS A;  1Q02 A;  2HWJ A;  1YLA A;  2LVA A;  4F1I A;  2L2D A;  2B3T A;  3IEC A;  1IM2 A;  2LVQ D;  2KNA A;  2MJ5 B;  1E94 E;  2KHH A;  2KNZ A;  1VDL A;  1VQ1 A;  2BWE A;  4GEW A;  1VEK A;  3BBZ A;  1WGL A;  1G41 A;  3FRI A;  2DAK A;  1HQY E;  3LCV B;  1F4I A;  3E21 A;  1VEJ A;  2MR9 A;  1GO5 A;  2L4F A;  1NV9 A;  2JZ1 A;  1T43 A;  1OTR A;  4DBG B;  1AIP C;  1MN3 A;  4R71 A;  2DAI A;  4WP2 A;  2LVO C;  1C7Y A;  2K0B X;  2DAM A;  1WHC A;  3K9P A;  3GLH E;  2LBC A;  2ZTD A;  2OOB A;  1HT2 E;  3IHP A;  2DNA A;  2OOA A;  3FRH A;  1G4A E;  3LCU A;  1NV8 A;  3GLF E;  4F2L A;  3GLI E;  1OKS A;  1HT1 E;  1V92 A;  1QZE A;  1ZV1 A;  2JY6 B;  2WZJ A;  1A5T A;  2L4E A;  2QNJ A;  2G3Q A;  1DV0 A;  1JR3 E;  2JP7 A;  2HAK A;  1DO2 A;  2EKF A;  1DO0 A;  1VG5 A;  2DEN A;  3E46 A;  2R0I A;  1G3I A;  1KYI A;  4Q7J A;  1OAI A;  2LTU A;  2QSF X;  3F92 A;  1T6O A;  2LVN C;  1CUK A;  1TR8 A;  3FE3 A;  4UN2 B;  3K9O A;  2RRU A;  1IFY A;  2DZL A;  3H4J A;  2CP8 A;  1WGN A;  1SG9 A;  2JY7 A;  2MRO B;  1Y8G A;  1ZMV A;  2O25 A;  1ZMU A;  2DHY A;  3T6P A;  2LVP C;  2EJS A;  2H5X A;  5DFL A;  2CWB A;  2DAG A;  4G3O A; 
#chains in the Genus database with same CATH topology
 1E9S A;  3TWK A;  3RGP A;  1R7R A;  4FWD A;  3OTO M;  1ZQ9 A;  4OU7 A;  4IBC A;  1VEG A;  2UU9 M;  1VDD A;  4S12 A;  1G71 A;  3AOG A;  1IN5 A;  5ITU A;  1QVR A;  3U61 A;  2FH0 A;  2JUJ A;  2V1U A;  4M9Z A;  3UMM A;  2DAE A;  3HJQ A;  2KZS A;  4DV1 M;  2YNM D;  2YR0 A;  2FOI C;  2VII A;  2J7O A;  1SXJ B;  2DZN B;  4IBB A;  1R4G A;  4AW4 A;  5EP4 A;  1HJP A;  1T3T A;  4PT5 A;  1MJG M;  5KO3 A;  4HEO A;  4X66 M;  4A3V B;  3B7Q A;  2VQF M;  3HJS A;  1SXJ A;  2KW0 A;  4BBA A;  2DWL A;  1Q02 A;  1D0K A;  1K3X A;  1HR0 M;  1NJG A;  1IXR C;  2BJW A;  1QAM A;  3FUU A;  1XNQ M;  4LCB A;  4NRV A;  4NRW A;  1GJS A;  2MJ5 B;  2R44 A;  3B7Z A;  4NSR A;  1EIJ A;  4JV5 M;  1VEK A;  4B7F A;  3CF2 A;  1WGL A;  2OPF A;  4LF8 M;  1G41 A;  1QDR A;  2LWX A;  3FRI A;  4LJ4 A;  5BPV A;  4LF9 M;  3PNV A;  2HCB A;  4L16 A;  1VEJ A;  4AQY M;  1OIP A;  2KRU A;  2D7H A;  2JZ1 A;  4JI2 M;  4LRS A;  2K47 A;  1TH4 A;  3SYK A;  4DBG B;  5EJC A;  1Z59 A;  1MN3 A;  4Z6Y A;  4QOZ C;  2DAI A;  3B7N A;  4WP2 A;  4FWG A;  4AKI A;  2K0B X;  4B3R M;  3SAU A;  4QHT A;  2CUZ A;  2OOB A;  2Y0Q A;  4DV4 M;  1C1K A;  2R4J A;  2EA0 A;  3NBX X;  3NWL A;  4ANR A;  5C18 A;  1D0M A;  1Q3C A;  4NL4 H;  3GPY A;  2CV0 A;  4DV2 M;  3SAS A;  4M9S A;  1K3W A;  4G4Q A;  1OKS A;  1HT1 E;  1LV7 A;  4MGH A;  4W5W A;  4R7G A;  1FJG M;  4DR7 M;  1A5T A;  2Z8Y M;  2L4E A;  3SMS A;  4LFC M;  2XSZ D;  2G3Q A;  2P5T A;  4AI6 A;  2CV1 A;  3FKE A;  2M5Z A;  3VK7 A;  2HAK A;  4CJ6 A;  5KQD A;  5A2Q S;  4K0K M;  1DO2 A;  2QZ4 A;  3TQS A;  2EKF A;  1D2N A;  4MM3 B;  3L2A A;  4AG6 A;  3ILK A;  2XLJ A;  4JI3 M;  1IN6 A;  3KOY E;  1DGG A;  3SAT A;  4IBD A;  4CHT B;  2O01 F;  4LJ9 A;  2RGO A;  3F92 A;  3GLG A;  1CUK A;  5KPT A;  1J5E M;  3M6A A;  3FE3 A;  1QUS A;  2ZAM A;  3K9O A;  3FTF A;  2RRU A;  1OFH A;  3KOX E;  4LFB M;  1D0L A;  3J27 B;  3KOZ E;  4II7 A;  2QBY B;  1L2D A;  1IN8 A;  4FCT A;  4MB7 A;  2VF7 A;  5ITX E;  3TPZ A;  4TUW A;  4QHS A;  1XMO M;  5C1B A;  5ITQ A;  3AL0 C;  4IJF A;  1ZMV A;  2O25 A;  2QBY A;  2DHY A;  1TH2 A;  2EUC A;  3Q8G A;  2Y0T A;  3CF0 A;  4X64 M;  3T6P A;  2DWM A;  3HY5 A;  1R2Y A;  2X49 A;  2H5X A;  3SAR A;  4L78 A;  3K2L A;  5DFL A;  3A98 B;  1UM8 A;  3LMM A;  4NXN M;  4KHP M;  1GAB A;  3M7G A;  2N35 A;  4G3O A;  2JY8 A;  1JB0 F;  1TDH A;  1UFZ A;  5EP2 A;  5ITR A;  2AHM A;  1XB2 B;  1R5L A;  4JI0 M;  2UXD M;  4DR3 M;  3HJ8 A;  1WR1 B;  1JQJ C;  1IBK M;  2DWZ B;  3KDS E;  3D8B A;  1PJT A;  5JI2 E;  1LTM A;  2KNV A;  4IIW A;  2BNK A;  3GLH B;  4B7H A;  2XGN A;  3U60 B;  4RKU F;  4B3T M;  2DI0 A;  3EIH A;  4BLC A;  4QNR A;  5FTJ A;  4X62 M;  1DGB A;  4X65 M;  3SBJ A;  3GLF B;  1I4W A;  1XXH E;  1P3Q Q;  3L28 A;  3TWL A;  3UJN A;  3VDU A;  3GLH A;  2EKK A;  2MGW A;  3U60 A;  1BVS A;  2KRK A;  5EP1 A;  3AKZ A;  2B3T A;  3GLF A;  2FFJ A;  4LZZ A;  4I8O A;  4GRI A;  1IM2 A;  3I4Y A;  2ERC A;  2KNA A;  3T15 A;  4MGK E;  3GLI A;  4GKJ M;  1OAO C;  4YY3 M;  3A45 A;  3KXE C;  3QWL A;  3KVW A;  5E6J A;  5E26 A;  5KQ8 A;  4KT0 F;  1I94 M;  1W5T A;  4PCZ A;  1IBL M;  4HL4 A;  4IBJ A;  2DAK A;  4GMQ A;  4M0W A;  4FWH A;  4PDG A;  2QCU A;  1QZM A;  1X37 A;  3AOE C;  1F4I A;  3HU3 A;  3HWS A;  3V76 A;  4PDI A;  1GO5 A;  4JYA M;  5IRE B;  3VKG A;  3R8F A;  1YUB A;  4GKK M;  3JAM S;  1T43 A;  2CV2 A;  2C96 A;  2C9O A;  4OW0 A;  1EE8 A;  4FW9 A;  1AIP C;  4G6Z A;  3HHY A;  2C98 A;  4NXM M;  4G4N A;  2DAM A;  1WHC A;  1WXQ A;  3DZD A;  4DV0 M;  3WHL A;  2LH0 A;  1QAO A;  2L7H A;  2ZTD A;  3I51 A;  4FCW A;  4KOD A;  1KFV A;  2DNA A;  2OOA A;  3FRH A;  4MGI E;  2XF3 A;  1N36 M;  2V6Z M;  4F2L A;  4DUZ M;  1MU5 A;  1V92 A;  4JI7 M;  2NQ8 C;  4GHL A;  1N32 M;  1GL7 A;  2J7N A;  3KSX A;  1JR3 E;  4I81 A;  2ZM6 M;  4JI8 M;  5EXX A;  2FS1 A;  3UGJ A;  1XMQ M;  2H1R A;  4DR1 M;  2Q2E B;  3KP0 E;  2X8A A;  3PXG A;  1VG5 A;  4LF6 M;  3RE8 A;  1GLN A;  4LGY A;  3KSJ A;  2UXC M;  3DA1 A;  4NSO B;  4I5S A;  4GH9 A;  4R3D A;  2CEA A;  3C3D A;  3HZJ A;  3QYE A;  1E32 A;  2R0I A;  3VFD A;  3ZC7 B;  4Q7J A;  3R9X B;  1OAI A;  2LTU A;  3GRY A;  2F5Q A;  3W0L B;  2C99 A;  3FTC A;  2UUB M;  3HKP A;  1S3S A;  5IT9 S;  4DUY M;  3W0F A;  1ORY B;  4P17 A;  4QNM A;  4AKG A;  1AUA A;  3VKH A;  1JR3 D;  3K8Z A;  3KW6 A;  4D82 A;  5IWA M;  4D81 A;  2F5N A;  2E5L M;  1KSF X;  1HNW M;  3FYC A;  1Q39 A;  1ZMU A;  2LHC A;  3EIE A;  4GIP A;  4MH0 E;  3GQ4 A;  3U6C A;  2KDL A;  1L2C A;  2LVP C;  5BR8 M;  1NY5 A;  2YFQ A;  3GQ3 A;  1MX0 A;  1PJS A;  3GLG B;  3AOE A;  3L25 A;  3I04 M;  4L8R C;  2OO9 A;  4YHH M;  2UUA M;  3SHG B;  2C5R A;  4HLQ A;  4QOS A;  1PGY A;  1ZMW A;  1TTE A;  4LJ6 A;  2JY5 A;  4KO8 A;  4P16 A;  2ZTC A;  3HGI A;  3BOS A;  4DV5 M;  3A42 A;  4CIZ A;  3U6D A;  1WJ7 A;  5LMN M;  2KA6 B;  1G8P A;  1QAQ A;  2QEN A;  2QHO B;  3MMP A;  1H6U A;  4JXJ A;  4LG2 A;  3B89 A;  5KPZ A;  3TE6 A;  3LW5 F;  2CHG A;  2L7I A;  1PJI A;  2XSZ A;  2BWB A;  2CRU A;  2QQ8 A;  3NBI A;  4AG5 A;  3E4R A;  1NSF A;  3I4V A;  2Y21 A;  2JZ0 A;  1IXS B;  4DV6 M;  3I01 M;  2K9D A;  1NO1 A;  1N34 M;  2R4E A;  3HHZ A;  1QYR A;  1WIV A;  2XEP A;  2XFS A;  2WSE F;  3D8L A;  2R45 A;  4IBG A;  4OX9 M;  4EIW A;  1XC8 A;  4Y28 F;  3PNY A;  3TL4 X;  1IXS A;  2MH8 A;  3GPU A;  2HWJ A;  4M9X A;  1YLA A;  4F1I A;  3VK8 A;  3KS8 A;  2L2D A;  3M0E A;  2Z3X A;  3W68 A;  3IEC A;  3JR5 A;  3CTW B;  5L8R F;  3A46 A;  3GRR A;  1YE9 A;  1FNN A;  1V33 A;  2LVQ D;  4GC9 A;  1N75 A;  4KLN A;  1NVM A;  3GQ5 A;  1E94 E;  2J5Y A;  2KHH A;  3MJ5 A;  2KNZ A;  5FLX S;  1VDL A;  1IY1 A;  4GEW A;  4DV7 M;  3U6Q A;  3Q8X A;  4L4U A;  3VLF B;  3GRU A;  1L1T A;  4LRT A;  4RF1 A;  1HQY E;  2GNO A;  5KPR A;  1G59 A;  2DHR A;  2Z4S A;  3U5Z B;  4MGZ E;  2V1C A;  3W67 A;  3T1H M;  1HNZ M;  2KEB A;  2L4F A;  3J80 S;  4NC6 A;  1IN7 A;  1J09 A;  1NV9 A;  3KFU G;  4FVM A;  1OTR A;  1N77 A;  3GLI B;  4IBK A;  1QAN A;  3U5Z A;  2L09 A;  2L6O A;  2LVO C;  4I4L A;  3B9P A;  2GQF A;  5EXT A;  4FD2 A;  3FTD A;  3ZCB B;  2CHV A;  4CGY B;  2DXI A;  1SXJ E;  2LBC A;  1N33 M;  3L27 A;  3GPP A;  3FYD A;  3LVV A;  2XH9 A;  5EQT A;  1TH3 A;  1G4A E;  1XHB A;  3LCU A;  5ITY A;  3SAW A;  3SC3 A;  2LHG A;  1Z5B A;  1QDT A;  1ZV1 A;  4M0D A;  5ITX A;  2JY6 B;  5EXS A;  3HU2 A;  3WHK A;  2XFT A;  4JN6 A;  4L15 A;  1QUT A;  2QNJ A;  3ZH9 B;  3DFZ A;  4G4R A;  3T1Y M;  1IY0 A;  1QQW A;  2JP7 A;  3T38 A;  5H37 D;  1K82 A;  3AFH A;  2W82 A;  4CIS A;  1N78 A;  4LF7 M;  3H4M A;  2EO2 A;  3HHW A;  4JI5 M;  1DO0 A;  1Z6T A;  1Z5C A;  2JXN A;  3GO8 A;  3E46 A;  4GC5 A;  4GIT A;  3LVW A;  2DWN A;  2XZU A;  1GVN A;  1W5S A;  1SXJ D;  1Z5A A;  2WSF F;  1G3I A;  2Y20 A;  3L29 A;  3AJI B;  4B08 A;  4IBI A;  1NY6 A;  3HHX A;  2QSF X;  4LF4 M;  2XZF A;  3VDP A;  2RGH A;  2LVN C;  4ZPX A;  2KZU A;  4UN2 B;  2CE7 A;  3PFI A;  4ITQ A;  4REZ A;  1XXH B;  3KOW E;  4LJA A;  1IFY A;  4G4O A;  1GL6 A;  3J2P B;  3H4J A;  3FUV A;  3C9P A;  1Q3B A;  3LQR A;  5EP3 A;  2CP8 A;  3SYL A;  1SG9 A;  4B7G A;  4AKH A;  2MRO B;  3U6E A;  1Y8G A;  2C9C A;  2I7P A;  4BB9 A;  1IN4 A;  1DGH B;  1XXH A;  3MHV C;  4PD2 A;  5FSW A;  2UUC M;  4GHA A;  1OFI A;  2F5O A;  2OQ4 A;  2G8L A;  4RF0 A;  4FCV A;  3FTE A;  2DAG A;  1YSY A;  1DGH A;  5FTN A;  2ZAN A;  3E9S A;  2QPA A;  4Z8X A;  3AV0 A;  3BXW A;  3K92 A;  3KS4 A;  2R46 A;  4LF5 M;  2A5Y B;  2I7N A;  2JNH A;  2FE8 A;  2Z4R A;  3GLG E;  1PJJ A;  1RU3 A;  2VF8 A;  1L8Q A;  2RKO A;  4B3S M;  1OQY A;  3J7B A;  1V34 A;  2DKL A;  3J7A S;  2UXB M;  2QP9 X;  4LZJ A;  4WW0 A;  1HNX M;  3HX3 A;  3GP1 A;  1DGF A;  1TF0 B;  1E9R A;  2DVW B;  2WSC F;  1IY2 A;  1EFU B;  4NOO B;  4LJ5 A;  4MGY E;  3FUX A;  5FTL A;  5ITT A;  4OVZ B;  2LVA A;  3MK6 A;  2R62 A;  4IBF A;  4XGI A;  2R6F A;  1NNU C;  3RGS A;  2X4A A;  4OVZ A;  2BWE A;  1VQ1 A;  1HQC A;  3CGW A;  2HHH M;  2HL7 A;  4XBO A;  4LY6 A;  2F5S A;  5DYG A;  1J7K A;  1JR3 A;  1NHG C;  3BBZ A;  1ZAE A;  3TWM A;  2JWS A;  3FD9 A;  4JI1 M;  2G5G X;  4AZF A;  3J81 S;  3U6L A;  3LCV B;  1IBM M;  3E21 A;  2MR9 A;  5DNY A;  4JI6 M;  2YQZ A;  2F5P A;  3U6O A;  2D7G A;  1XWI A;  1TGU A;  3PVS A;  1R2Z A;  1R6B X;  2F4V M;  4XK8 F;  1IQP A;  4D80 A;  4R71 A;  3U6M A;  2DZO B;  1C7Y A;  2BJV A;  3SAV A;  1OIZ A;  2ZAO A;  3K9P A;  1GKI A;  3GLH E;  3K1J A;  1L1Z A;  4DR6 M;  1HT2 E;  2VDB B;  3IHP A;  3C58 A;  5F3W A;  3HU1 A;  1XNR M;  4DR4 M;  2FNA A;  1NV8 A;  4RNA A;  3GLF E;  1IXZ A;  3GLI E;  1NJF A;  3C3E A;  5IZ7 D;  1QZE A;  2JA2 A;  3QYB A;  2LNH C;  2WZJ A;  5DYI A;  2KXE A;  1DV0 A;  1SXJ C;  3B74 A;  2R18 A;  2VQE M;  1PM5 A;  1PRB A;  4JI4 M;  2K6B A;  1L2B A;  5FTM A;  4LJ7 A;  2LXE A;  4DR5 M;  2DEN A;  4IJE A;  3L26 A;  3FUW A;  3SHF A;  2M60 A;  3FUT A;  4DV3 M;  3DOA A;  2Z7J A;  1PJQ A;  1TDZ A;  3RFW A;  1NNJ A;  4IBE A;  7CAT A;  4DR2 M;  1KYI A;  5EXP A;  3CF6 E;  2ZBK B;  3U6S A;  1NHW C;  3LQQ A;  2R65 A;  1T6O A;  3IG8 A;  3SMP A;  3GPX A;  3IG5 A;  2D7E A;  3KP1 E;  3JR4 A;  1TR8 A;  5JI3 E;  3ZQJ A;  5LMU M;  2DZL A;  3U6P A;  4LGM A;  2CFO A;  1GJT A;  2O5R A;  5GKN A;  4LJ8 A;  1WGN A;  2JY7 A;  4B3M M;  2HKJ A;  2CHQ A;  3SFZ A;  4WUR A;  3QAU A;  3UZU A;  3GRV A;  4L6V 6;  3THG A;  2EJS A;  4LFA M;  5FTK A;  2APL A;  3UK6 A;  8CAT A;  2CWB A;  3U61 B;  1OJL A; 
#chains in the Genus database with same CATH homology
 2JY8 A;  2OO9 A;  1PGY A;  1ZMW A;  1TTE A;  1UFZ A;  2JY5 A;  2ZTC A;  1VEG A;  1XB2 B;  1WJ7 A;  2JNH A;  3MMP A;  2QHO B;  2JUJ A;  3GLG E;  3B89 A;  1WR1 B;  1OQY A;  2DKL A;  2DAE A;  5JI2 E;  2BWB A;  2KNV A;  2JZ0 A;  2K9D A;  1R4G A;  2DI0 A;  1HJP A;  1WIV A;  1EFU B;  1XXH E;  1P3Q Q;  4HEO A;  1IXS A;  2EKK A;  2MGW A;  1BVS A;  1Q02 A;  2HWJ A;  1YLA A;  2LVA A;  4F1I A;  2L2D A;  2B3T A;  3IEC A;  1IM2 A;  2LVQ D;  2KNA A;  2MJ5 B;  1E94 E;  2KHH A;  2KNZ A;  1VDL A;  1VQ1 A;  2BWE A;  4GEW A;  1VEK A;  3BBZ A;  1WGL A;  1G41 A;  3FRI A;  2DAK A;  1HQY E;  3LCV B;  1F4I A;  3E21 A;  1VEJ A;  2MR9 A;  1GO5 A;  2L4F A;  1NV9 A;  2JZ1 A;  1T43 A;  1OTR A;  4DBG B;  1AIP C;  1MN3 A;  4R71 A;  2DAI A;  4WP2 A;  2LVO C;  1C7Y A;  2K0B X;  2DAM A;  1WHC A;  3K9P A;  3GLH E;  2LBC A;  2ZTD A;  2OOB A;  1HT2 E;  3IHP A;  2DNA A;  2OOA A;  3FRH A;  1G4A E;  3LCU A;  1NV8 A;  3GLF E;  4F2L A;  3GLI E;  1OKS A;  1HT1 E;  1V92 A;  1QZE A;  1ZV1 A;  2JY6 B;  2WZJ A;  1A5T A;  2L4E A;  2QNJ A;  2G3Q A;  1DV0 A;  1JR3 E;  2JP7 A;  2HAK A;  1DO2 A;  2EKF A;  1DO0 A;  1VG5 A;  2DEN A;  3E46 A;  2R0I A;  1G3I A;  1KYI A;  4Q7J A;  1OAI A;  2LTU A;  2QSF X;  3F92 A;  1T6O A;  2LVN C;  1CUK A;  1TR8 A;  3FE3 A;  4UN2 B;  3K9O A;  2RRU A;  1IFY A;  2DZL A;  3H4J A;  2CP8 A;  1WGN A;  1SG9 A;  2JY7 A;  2MRO B;  1Y8G A;  1ZMV A;  2O25 A;  1ZMU A;  2DHY A;  3T6P A;  2LVP C;  2EJS A;  2H5X A;  5DFL A;  2CWB A;  2DAG A;  4G3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...