2MJ5B

Structure of the uba domain of human nbr1 in complex with ubiquitin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
52
structure length
52
Chain Sequence
GPLGSSEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-C
publication title Solution Structure of the Ubiquitin-associated (UBA) Domain of Human Autophagy Receptor NBR1 and its Interaction with Ubiquitin and Polyubiquitin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2013-12-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mj5B00
1G3IA 3E21A 3IHPA 5DFLA 1PGYA 3F92A 1OTRA 2L2DA 2LVOC 2EJSA 3BBZA 2KNVA 1NV9A 4UN2B 1ZMVA 2L4FA 1P3QQ 2DZLA 2KHHA 3K9OA 1TR8A 2BWBA 1GO5A 3MMPA 2JY5A 4DBGB 2LTUA 3GLIE 2JNHA 4F2LA 1WHCA 1VDLA 1IFYA 2JY7A 2WZJA 3LCUA 1EFUB 1VEGA 1ZMUA 1BVSA 2QHOB 4WP2A 2DKLA 2HWJA 4Q7JA 4G3OA 1CUKA 3FRHA 1C7YA 1HT1E 1KYIA 1XXHE 3K9PA 2LVPC 1ZMWA 2MJ5B 1ZV1A 3LCVB 1DO2A 4HEOA 1F4IA 2MR9A 1VEKA 2DAIA 2EKFA 2LVNC 2R0IA 1V92A 1QZEA 2QSFX 1MN3A 2OO9A 5JI2E 2MROB 1HQYE 2KNAA 1T6OA 2DAGA 2DNAA 2DAEA 2DHYA 2MGWA 2ZTDA 2CWBA 2DAMA 1WR1B 2DI0A 3FRIA 1WGLA 3B89A 2K9DA 1OQYA 1DV0A 2EKKA 1Y8GA 2LBCA 1E94E 2BWEA 1VG5A 2HAKA 1VQ1A 1VEJA 3GLGE 2JUJA 2QNJA 2JY6B 2RRUA 2KNZA 2JY8A 1HJPA 2LVAA 2JZ1A 1WIVA 1OAIA 2CP8A 1T43A 1WJ7A 3T6PA 1TTEA 4GEWA 1OKSA 2H5XA 1HT2E 1NV8A 2JP7A 1AIPC 3IECA 1G4AE 2OOAA 1A5TA 2O25A 1G41A 2ZTCA 2G3QA 4R71A 1Q02A 1YLAA 1JR3E 2B3TA 2OOBA 4F1IA 3GLFE 1UFZA 1XB2B 1IM2A 3FE3A 1WGNA 2DAKA 2DENA 1DO0A 1R4GA 2JZ0A 2K0BX 2L4EA 2LVQD 3GLHE 1SG9A 3H4JA 1IXSA 3E46A
chains in the Genus database with same CATH superfamily
3C58A 5ITXE 3NWLA 5ITYA 5DFLA 2W82A 2AHMA 1YUBA 3I4VA 5KQDA 4B7GA 4LG2A 4IBEA 3HHYA 2KZUA 1YE9A 2LVOC 2EJSA 3SHGB 1W5SA 1ZMVA 1XXHB 2XH9A 1Z6TA 4BB9A 2L09A 1QQWA 3B74A 1GO5A 1NNUC 2R4EA 1DGHB 5BR8M 1QUTA 4DBGB 4B3TM 2C5RA 2I7NA 4FWHA 1VDLA 1I94M 5IWAM 1D0LA 1QZMA 1QAOA 3RFWA 4D81A 1Q3BA 1VEGA 4FWDA 2CV2A 2DKLA 4HLQA 4LF4M 2Z7JA 3FTCA 5IZ7D 4NXNM 5KPZA 3EIHA 3QWLA 3HU3A 3FRHA 3KFUG 4B7HA 1HT1E 4DR7M 4X64M 3W0LB 4LZZA 1XC8A 3KXEC 4LF9M 4LGMA 1ZV1A 4AQYM 1G59A 2X4AA 1AUAA 1DO2A 4HEOA 1F4IA 3ILKA 2DVWB 7CATA 4DV1M 4GC5A 2Z4SA 1D2NA 2KDLA 2RGHA 2N35A 1IY2A 4OVZB 1V92A 1QZEA 3IG8A 5C1BA 1L1TA 1TDZA 4AKGA 8CATA 4RKUF 3M0EA 4I5SA 1HQYE 4IBIA 1NO1A 2KNAA 2O01F 4LF5M 1IQPA 2BJWA 4MB7A 3T1HM 1NY6A 2CWBA 3LVVA 2DI0A 3FRIA 4R7GA 2LH0A 4YY3M 1H6UA 2EKKA 2VF8A 3LQQA 2DWNA 2BWEA 3ZCBB 3FTDA 3J81S 1L8QA 4IBJA 5F3WA 4JI5M 4JI1M 1VG5A 4GC9A 3U6DA 3FYCA 3KOYE 1VQ1A 3GPXA 4L16A 1QVRA 1NHGC 3SAUA 4LJ7A 3PVSA 3A46A 3KVWA 1XNQM 2A5YB 2CEAA 2J7OA 4KODA 1GL7A 2BNKA 2JY8A 3BOSA 1TDHA 3VDPA 3VKGA 3GRVA 4DR3M 5EXSA 1J7KA 1MX0A 3L26A 2MH8A 1K3WA 1TTEA 3GLFA 4G4NA 5KQ8A 2OPFA 2QENA 4I81A 1NV8A 3J80S 2Z8YM 3VLFB 4GHAA 2JP7A 1GKIA 4KO8A 1JQJC 1G4AE 1V34A 2O25A 1G41A 4AG5A 4X66M 3J7BA 5GKNA 4FW9A 2CHVA 2DHRA 1SXJB 1UFZA 2R62A 3LVWA 1XB2B 1NY5A 3AFHA 4EIWA 3FE3A 4D80A 3K2LA 3GLHA 4X65M 3T15A 2DAKA 1IN4A 1R7RA 3GPPA 3K1JA 3L27A 4LJ8A 2JZ0A 3PFIA 4DV5M 2GQFA 2F5SA 2K0BX 4LFAM 1WXQA 1DGFA 2DZNB 4LGYA 4GH9A 5KPRA 1N75A 4Z6YA 1GL6A 3DA1A 2G5GX 3FUTA 4NSOB 3SARA 2VDBB 2CFOA 2FNAA 2XFSA 2FE8A 1SG9A 2M5ZA 1IXSA 3E46A 2ERCA 2DWLA 3HWSA 3L28A 3IHPA 5LMUM 4IJEA 4L8RC 3Q8GA 4LFBM 5IT9S 2H1RA 3JAMS 1KSFX 2EUCA 2KNVA 4NRWA 1X37A 2GNOA 3NBXX 2DZLA 5E6JA 2UU9M 2XSZD 1GVNA 1IBKM 3RGPA 2HL7A 3CGWA 2BWBA 1Z5BA 4WURA 2NQ8C 3AOGA 4QOZC 1OFHA 3B7NA 3KOWE 4DUYM 4JI2M 4DV3M 2LTUA 1PJIA 2XGNA 4FCVA 4XGIA 2JNHA 3GLIE 4X62M 3U6EA 3FTEA 3QYBA 2JY7A 1W5TA 3KP1E 3L29A 3LMMA 2D7GA 2L7HA 3U5ZA 1GLNA 4P16A 2XF3A 3WHKA 3GQ5A 2QHOB 4WP2A 3B7ZA 4Q7JA 3HHXA 1CUKA 4B3MM 1KYIA 3CF6E 3A98B 1R6BX 3VKHA 4RF0A 4AKIA 1XXHE 4MGKE 2Y0TA 2QZ4A 4MGIE 2DZOB 3FYDA 2LVPC 2LXEA 3FTFA 2MJ5B 3KS8A 2R18A 1NJGA 2ZAMA 4JI7M 4I8OA 2Q2EB 2MR9A 1TH3A 2DAIA 2M60A 4NOOB 3U6PA 1NNJA 4IJFA 3U61A 4DR6M 2QSFX 1XHBA 3HJQA 3RGSA 2LHCA 1QUSA 3C9PA 2QP9X 1T6OA 2R44A 3GRRA 2DAEA 2C98A 4OU7A 2MGWA 2ZTDA 3DZDA 3DFZA 5ITQA 1WR1B 2Y21A 1N36M 4K0KM 4LJ5A 3U60B 2UXBM 3FUUA 2K9DA 1OQYA 1DV0A 3CF2A 1QDTA 2VQFM 4XBOA 4CHTB 4GMQA 1HNZM 2HCBA 2P5TA 1Q3CA 4DR5M 4B3SM 4L6V6 3SC3A 1QAQA 3UK6A 4LRSA 3GLGE 3R8FA 2F5OA 1TH4A 2JUJA 2QNJA 2RRUA 4FCTA 3THGA 3GLGB 4IBGA 4NC6A 1TF0B 2LVAA 4LY6A 2Y20A 5C18A 3GQ3A 1WIVA 2Y0QA 4AW4A 1E32A 3T6PA 3KSXA 4PDGA 3W67A 2CRUA 3PNYA 3FUXA 3TL4X 3UZUA 4ANRA 4YHHM 4JI4M 3SASA 1AIPC 4B08A 1N33M 3U6MA 1NSFA 5EXPA 4NRVA 2G3QA 3QAUA 4LCBA 5FTNA 3ZC7B 1YLAA 1OIPA 3I4YA 1JR3E 3AJIB 4Y28F 3SMSA 4F1IA 1OIZA 2C9OA 2KA6B 3A45A 4DR2M 2F5PA 1IXSB 1Z5AA 1IM2A 1KFVA 2CV0A 1WGNA 3K92A 2XZUA 1DGBA 4JI8M 1DO0A 1R4GA 1L2CA 1JB0F 2VF7A 1JR3D 5ITXA 2I7PA 4RF1A 1ZAEA 1ZQ9A 4MGHA 3KOXE 4XK8F 2JXNA 2QBYB 5ITUA 4OX9M 1XXHA 1MJGM 4BLCA 2YFQA 3MMPA 4LRTA 4G4QA 4PT5A 2HKJA 2KRKA 1N34M 3QYEA 4FD2A 3HKPA 3HGIA 2C9CA 3HY5A 3L2AA 1IXZA 1IN6A 2X8AA 3E4RA 2WSFF 5FLXS 4GRIA 1NV9A 4UN2B 1SXJE 3GRUA 4AKHA 4DV7M 1XWIA 4FCWA 1HR0M 2E5LM 3NBIA 2HHHM 1OAOC 4IBDA 1T3TA 3TQSA 2FH0A 4F2LA 2RGOA 1WHCA 1SXJD 1IFYA 3MK6A 3KS4A 4G4OA 4PDIA 1QAMA 3B9PA 1FJGM 5EP4A 3SATA 4GKKM 1EFUB 1ZMUA 1BVSA 1R2ZA 3BXWA 4GITA 4OW0A 1LTMA 4CJ6A 5A2QS 4G3OA 5EQTA 4ITQA 3D8LA 3TWKA 1N32M 2FOIC 5FTLA 1FNNA 4L4UA 3SYLA 3TWLA 2WSCF 3MJ5A 2WSEF 5FTMA 1EIJA 2YQZA 1N77A 2XZFA 2UXCM 3VFDA 2R45A 1TH2A 4L78A 4NSRA 1VEKA 4LJ9A 5L8RF 2LVNC 4LJ4A 2ZM6M 4W5WA 1NHWC 3OTOM 2R65A 3JR4A 4G4RA 2OO9A 1GJTA 3AV0A 4JI3M 3L25A 2DNAA 2FFJA 2UUCM 1V33A 4NXMM 2DHYA 3M7GA 3U6OA 2ZAOA 4REZA 3U6LA 3K8ZA 4KHPM 1R2YA 3PNVA 3B89A 1QDRA 1VDDA 4HL4A 2F4VM 3M6AA 4MGZE 1Z59A 5EJCA 4CGYB 2LBCA 3J2PB 1XMOM 1IN5A 3E9SA 3HX3A 1HQCA 1VEJA 3HJ8A 5E26A 5KO3A 4QOSA 3U6QA 3LW5F 3LQRA 2KNZA 5EP1A 4DV0M 1HJPA 3AL0C 1LV7A 3TWMA 1PJQA 5IREB 4QNRA 4M0DA 3IG5A 3J7AS 2CP8A 4KLNA 3JR5A 3W0FA 1D0KA 3HHWA 3HHZA 2QCUA 2QPAA 4GEWA 4CIZA 2D7EA 1UM8A 1J5EM 2LNHC 5EXXA 3W68A 3CTWB 3IECA 4QNMA 2C96A 3HJSA 4DR4M 4MH0E 5FTKA 3DOAA 4R71A 2DWZB 3GPYA 3VK8A 2UXDM 2OOBA 3GLFE 2L6OA 4MGYE 1N78A 5EP2A 3HU2A 4DR1M 4IBBA 4PCZA 2JA2A 2F5QA 3GLFB 3R9XB 1E9SA 5DYGA 4JI0M 1IY1A 2DENA 2XSZA 4JYAM 2EA0A 3HU1A 2L4EA 3AOEA 3AOEC 4JN6A 1ORYB 3GLHE 5EP3A 1PJTA 1Q39A 2XEPA 3FD9A 2OQ4A 4GKJM 3H4JA 3GLHB 1G3IA 3VK7A 4DV6M 3E21A 4LZJA 1PGYA 5KPTA 1K3XA 3F92A 1NVMA 1D0MA 1OTRA 2ZBKB 4IBCA 2L2DA 4LJAA 3FKEA 4M9ZA 5LMNM 1K82A 3BBZA 3PXGA 3EIEA 3GLIA 2YR0A 2L4FA 2LHGA 4G6ZA 1PJJA 2XLJA 2KXEA 1P3QQ 2KHHA 3K9OA 1TR8A 2V1CA 4AI6A 1RU3A 5FSWA 4JI6M 1TGUA 2K6BA 5EXTA 2JY5A 3GRYA 4DUZM 4QHTA 1YSYA 2KEBA 4TUWA 1QYRA 3FUWA 2CV1A 1IBMM 3SFZA 2WZJA 3LCUA 4GIPA 1XMQM 1S3SA 2R6FA 5H37D 1I4WA 3I51A 2HWJA 1C1KA 3VDUA 5DNYA 2VIIA 3U6CA 1NJFA 3SYKA 4B3RM 3TPZA 3HZJA 2V6ZM 3Q8XA 2ZANA 3TE6A 2YNMD 3KW6A 1DGHA 5ITRA 1C7YA 4LF8M 2LWXA 2D7HA 4A3VB 3UGJA 3T38A 1J09A 3GQ4A 3SBJA 4JV5M 4S12A 1EE8A 3GP1A 3K9PA 4GHLA 4IBFA 1L2DA 1PRBA 4WW0A 3U5ZB 1XNRM 2CHQA 1GABA 2O5RA 1ZMWA 5JI3E 3LCVB 3GPUA 2UUBM 2KRUA 1IN8A 5DYIA 1IY0A 4FWGA 3SHFA 2KZSA 2EKFA 3FUVA 5BPVA 4DV4M 3U6SA 2R0IA 3U60A 2G8LA 1MN3A 3C3EA 4I4LA 3SAVA 4M0WA 5JI2E 2MROB 1L2BA 1Z5CA 2DAGA 4NL4H 2Z3XA 1G8PA 5ITTA 1DGGA 2DAMA 1HNWM 1OJLA 3D8BA 1WGLA 4P17A 2CUZA 2APLA 2J7NA 3KSJA 3GO8A 3U61B 1Y8GA 2J5YA 4D82A 4IIWA 4OVZA 3GLGA 4II7A 1E94E 2R4JA 3KDSE 4ZPXA 2HAKA 2JWSA 2L7IA 4AZFA 3ZQJA 1G71A 4QHSA 3V76A 4AG6A 3ZH9B 4L15A 3J27B 2F5NA 1IBLM 2JY6B 1QANA 3SMPA 2DWMA 2DXIA 4LFCM 2QQ8A 2KW0A 4BBAA 5FTJA 2JZ1A 3AKZA 4RNAA 3SAWA 1OAIA 2CHGA 1E9RA 3H4MA 4JXJA 3CF0A 1T43A 4Z8XA 3WHLA 1MU5A 1WJ7A 4KT0F 2UUAM 2VQEM 1JR3A 1OKSA 3I01M 2H5XA 3RE8A 1HT2E 4CISA 3MHVC 3UMMA 4M9XA 4DV2M 4LF6M 2CE7A 3A42A 1R5LA 2OOAA 3I04M 1A5TA 2ZTCA 1PM5A 1Q02A 3T1YM 1L1ZA 2K47A 1PJSA 2B3TA 2QBYA 2R46A 2X49A 4M9SA 4PD2A 3UJNA 4R3DA 1GJSA 1IN7A 3KOZE 2Z4RA 4FVMA 2EO2A 2C99A 4MM3B 3GLIB 4LF7M 3C3DA 3KP0E 1IXRC 1HNXM 4IBKA 4LJ6A 4B7FA 1OFIA 2LVQD 2V1UA 2RKOA 2BJVA 3B7QA 1SXJC 1SXJA 2XFTA 2FS1A
chains in the Genus database with same CATH topology
1G3IA 3E21A 3IHPA 5DFLA 1PGYA 3F92A 1OTRA 2L2DA 2LVOC 2EJSA 3BBZA 2KNVA 1NV9A 4UN2B 1ZMVA 2L4FA 1P3QQ 2DZLA 2KHHA 3K9OA 1TR8A 2BWBA 1GO5A 3MMPA 2JY5A 4DBGB 2LTUA 3GLIE 2JNHA 4F2LA 1WHCA 1VDLA 1IFYA 2JY7A 2WZJA 3LCUA 1EFUB 1VEGA 1ZMUA 1BVSA 2QHOB 4WP2A 2DKLA 2HWJA 4Q7JA 4G3OA 1CUKA 3FRHA 1C7YA 1HT1E 1KYIA 1XXHE 3K9PA 2LVPC 1ZMWA 2MJ5B 1ZV1A 3LCVB 1DO2A 4HEOA 1F4IA 2MR9A 1VEKA 2DAIA 2EKFA 2LVNC 2R0IA 1V92A 1QZEA 2QSFX 1MN3A 2OO9A 5JI2E 2MROB 1HQYE 2KNAA 1T6OA 2DAGA 2DNAA 2DAEA 2DHYA 2MGWA 2ZTDA 2CWBA 2DAMA 1WR1B 2DI0A 3FRIA 1WGLA 3B89A 2K9DA 1OQYA 1DV0A 2EKKA 1Y8GA 2LBCA 1E94E 2BWEA 1VG5A 2HAKA 1VQ1A 1VEJA 3GLGE 2JUJA 2QNJA 2JY6B 2RRUA 2KNZA 2JY8A 1HJPA 2LVAA 2JZ1A 1WIVA 1OAIA 2CP8A 1T43A 1WJ7A 3T6PA 1TTEA 4GEWA 1OKSA 2H5XA 1HT2E 1NV8A 2JP7A 1AIPC 3IECA 1G4AE 2OOAA 1A5TA 2O25A 1G41A 2ZTCA 2G3QA 4R71A 1Q02A 1YLAA 1JR3E 2B3TA 2OOBA 4F1IA 3GLFE 1UFZA 1XB2B 1IM2A 3FE3A 1WGNA 2DAKA 2DENA 1DO0A 1R4GA 2JZ0A 2K0BX 2L4EA 2LVQD 3GLHE 1SG9A 3H4JA 1IXSA 3E46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3I A;  3E21 A;  3IHP A;  5DFL A;  1PGY A;  3F92 A;  1OTR A;  2L2D A;  2LVO C;  2EJS A;  3BBZ A;  2KNV A;  1NV9 A;  4UN2 B;  1ZMV A;  2L4F A;  1P3Q Q;  2DZL A;  2KHH A;  3K9O A;  1TR8 A;  2BWB A;  1GO5 A;  3MMP A;  2JY5 A;  4DBG B;  2LTU A;  3GLI E;  2JNH A;  4F2L A;  1WHC A;  1VDL A;  1IFY A;  2JY7 A;  2WZJ A;  3LCU A;  1EFU B;  1VEG A;  1ZMU A;  1BVS A;  2QHO B;  4WP2 A;  2DKL A;  2HWJ A;  4Q7J A;  4G3O A;  1CUK A;  3FRH A;  1C7Y A;  1HT1 E;  1KYI A;  1XXH E;  3K9P A;  2LVP C;  1ZMW A;  2MJ5 B;  1ZV1 A;  3LCV B;  1DO2 A;  4HEO A;  1F4I A;  2MR9 A;  1VEK A;  2DAI A;  2EKF A;  2LVN C;  2R0I A;  1V92 A;  1QZE A;  2QSF X;  1MN3 A;  2OO9 A;  5JI2 E;  2MRO B;  1HQY E;  2KNA A;  1T6O A;  2DAG A;  2DNA A;  2DAE A;  2DHY A;  2MGW A;  2ZTD A;  2CWB A;  2DAM A;  1WR1 B;  2DI0 A;  3FRI A;  1WGL A;  3B89 A;  2K9D A;  1OQY A;  1DV0 A;  2EKK A;  1Y8G A;  2LBC A;  1E94 E;  2BWE A;  1VG5 A;  2HAK A;  1VQ1 A;  1VEJ A;  3GLG E;  2JUJ A;  2QNJ A;  2JY6 B;  2RRU A;  2KNZ A;  2JY8 A;  1HJP A;  2LVA A;  2JZ1 A;  1WIV A;  1OAI A;  2CP8 A;  1T43 A;  1WJ7 A;  3T6P A;  1TTE A;  4GEW A;  1OKS A;  2H5X A;  1HT2 E;  1NV8 A;  2JP7 A;  1AIP C;  3IEC A;  1G4A E;  2OOA A;  1A5T A;  2O25 A;  1G41 A;  2ZTC A;  2G3Q A;  4R71 A;  1Q02 A;  1YLA A;  1JR3 E;  2B3T A;  2OOB A;  4F1I A;  3GLF E;  1UFZ A;  1XB2 B;  1IM2 A;  3FE3 A;  1WGN A;  2DAK A;  2DEN A;  1DO0 A;  1R4G A;  2JZ0 A;  2K0B X;  2L4E A;  2LVQ D;  3GLH E;  1SG9 A;  3H4J A;  1IXS A;  3E46 A; 
#chains in the Genus database with same CATH topology
 3C58 A;  5ITX E;  3NWL A;  5ITY A;  5DFL A;  2W82 A;  2AHM A;  1YUB A;  3I4V A;  5KQD A;  4B7G A;  4LG2 A;  4IBE A;  3HHY A;  2KZU A;  1YE9 A;  2LVO C;  2EJS A;  3SHG B;  1W5S A;  1ZMV A;  1XXH B;  2XH9 A;  1Z6T A;  4BB9 A;  2L09 A;  1QQW A;  3B74 A;  1GO5 A;  1NNU C;  2R4E A;  1DGH B;  5BR8 M;  1QUT A;  4DBG B;  4B3T M;  2C5R A;  2I7N A;  4FWH A;  1VDL A;  1I94 M;  5IWA M;  1D0L A;  1QZM A;  1QAO A;  3RFW A;  4D81 A;  1Q3B A;  1VEG A;  4FWD A;  2CV2 A;  2DKL A;  4HLQ A;  4LF4 M;  2Z7J A;  3FTC A;  5IZ7 D;  4NXN M;  5KPZ A;  3EIH A;  3QWL A;  3HU3 A;  3FRH A;  3KFU G;  4B7H A;  1HT1 E;  4DR7 M;  4X64 M;  3W0L B;  4LZZ A;  1XC8 A;  3KXE C;  4LF9 M;  4LGM A;  1ZV1 A;  4AQY M;  1G59 A;  2X4A A;  1AUA A;  1DO2 A;  4HEO A;  1F4I A;  3ILK A;  2DVW B;  7CAT A;  4DV1 M;  4GC5 A;  2Z4S A;  1D2N A;  2KDL A;  2RGH A;  2N35 A;  1IY2 A;  4OVZ B;  1V92 A;  1QZE A;  3IG8 A;  5C1B A;  1L1T A;  1TDZ A;  4AKG A;  8CAT A;  4RKU F;  3M0E A;  4I5S A;  1HQY E;  4IBI A;  1NO1 A;  2KNA A;  2O01 F;  4LF5 M;  1IQP A;  2BJW A;  4MB7 A;  3T1H M;  1NY6 A;  2CWB A;  3LVV A;  2DI0 A;  3FRI A;  4R7G A;  2LH0 A;  4YY3 M;  1H6U A;  2EKK A;  2VF8 A;  3LQQ A;  2DWN A;  2BWE A;  3ZCB B;  3FTD A;  3J81 S;  1L8Q A;  4IBJ A;  5F3W A;  4JI5 M;  4JI1 M;  1VG5 A;  4GC9 A;  3U6D A;  3FYC A;  3KOY E;  1VQ1 A;  3GPX A;  4L16 A;  1QVR A;  1NHG C;  3SAU A;  4LJ7 A;  3PVS A;  3A46 A;  3KVW A;  1XNQ M;  2A5Y B;  2CEA A;  2J7O A;  4KOD A;  1GL7 A;  2BNK A;  2JY8 A;  3BOS A;  1TDH A;  3VDP A;  3VKG A;  3GRV A;  4DR3 M;  5EXS A;  1J7K A;  1MX0 A;  3L26 A;  2MH8 A;  1K3W A;  1TTE A;  3GLF A;  4G4N A;  5KQ8 A;  2OPF A;  2QEN A;  4I81 A;  1NV8 A;  3J80 S;  2Z8Y M;  3VLF B;  4GHA A;  2JP7 A;  1GKI A;  4KO8 A;  1JQJ C;  1G4A E;  1V34 A;  2O25 A;  1G41 A;  4AG5 A;  4X66 M;  3J7B A;  5GKN A;  4FW9 A;  2CHV A;  2DHR A;  1SXJ B;  1UFZ A;  2R62 A;  3LVW A;  1XB2 B;  1NY5 A;  3AFH A;  4EIW A;  3FE3 A;  4D80 A;  3K2L A;  3GLH A;  4X65 M;  3T15 A;  2DAK A;  1IN4 A;  1R7R A;  3GPP A;  3K1J A;  3L27 A;  4LJ8 A;  2JZ0 A;  3PFI A;  4DV5 M;  2GQF A;  2F5S A;  2K0B X;  4LFA M;  1WXQ A;  1DGF A;  2DZN B;  4LGY A;  4GH9 A;  5KPR A;  1N75 A;  4Z6Y A;  1GL6 A;  3DA1 A;  2G5G X;  3FUT A;  4NSO B;  3SAR A;  2VDB B;  2CFO A;  2FNA A;  2XFS A;  2FE8 A;  1SG9 A;  2M5Z A;  1IXS A;  3E46 A;  2ERC A;  2DWL A;  3HWS A;  3L28 A;  3IHP A;  5LMU M;  4IJE A;  4L8R C;  3Q8G A;  4LFB M;  5IT9 S;  2H1R A;  3JAM S;  1KSF X;  2EUC A;  2KNV A;  4NRW A;  1X37 A;  2GNO A;  3NBX X;  2DZL A;  5E6J A;  2UU9 M;  2XSZ D;  1GVN A;  1IBK M;  3RGP A;  2HL7 A;  3CGW A;  2BWB A;  1Z5B A;  4WUR A;  2NQ8 C;  3AOG A;  4QOZ C;  1OFH A;  3B7N A;  3KOW E;  4DUY M;  4JI2 M;  4DV3 M;  2LTU A;  1PJI A;  2XGN A;  4FCV A;  4XGI A;  2JNH A;  3GLI E;  4X62 M;  3U6E A;  3FTE A;  3QYB A;  2JY7 A;  1W5T A;  3KP1 E;  3L29 A;  3LMM A;  2D7G A;  2L7H A;  3U5Z A;  1GLN A;  4P16 A;  2XF3 A;  3WHK A;  3GQ5 A;  2QHO B;  4WP2 A;  3B7Z A;  4Q7J A;  3HHX A;  1CUK A;  4B3M M;  1KYI A;  3CF6 E;  3A98 B;  1R6B X;  3VKH A;  4RF0 A;  4AKI A;  1XXH E;  4MGK E;  2Y0T A;  2QZ4 A;  4MGI E;  2DZO B;  3FYD A;  2LVP C;  2LXE A;  3FTF A;  2MJ5 B;  3KS8 A;  2R18 A;  1NJG A;  2ZAM A;  4JI7 M;  4I8O A;  2Q2E B;  2MR9 A;  1TH3 A;  2DAI A;  2M60 A;  4NOO B;  3U6P A;  1NNJ A;  4IJF A;  3U61 A;  4DR6 M;  2QSF X;  1XHB A;  3HJQ A;  3RGS A;  2LHC A;  1QUS A;  3C9P A;  2QP9 X;  1T6O A;  2R44 A;  3GRR A;  2DAE A;  2C98 A;  4OU7 A;  2MGW A;  2ZTD A;  3DZD A;  3DFZ A;  5ITQ A;  1WR1 B;  2Y21 A;  1N36 M;  4K0K M;  4LJ5 A;  3U60 B;  2UXB M;  3FUU A;  2K9D A;  1OQY A;  1DV0 A;  3CF2 A;  1QDT A;  2VQF M;  4XBO A;  4CHT B;  4GMQ A;  1HNZ M;  2HCB A;  2P5T A;  1Q3C A;  4DR5 M;  4B3S M;  4L6V 6;  3SC3 A;  1QAQ A;  3UK6 A;  4LRS A;  3GLG E;  3R8F A;  2F5O A;  1TH4 A;  2JUJ A;  2QNJ A;  2RRU A;  4FCT A;  3THG A;  3GLG B;  4IBG A;  4NC6 A;  1TF0 B;  2LVA A;  4LY6 A;  2Y20 A;  5C18 A;  3GQ3 A;  1WIV A;  2Y0Q A;  4AW4 A;  1E32 A;  3T6P A;  3KSX A;  4PDG A;  3W67 A;  2CRU A;  3PNY A;  3FUX A;  3TL4 X;  3UZU A;  4ANR A;  4YHH M;  4JI4 M;  3SAS A;  1AIP C;  4B08 A;  1N33 M;  3U6M A;  1NSF A;  5EXP A;  4NRV A;  2G3Q A;  3QAU A;  4LCB A;  5FTN A;  3ZC7 B;  1YLA A;  1OIP A;  3I4Y A;  1JR3 E;  3AJI B;  4Y28 F;  3SMS A;  4F1I A;  1OIZ A;  2C9O A;  2KA6 B;  3A45 A;  4DR2 M;  2F5P A;  1IXS B;  1Z5A A;  1IM2 A;  1KFV A;  2CV0 A;  1WGN A;  3K92 A;  2XZU A;  1DGB A;  4JI8 M;  1DO0 A;  1R4G A;  1L2C A;  1JB0 F;  2VF7 A;  1JR3 D;  5ITX A;  2I7P A;  4RF1 A;  1ZAE A;  1ZQ9 A;  4MGH A;  3KOX E;  4XK8 F;  2JXN A;  2QBY B;  5ITU A;  4OX9 M;  1XXH A;  1MJG M;  4BLC A;  2YFQ A;  3MMP A;  4LRT A;  4G4Q A;  4PT5 A;  2HKJ A;  2KRK A;  1N34 M;  3QYE A;  4FD2 A;  3HKP A;  3HGI A;  2C9C A;  3HY5 A;  3L2A A;  1IXZ A;  1IN6 A;  2X8A A;  3E4R A;  2WSF F;  5FLX S;  4GRI A;  1NV9 A;  4UN2 B;  1SXJ E;  3GRU A;  4AKH A;  4DV7 M;  1XWI A;  4FCW A;  1HR0 M;  2E5L M;  3NBI A;  2HHH M;  1OAO C;  4IBD A;  1T3T A;  3TQS A;  2FH0 A;  4F2L A;  2RGO A;  1WHC A;  1SXJ D;  1IFY A;  3MK6 A;  3KS4 A;  4G4O A;  4PDI A;  1QAM A;  3B9P A;  1FJG M;  5EP4 A;  3SAT A;  4GKK M;  1EFU B;  1ZMU A;  1BVS A;  1R2Z A;  3BXW A;  4GIT A;  4OW0 A;  1LTM A;  4CJ6 A;  5A2Q S;  4G3O A;  5EQT A;  4ITQ A;  3D8L A;  3TWK A;  1N32 M;  2FOI C;  5FTL A;  1FNN A;  4L4U A;  3SYL A;  3TWL A;  2WSC F;  3MJ5 A;  2WSE F;  5FTM A;  1EIJ A;  2YQZ A;  1N77 A;  2XZF A;  2UXC M;  3VFD A;  2R45 A;  1TH2 A;  4L78 A;  4NSR A;  1VEK A;  4LJ9 A;  5L8R F;  2LVN C;  4LJ4 A;  2ZM6 M;  4W5W A;  1NHW C;  3OTO M;  2R65 A;  3JR4 A;  4G4R A;  2OO9 A;  1GJT A;  3AV0 A;  4JI3 M;  3L25 A;  2DNA A;  2FFJ A;  2UUC M;  1V33 A;  4NXM M;  2DHY A;  3M7G A;  3U6O A;  2ZAO A;  4REZ A;  3U6L A;  3K8Z A;  4KHP M;  1R2Y A;  3PNV A;  3B89 A;  1QDR A;  1VDD A;  4HL4 A;  2F4V M;  3M6A A;  4MGZ E;  1Z59 A;  5EJC A;  4CGY B;  2LBC A;  3J2P B;  1XMO M;  1IN5 A;  3E9S A;  3HX3 A;  1HQC A;  1VEJ A;  3HJ8 A;  5E26 A;  5KO3 A;  4QOS A;  3U6Q A;  3LW5 F;  3LQR A;  2KNZ A;  5EP1 A;  4DV0 M;  1HJP A;  3AL0 C;  1LV7 A;  3TWM A;  1PJQ A;  5IRE B;  4QNR A;  4M0D A;  3IG5 A;  3J7A S;  2CP8 A;  4KLN A;  3JR5 A;  3W0F A;  1D0K A;  3HHW A;  3HHZ A;  2QCU A;  2QPA A;  4GEW A;  4CIZ A;  2D7E A;  1UM8 A;  1J5E M;  2LNH C;  5EXX A;  3W68 A;  3CTW B;  3IEC A;  4QNM A;  2C96 A;  3HJS A;  4DR4 M;  4MH0 E;  5FTK A;  3DOA A;  4R71 A;  2DWZ B;  3GPY A;  3VK8 A;  2UXD M;  2OOB A;  3GLF E;  2L6O A;  4MGY E;  1N78 A;  5EP2 A;  3HU2 A;  4DR1 M;  4IBB A;  4PCZ A;  2JA2 A;  2F5Q A;  3GLF B;  3R9X B;  1E9S A;  5DYG A;  4JI0 M;  1IY1 A;  2DEN A;  2XSZ A;  4JYA M;  2EA0 A;  3HU1 A;  2L4E A;  3AOE A;  3AOE C;  4JN6 A;  1ORY B;  3GLH E;  5EP3 A;  1PJT A;  1Q39 A;  2XEP A;  3FD9 A;  2OQ4 A;  4GKJ M;  3H4J A;  3GLH B;  1G3I A;  3VK7 A;  4DV6 M;  3E21 A;  4LZJ A;  1PGY A;  5KPT A;  1K3X A;  3F92 A;  1NVM A;  1D0M A;  1OTR A;  2ZBK B;  4IBC A;  2L2D A;  4LJA A;  3FKE A;  4M9Z A;  5LMN M;  1K82 A;  3BBZ A;  3PXG A;  3EIE A;  3GLI A;  2YR0 A;  2L4F A;  2LHG A;  4G6Z A;  1PJJ A;  2XLJ A;  2KXE A;  1P3Q Q;  2KHH A;  3K9O A;  1TR8 A;  2V1C A;  4AI6 A;  1RU3 A;  5FSW A;  4JI6 M;  1TGU A;  2K6B A;  5EXT A;  2JY5 A;  3GRY A;  4DUZ M;  4QHT A;  1YSY A;  2KEB A;  4TUW A;  1QYR A;  3FUW A;  2CV1 A;  1IBM M;  3SFZ A;  2WZJ A;  3LCU A;  4GIP A;  1XMQ M;  1S3S A;  2R6F A;  5H37 D;  1I4W A;  3I51 A;  2HWJ A;  1C1K A;  3VDU A;  5DNY A;  2VII A;  3U6C A;  1NJF A;  3SYK A;  4B3R M;  3TPZ A;  3HZJ A;  2V6Z M;  3Q8X A;  2ZAN A;  3TE6 A;  2YNM D;  3KW6 A;  1DGH A;  5ITR A;  1C7Y A;  4LF8 M;  2LWX A;  2D7H A;  4A3V B;  3UGJ A;  3T38 A;  1J09 A;  3GQ4 A;  3SBJ A;  4JV5 M;  4S12 A;  1EE8 A;  3GP1 A;  3K9P A;  4GHL A;  4IBF A;  1L2D A;  1PRB A;  4WW0 A;  3U5Z B;  1XNR M;  2CHQ A;  1GAB A;  2O5R A;  1ZMW A;  5JI3 E;  3LCV B;  3GPU A;  2UUB M;  2KRU A;  1IN8 A;  5DYI A;  1IY0 A;  4FWG A;  3SHF A;  2KZS A;  2EKF A;  3FUV A;  5BPV A;  4DV4 M;  3U6S A;  2R0I A;  3U60 A;  2G8L A;  1MN3 A;  3C3E A;  4I4L A;  3SAV A;  4M0W A;  5JI2 E;  2MRO B;  1L2B A;  1Z5C A;  2DAG A;  4NL4 H;  2Z3X A;  1G8P A;  5ITT A;  1DGG A;  2DAM A;  1HNW M;  1OJL A;  3D8B A;  1WGL A;  4P17 A;  2CUZ A;  2APL A;  2J7N A;  3KSJ A;  3GO8 A;  3U61 B;  1Y8G A;  2J5Y A;  4D82 A;  4IIW A;  4OVZ A;  3GLG A;  4II7 A;  1E94 E;  2R4J A;  3KDS E;  4ZPX A;  2HAK A;  2JWS A;  2L7I A;  4AZF A;  3ZQJ A;  1G71 A;  4QHS A;  3V76 A;  4AG6 A;  3ZH9 B;  4L15 A;  3J27 B;  2F5N A;  1IBL M;  2JY6 B;  1QAN A;  3SMP A;  2DWM A;  2DXI A;  4LFC M;  2QQ8 A;  2KW0 A;  4BBA A;  5FTJ A;  2JZ1 A;  3AKZ A;  4RNA A;  3SAW A;  1OAI A;  2CHG A;  1E9R A;  3H4M A;  4JXJ A;  3CF0 A;  1T43 A;  4Z8X A;  3WHL A;  1MU5 A;  1WJ7 A;  4KT0 F;  2UUA M;  2VQE M;  1JR3 A;  1OKS A;  3I01 M;  2H5X A;  3RE8 A;  1HT2 E;  4CIS A;  3MHV C;  3UMM A;  4M9X A;  4DV2 M;  4LF6 M;  2CE7 A;  3A42 A;  1R5L A;  2OOA A;  3I04 M;  1A5T A;  2ZTC A;  1PM5 A;  1Q02 A;  3T1Y M;  1L1Z A;  2K47 A;  1PJS A;  2B3T A;  2QBY A;  2R46 A;  2X49 A;  4M9S A;  4PD2 A;  3UJN A;  4R3D A;  1GJS A;  1IN7 A;  3KOZ E;  2Z4R A;  4FVM A;  2EO2 A;  2C99 A;  4MM3 B;  3GLI B;  4LF7 M;  3C3D A;  3KP0 E;  1IXR C;  1HNX M;  4IBK A;  4LJ6 A;  4B7F A;  1OFI A;  2LVQ D;  2V1U A;  2RKO A;  2BJV A;  3B7Q A;  1SXJ C;  1SXJ A;  2XFT A;  2FS1 A; 
#chains in the Genus database with same CATH homology
 1G3I A;  3E21 A;  3IHP A;  5DFL A;  1PGY A;  3F92 A;  1OTR A;  2L2D A;  2LVO C;  2EJS A;  3BBZ A;  2KNV A;  1NV9 A;  4UN2 B;  1ZMV A;  2L4F A;  1P3Q Q;  2DZL A;  2KHH A;  3K9O A;  1TR8 A;  2BWB A;  1GO5 A;  3MMP A;  2JY5 A;  4DBG B;  2LTU A;  3GLI E;  2JNH A;  4F2L A;  1WHC A;  1VDL A;  1IFY A;  2JY7 A;  2WZJ A;  3LCU A;  1EFU B;  1VEG A;  1ZMU A;  1BVS A;  2QHO B;  4WP2 A;  2DKL A;  2HWJ A;  4Q7J A;  4G3O A;  1CUK A;  3FRH A;  1C7Y A;  1HT1 E;  1KYI A;  1XXH E;  3K9P A;  2LVP C;  1ZMW A;  2MJ5 B;  1ZV1 A;  3LCV B;  1DO2 A;  4HEO A;  1F4I A;  2MR9 A;  1VEK A;  2DAI A;  2EKF A;  2LVN C;  2R0I A;  1V92 A;  1QZE A;  2QSF X;  1MN3 A;  2OO9 A;  5JI2 E;  2MRO B;  1HQY E;  2KNA A;  1T6O A;  2DAG A;  2DNA A;  2DAE A;  2DHY A;  2MGW A;  2ZTD A;  2CWB A;  2DAM A;  1WR1 B;  2DI0 A;  3FRI A;  1WGL A;  3B89 A;  2K9D A;  1OQY A;  1DV0 A;  2EKK A;  1Y8G A;  2LBC A;  1E94 E;  2BWE A;  1VG5 A;  2HAK A;  1VQ1 A;  1VEJ A;  3GLG E;  2JUJ A;  2QNJ A;  2JY6 B;  2RRU A;  2KNZ A;  2JY8 A;  1HJP A;  2LVA A;  2JZ1 A;  1WIV A;  1OAI A;  2CP8 A;  1T43 A;  1WJ7 A;  3T6P A;  1TTE A;  4GEW A;  1OKS A;  2H5X A;  1HT2 E;  1NV8 A;  2JP7 A;  1AIP C;  3IEC A;  1G4A E;  2OOA A;  1A5T A;  2O25 A;  1G41 A;  2ZTC A;  2G3Q A;  4R71 A;  1Q02 A;  1YLA A;  1JR3 E;  2B3T A;  2OOB A;  4F1I A;  3GLF E;  1UFZ A;  1XB2 B;  1IM2 A;  3FE3 A;  1WGN A;  2DAK A;  2DEN A;  1DO0 A;  1R4G A;  2JZ0 A;  2K0B X;  2L4E A;  2LVQ D;  3GLH E;  1SG9 A;  3H4J A;  1IXS A;  3E46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...