2MJIA

Hifabp_ketorolac_complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
b'AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid-binding protein, intestinal
publication title Characterization of two distinct modes of drug binding to human intestinal Fatty Acid binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein, transport protein
total genus 17
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 2mjiA00
4A60A 2LBVA 2FT9A 4ZHFA 2O62A 5HCEC 3KZAA 1X71A 2LKKA 4NLIA 2CM9A 5HCDC 1IFCA 2NNEA 3HWEA 1IW2A 4AYHA 1FE3A 5KIDA 2LBAA 3CWKA 1GGLA 1EUOA 2QO5A 4IBAA 4I3DA 4I3BA 3AKMA 2FR3A 1GT5A 4ZJ0A 4ORWA 1T0VA 3DSZA 2OVDA 4TQ2A 4QGVA 3C76X 1SXXA 1XKIA 1YUPA 3CQRA 4TNNA 2AT3X 2QM9A 4HPAA 4YH0A 4D6AA 4YCHA 5F6ZA 4QYPA 3HWGA 4YGZA 2MO5A 4WBKA 1YIVA 3FR2A 2OFRX 1KOIA 1GXAA 1LNMA 1S44A 2ALLX 3O22A 4IAWA 4ORYA 3C77X 2WUTA 2NP1A 5IO6A 5BVSA 3C78X 1P6PA 1VYFA 3FEPA 3P6GA 3AKNA 2R74A 1A57A 3WXQA 3I17A 3KFGA 3VG2A 1LPJA 4YMYA 2Q9SA 1YWCA 2CBSA 2A3FX 5EZ2A 4ZHDA 1KZXA 3BSZE 1BBPA 1YWBA 3VG6A 5HTDA 3EBKA 4NLJA 5FFHA 5HZ9A 4AZRA 1DF3A 3STMX 3CR6A 1EIIA 4ZFXA 1LIDA 4QZUA 5CE4A 5F7GA 5K06A 4ORSA 4CK4A 2Q2PA 3NQ3A 3STNA 2L5PA 1LIEA 3WJCA 1MDCA 1ZNEA 1VPRA 1JJJA 3BLGA 1YP7A 1AVGI 1ZNKA 3CBCA 4ORRA 2RCTA 2OVEA 1SXYA 3TZSA 1TW4A 3BY0A 4LZVA 4WFUA 2K62A 5LJDA 1EQDA 4I3CA 2IFBA 1DZJA 1JV4A 2E4JA 1X8NA 1OEKA 4ALOA 2CBRA 1S2PA 2HYSA 3RSWA 1ERXA 3STKA 1KT7A 1ICMA 5D48A 2KTDA 5LKEA 2Q39A 2FLJA 2OFMX 3VG5A 5LJKA 1CJ5A 5F58A 1XCAA 1SY1A 3FIQA 1B0OA 1KQXA 2X45A 1IKJA 4A1YA 2G78A 4ALBA 4OS3A 3KFHA 5FENA 1FDQA 3BX7A 4IMOA 2Q2MA 4UU3A 4IB9A 5BVTA 3APVA 4IB8A 5HZ8A 1QQSA 4AZNA 2A2UA 1AB0A 3PECA 1KT6A 1LIBA 3P6CA 1BEBA 3F8AA 2JU7A 4GH7A 2XSTA 1KZWA 4YGGA 4GRJA 1BRPA 1RBPA 1S7DA 2JU3A 3PP6A 3Q6LA 4AW8A 1BLRA 2ANSA 3FELA 3P6EA 4AZQA 2WQ9A 5B27A 2FS7A 5L8NA 1ICNA 1U18A 1E00A 4OS8A 4OS0A 4ES7A 3FMZA 2GC9A 4BOEA 2AT5X 3GAQA 3B2IA 3HWDA 3F9DA 4OMWA 3UEUA 2FTBA 1X8QA 1B4MA 1OEJA 2YG2A 3B2JA 1DZPA 3D97A 4ORUA 5H9LA 1A2DA 5H9AA 1GM6A 1EXSA 3EYCA 4IB6A 5L8OA 5L8IA 1GT3A 2P8GA 2DM5A 2WEXA 3NX1A 4EDEA 3VG4A 1AQBA 1BM5A 1OBPA 3P6HA 3DTQA 5LJGA 5HWZA 4NNSA 4ZHGA 1LFOA 4MVKA 2POAA 4TKJA 1SY0A 3ELXA 1IIUA 2RCQA 4YKMA 2W2FA 1ALBA 3WJGA 2A0AA 3SAOA 2HLVA 5HAEA 3BDRA 1YWDA 2Q4NA 3ZUOA 2G79A 2A2GA 3G7XA 3WJDA 1N0SA 1LKEA 4GKCA 1QWDA 2CZUA 1MX8A 2MM3A 1OPAA 3KFFA 2AL0X 3TGBA 1ERBA 1SXWA 1A18A 1CBSA 1R0UA 5EPQA 3BU9A 1BSQA 4Y0RA 1GKAB 1GX8A 2LFOA 1DZKA 1BWYA 4ZGUA 2GJ5A 2HZRA 4DQ4A 3TF6A 1ADLA 3NADA 3P6DA 4AZPA 2A13A 5B29A 1MUPA 4YBUA 2QOSC 2AT0X 4YDAA 1QABE 1OPBA 4YFRA 2R73A 3QKGA 4NYQA 5BVQA 3WVMA 3HWFA 2ASNX 3FA6A 1E5PA 5EEEA 1X89A 3ZQ3A 3NQ9A 4XMHA 5KICA 1PBOA 3CMPA 2HNXA 1EPBA 5F1EA 4ZH6A 2OVAA 1OBQA 1EW3A 1RLBE 5DG4A 3FW5A 5HZQA 3NPOA 1T8VA 4EFGA 1HBQA 4YKOA 5H9NA 1JYDA 3NX2A 1SA8A 1OBUA 1UREA 1X8UA 2W2BA 4IMNA 2EU7X 2MJIA 3MBTA 1U17A 1JYJA 3HK1A 1HMRA 1NGLA 3FA8A 4I9RA 5D8JA 4ZHCA 1G74A 3APXA 1AELA 3BU1A 3BRNA 4LKPA 3O2YA 1HBPA 4HFOA 1GT4A 4LKTA 2AT8X 3RZYA 4BQUA 3OJYC 4M7MA 3FW4A 1ZNDA 2OZQA 2CM4A 2JOZA 1DC9A 2L68A 4TJZA 1QG5A 4GNYA 1U0XA 1QY1A 1HQPA 5LJBA 1GKAA 5EDBA 1NP1A 3WBGA 4KIIA 4YBPA 2RQ0A 3ELZA 5HA1A 1DV9A 3UEVA 4ZCBA 3U9PC 1OEEA 1KQWA 3CBSA 4QGWA 3BS2A 4XMCA 4RUUA 1KT5A 3FENA 3IFBA 4YFQA 4I9SA 2G7BA 3U03A 4XMDA 3EMMA 4AZMA 1EALA 1TOUA 4HPDA 5IO5A 1YWAA 3FEKA 1T68X 1QFTA 4R0BA 5HA0A 4A1HA 1IKEA 2HMBA 4YFPA 1HMTA 3MVFA 1NP4A 1O1UA 3WJFA 1FELA 3NR3A 5D47A 1ZNGA 1SXUA 1E02A 1IFBA 1ZRYA 2XKLA 2LB6A 3CQNA 4N7DA 4TKBA 4ZHHA 1ACDA 3FLLA 4IB7A 1A3YA 4EEJA 1O8VA 3FR4A 3BX8A 4IAXA 3O19A 4MVLA 3ZUIA 4M6SA 3APWA 1FEMA 1ML7A 3L4RA 1SY2A 3WJBA 1I04A 4XMEA 3D96A 2FRSA 5D45A 1B8EA 4Y0QA 4WFVA 2NNDA 1G7NA 1LF7A 2HZQA 5DPQA 2ACOA 5LJHA 4NNTA 4A8ZA 4Y0SA 1BRQA 2FR2A 1TVQA 3PEDA 1JJXA 3U0DA 1ZNLA 3IA8A 1KT3A 1PM1X 4QAEA 3D95A 4N7CA 4ARHA 5IO7A 2QO4A 4PSQA 3UEXA 2L9CA 4K19A 4UU2A 3APUA 4OMXA 1G5WA 1JZUA 4Y0PA 1YP6A 4NYRA 1TXLA 2K23A 3PPTA 1CBRA 4NP1A 1E06A 4QGXA 1LIFA 5H8TA 4ORXA 2GTFX 3T1DA 3B2LA 1LICA 1KXOA 1QY2A 1B56A 3S26A 5JR8A 4QZTA 1CRBA 4YDBA 3FA9A 1JBHA 5HTEA 3TGAA 4ZR2A 4O9SA 1ZNHA 1BJ7A 1DFVA 3K3LA 3PH5A 1CBIA 4QYNA 3EBWA 5F6BA 4TLJA 4XMFA 4YGHA 2AT6X 4DQ3A 1BSOA 1KGLA 1QY0A 2F73A 3NP1A 1MVGA 4HPBA 5HZ6A 2PY1A 2W2AA 4EXZA 5HZ5A 5KHPA 2RA6A 3WJEA 5EDCA 1HN2A 1SY3A 1EPAA 3JSQA 2WQAE 1H91A 1PEEA 1I06A 1D2UA 1HMSA 3KQ0A 2N93A 2WWPA 5HCCC 2JU8A 4GNWA 4AZOA 5C0NA 4D6BA 4BVMA 3VG3A 2WSJA 3TGCA 3I0AA 4ZH9A 4XMGA 2WR6A 5FAZA 5LJEA 2NNQA 1X8PA 1KT4A 3KFIA 3B2HA 3FR5A 2ACPX 1X8OA 5H9KA 3JS1A 2KT4B 1FENA 2X46A 2AKQA 4MVIA 1FTPA 2CZTA 4GE1A 1GX9A 5LJCA 1Z24A 1UZ2X 2JN3A 4LZUA 1D3SA 4HPCA 1PMPA 1TOWA 1MX7A 5AQ6A 4GETA 4YCEA 5LKFA 3EM0A 2R56A 4TKHA 1I4UA 2WEWA 2L67A 1BSYA 2FWVA 1CBQA 1QFVA 1G85A 3B2KA 2AMMX 1EIOA 1GT1A 5HBSA 4RUNA 2AH7X 2QO6A 3PH6A 1L6MA 3FA7A 5D4AA 2BLGA 1O1VA 5EEDA 1DZMA 1I05A 2RD7C 3P6FA 3UEWA 3VG7A 1VYGA 4ODDA 2FS6A
chains in the Genus database with same CATH superfamily
4A60A 2LBVA 2FT9A 4ZHFA 2O62A 5HCEC 3KZAA 1X71A 3JQOA 2LKKA 4NLIA 1MM9A 3WOVA 3RDOA 3WYQA 2BSZA 3SLOA 1I9HA 2CM9A 5HCDC 1IFCA 2NNEA 2X34A 4GGRA 3HWEA 1JJUA 3WZPA 4ID2A 1IW2A 4OELA 4AYHA 1FE3A 5KIDA 2BS5A 2GTLO 1Y9LA 2LBAA 3CWKA 1GGLA 1EUOA 2QO5A 2UZ2A 4IBAA 5JD2A 4I3DA 4I3BA 3AKMA 1NBXA 2FR3A 1GT5A 3ZW0A 4ZJ0A 4ORWA 3SOTA 1SRFA 1T0VA 3PQSA 2MF6A 3ZW1A 3DSZA 2OVDA 4L1NA 4TQ2A 4Z2VA 3RE6A 4QGVA 4CPEA 3C76X 1SXXA 3AUMO 1XKIA 1YUPA 3CQRA 3QQ2A 1RSTB 2AT3X 2QM9A 3NQKA 4HPAA 4TNNA 4YH0A 4D6AA 4YCHA 5F6ZA 4QYPA 3HWGA 3LV4A 2MO5A 4O4XA 4WBKA 2RTOB 1YIVA 3FR2A 4YGZA 2OFRX 1KOIA 1GXAA 1LNMA 1S44A 2ALLX 2KD2A 2KW1A 3O22A 4IAWA 4ORYA 3C77X 2WUTA 4U3QA 2NP1A 5IO6A 2VFBA 5BVSA 3C78X 4QRLA 1P6PA 1VYFA 3FEPA 2OY7A 3ZW2A 1E2TA 2X4MA 3HTYA 3P6GA 3AKNA 2R74A 1A57A 3WXQA 2IZIA 1VWNB 4CDFA 3I17A 3KFGA 1SWRA 3VG2A 1LPJA 4YMYA 2Q9SA 2RTFB 1YWCA 4CDEA 2CBSA 2A3FX 1JQPA 4JO6A 5EZ2A 4BBOA 4GDZA 4ZHDA 1SWKA 1VWEB 1W4TA 2C1SA 3BSZE 1KZXA 1BBPA 1YWBA 3VG6A 2FKGA 3EBKA 1LCVA 3OE3A 4NLJA 5FFHA 5HTDA 1PTSA 5HZ9A 4AZRA 3LTWA 1RXHA 3STMX 4EQAC 1DF3A 3CR6A 1EIIA 1NQMA 1LIDA 4ZFXA 4QZUA 5CE4A 1SRHA 1VWOB 4GD9A 2RTAA 4JGLA 1UYNX 3HOLA 4Y5DA 5F7GA 4KC7A 3VHMA 5K06A 4ORSA 2AVIA 2ZAIA 4CK4A 2Q2PA 3NQ3A 3STNA 1N9YA 2L5PA 1LIEA 3WJCA 2DJGA 1MDCA 1ZNEA 5CYBA 1VPRA 3D4RA 4IABA 5F2BA 1JJJA 3BLGA 1YP7A 1AVGI 1LUQA 1ZNKA 2IZLB 2PI3O 3CBCA 4ORRA 3WZQA 1AELA 2RCTA 3FYFA 2OVEA 1SXYA 1N4JA 3TZSA 1TW4A 3BY0A 4LZVA 4WFUA 2K62A 4ZGFA 5LJDA 1EQDA 4I3CA 1I78A 2IFBA 1DZJA 1JV4A 2E4JA 1X8NA 1OEKA 4ALOA 2CBRA 1S2PA 2HYSA 3RSWA 1VWBB 1ERXA 2C1QA 3STKA 1KT7A 2C4IA 1ICMA 5D48A 2KTDA 2RTHB 5LKEA 4C5PA 3P02A 2Q39A 2M4LA 4DNEA 2FLJA 2OFMX 3RWXA 3VG5A 5LJKA 3GE2A 1CJ5A 5F58A 4U8UO 1SLEB 2OY5O 1XCAA 2GH7A 1Y53X 2LA7A 1SY1A 3FIQA 1B0OA 1KQXA 2X45A 1MK5A 3RDMA 1IKJA 1KL5A 4A1YA 1SWHA 2OF8A 2G78A 2RTPB 4ALBA 3LHNA 4OS3A 3KFHA 5FENA 1FDQA 3BX7A 1SRGA 2JW1A 2Q2MA 4IMOA 4UU3A 3VPJE 4IB9A 5BVTA 1KFFA 1SWDA 4Z2PA 3APVA 2IZJA 2OF9A 1SWJA 4IB8A 5HZ8A 1QQSA 4AZNA 2RTDB 2A2UA 1AB0A 3PECA 1KT6A 1LIBA 4FQBB 3P6CA 4BX5B 1BEBA 1K3BA 3F8AA 2JU7A 4GH7A 2XSTA 1KZWA 4YGGA 4GRJA 1BRPA 1RBPA 1S7DA 1HXZA 1RXKA 2JU3A 3PP6A 3Q6LA 4AW8A 1BLRA 2ANSA 3FELA 3P6EA 4AZQA 2WQ9A 5B27A 1SRIA 2FS7A 5L8NA 1NDJA 1ICNA 1U18A 1MEPA 2X55A 1E00A 1WBIA 4OS8A 4OS0A 4CSBA 3VU1A 4ES7A 2JMBA 5FQ7E 3FMZA 2GC9A 1VWMB 2AT5X 4BOEA 1SWQA 2DJFA 2GTLM 3GAQA 4NV8A 3B2IA 3HWDA 3F9DA 4OMWA 3E3CA 3UEUA 2FTBA 1X8QA 2GTLN 1B4MA 5AJBA 1HY2A 1OEJA 3OBLA 2YG2A 3B2JA 3VE1A 4CDCA 1DZPA 1VWGB 3D97A 4ORUA 5H9LA 1A2DA 3VHIA 1NQNA 5H9AA 3TGBA 1GM6A 1W6FA 2RN4A 3EW1A 1EXSA 1K24A 3EYCA 4IB6A 1EI5A 4O4UA 5L8OA 4BX6B 4O3WA 4QQ1A 5L8IA 4GGZA 1GT3A 2P8GA 2DM5A 2WEXA 3NX1A 4EDEA 3VG4A 4FBRA 3MG5A 1AQBA 4FBOA 1BM5A 2RTQB 4KC8A 3RDUA 1OBPA 1SWAA 1VWKB 4KT5A 3T6LA 3P6HA 1HXLA 3DTQA 5LJGA 1SMPI 4ML7B 4BGFA 5HWZA 3MM0A 4NNSA 3UAQA 4ZHGA 1LFOA 4MVKA 2POAA 4TKJA 5B5GA 1LCWA 1SWNA 1SY0A 2A8GA 3ELXA 1IIUA 2RCQA 4YKMA 2W2FA 1ALBA 1W5RA 2A0AA 3N91A 3WJGA 4O4SA 2F01A 3SAOA 2HLVA 3F6ZB 5HAEA 3BDRA 1YWDA 1STSB 2Q4NA 3ZUOA 4U46A 2G79A 2A2GA 3G7XA 3Q34A 3WYPA 3WJDA 1N0SA 3X00A 1LKEA 5K68A 4GKCA 1QWDA 2IZKA 1VWPB 2CZUA 1MX8A 2MM3A 1OPAA 3KFFA 2AL0X 2QOMA 5FQ8E 1ERBA 1SXWA 1A18A 4GDAA 1CBSA 1R0UA 3WZOA 1PBYA 5EPQA 3BU9A 1BSQA 4Z27A 4O3ZA 3RDSA 4Y0RA 1GKAB 1GX8A 3RBYA 2LFOA 1DZKA 4CPIA 3RKGA 4Z6JA 1BWYA 4ZGUA 2GJ5A 2HZRA 4DQ4A 2IZGB 3TF6A 4EKVA 1ADLA 3NADA 1SWEA 3P6DA 4AZPA 3RY1A 2A13A 5B29A 4MIRA 1KL3A 1MUPA 4FBVA 4I6SA 2FHLA 2JGSA 4YBUA 2QOSC 2AT0X 4YDAA 1QABE 1OPBA 4BJ8A 5AEOA 4YFRA 2R73A 3QKGA 4NYQA 5BVQA 3WVMA 3HWFA 3FDCA 5IRWA 2RTEB 2ASNX 3FA6A 1E5PA 2RTBB 4O3YA 5EEEA 1X89A 1Y52X 3AEHA 3ZQ3A 3NQ9A 4I60A 4XMHA 5KICA 1PBOA 2Y3EA 3CMPA 2HNXA 4MVEA 1EPBA 5F1EA 4ZH6A 2OVAA 3V8UA 2BC3A 1VYOA 4U8UM 4GU8A 4GJVA 4GZVA 1OSPO 1SWCA 1OBQA 1EW3A 1RLBE 5DG4A 3FW5A 5HZQA 1VWRB 3NPOA 4U8UN 5IXGA 1T8VA 4HWMA 2CAMA 3VGWA 1HBQA 4EFGA 4YKOA 5H9NA 1LCZA 2OFAA 1JYDA 2FGSA 2IZDB 3NX2A 1SA8A 1OBUA 3SZIA 1UREA 1X8UA 2W2BA 2A5CA 2QCBA 4IMNA 1VWJB 2EU7X 2ZSCA 2MJIA 1NC9A 3MBTA 4CPHB 4BX5A 1U17A 1JYJA 2I5VO 3HK1A 5K67A 5CSEA 1HMRA 1NGLA 3FA8A 3MX7A 4I9RA 5D8JA 1G74A 3APXA 4ZHCA 3BU1A 3BRNA 4LKPA 3RDXA 2IZEB 1SLFB 3O2YA 1HBPA 4HFOA 1GT4A 4LKTA 4YVBA 1STRB 2AT8X 3RZYA 2IZAA 4BQUA 3OJYC 4M7MA 1N43A 4ODDA 3FW4A 2VDFA 1ZNDA 3CKFA 2OZQA 4CV7A 2CM4A 1LDQA 1DC9A 2JOZA 2L68A 3PDFA 4TJZA 3T2XA 1SWUA 1QG5A 4B55A 2OL7A 4GNYA 1IJ8A 1U0XA 3T2WA 1QY1A 2X32A 1HQPA 2RTJA 5LJBA 2MHDA 1GKAA 5EDBA 1NP1A 3WBGA 4KIIA 4YBPA 2UYWA 2G5LA 2RQ0A 3SZJA 3ELZA 2OFBA 3RDQA 1SWTA 5HA1A 1DV9A 1VWCB 1Y0GA 4U9CA 4ZCBA 3UEVA 1AVDA 3FIDA 3U9PC 4ON1A 1OEEA 1KQWA 3CBSA 4QGWA 3BS2A 4GGTA 4I95A 4IRWA 2BT9A 4XMCA 4RUUA 1KT5A 3FENA 3IFBA 4YFQA 4I9SA 2G7BA 1VWAB 5IRUA 3U03A 1SREA 3EMMA 4XMDA 2FKJA 4AZMA 1EALA 1TOUA 4HPDA 5IO5A 1YWAA 3FEKA 4L3RA 3H3IA 1RAVA 1T68X 1QFTA 4R0BA 5HA0A 3SLJA 2OYBO 1Y55X 3HOEA 4A1HA 1IKEA 2X8SA 3NBXX 3S60A 2HMBA 4YFPA 1HMTA 3MVFA 1NP4A 2Y3FA 3T6FA 1LDOA 1O1UA 3P24A 3WJFA 1SLGB 1FELA 1SWBA 1SWFA 3NR3A 5D47A 1ZNGA 4GJSA 1SXUA 1E02A 1IFBA 1ZRYA 2XKLA 4MISA 2LB6A 1SWOA 3CQNA 4N7DA 2IZCB 4TKBA 4ZHHA 1ACDA 3FLLA 4IB7A 4LQZA 1A3YA 2WPUA 4CPHA 1O8VA 4EEJA 5KHPA 3FR4A 3BX8A 4NV7A 4IAXA 3O19A 4MVLA 3ZUIA 4DCBA 4M6SA 3APWA 3SLTA 1LELA 1FEMA 1ML7A 3L4RA 5AJCA 1SY2A 3WJBA 1I04A 4XMEA 3D96A 2FRSA 5D45A 2Z4HA 1B8EA 1UYOX 4WFVA 4Y0QA 2NNDA 1G7NA 1LF7A 2HZQA 5DPQA 2RTCB 2ACOA 1Y9TA 1WUBA 2RTNB 1VWHB 5LJHA 4NNTA 4A8ZA 4Y0SA 3S5VA 1BRQA 2FR2A 1TVQA 2RTIB 3PEDA 4Z2OA 1JJXA 3U0DA 1ZNLA 2OY8A 3IA8A 1KT3A 1PM1X 4QAEA 3D95A 4N7CA 4ARHA 3HPEA 5IO7A 2QO4A 4PSQA 3UEXA 2L9CA 4K19A 1HQQA 4UU2A 3APUA 1KL4A 4OMXA 1VWLB 5B5FA 4BX7B 3KVNA 1G5WA 1JZUA 4NW4A 4O3XB 4Y0PA 1YP6A 2OL8O 4NYRA 1TXLA 4BCSA 4O4OA 2K23A 3PPTA 2AF5A 1CBRA 2BS6A 4NP1A 1E06A 4QGXA 1LIFA 5H8TA 1N7YA 4ORXA 2GTFX 3EW2A 3B2LA 1LICA 3PQUA 4OEMA 3T1DA 1KXOA 1QY2A 4GK9A 2VFCA 4COTA 3SZHA 1FJ1E 1B56A 3S26A 5BYPA 5JR8A 4QZTA 1CRBA 2RTGB 4YDBA 1MOYA 3FA9A 4FGIB 5HTEA 3TGAA 4ZR2A 1SWLA 4O9SA 1ZNHA 1BJ7A 4BX6A 1JBHA 1DFVA 1SWPA 3K3LA 3VHHA 3PH5A 1CBIA 4QYNA 4INNA 3CKGA 2KTSA 3EBWA 5F6BA 4CPFA 1JMZA 4TLJA 4MEEA 4XMFA 1VWFB 4YGHA 2I5ZO 2AT6X 4DQ3A 1BSOA 1KGLA 4O49A 3WZNA 1QY0A 2F73A 2G8CO 3NP1A 1MVGA 1SLDB 4GUZA 4HPBA 5HZ6A 3ZZVA 2PY1A 2IZBA 2W2AA 2A5BA 1AVEA 2RA6A 3WJEA 4EXZA 5HZ5A 1N9MA 5L3YA 2Y32A 2RTKA 1HN2A 5EDCA 4Z28A 3RE5A 1SY3A 1EPAA 4QNIA 2HKDA 3JSQA 3ZW0B 1VWDB 1H91A 2WQAE 1PEEA 1I06A 3ZW1B 1D2UA 1HMSA 5CHKA 3KQ0A 2N93A 2WWPA 4KH8A 3RY2A 2IZFB 5HCCC 2JU8A 4GNWA 4AZOA 2OVSA 5C0NA 4D6BA 1SWSA 4BVMA 3VG3A 2QMIA 2WSJA 3EC5A 5B11O 3I0AA 5IRAA 4ZH9A 3TGCA 4XMGA 2WR6A 3PK2A 5FAZA 2RTLA 2NNQA 1X8PA 1KT4A 3KFIA 5LJEA 3B2HA 3FR5A 2ACPX 2RTMA 1X8OA 5H9KA 4JHQA 3JS1A 2KT4B 1FENA 2X46A 2BHVA 2AKQA 4MVIA 1FTPA 2CZTA 2ZAGA 1GX9A 4GE1A 1Z24A 4Y59A 1UZ2X 5LJCA 2JN3A 4LZUA 1DF8A 1D3SA 4HPCA 1PMPA 1TOWA 2X56A 1MX7A 1VWQB 4OKAA 5AQ6A 4GETA 1RXJA 4YCEA 3ZI8A 2F09A 5LKFA 3EM0A 4BX7A 2R56A 4TKHA 3S5XA 1I4UA 2IZHB 2WEWA 2X8TA 2L67A 1BSYA 1JMXA 2FHNX 2YMSA 2FWVA 5FQ6E 2OL6O 2Z4IA 3D9WA 1CBQA 1QFVA 2X8FA 3ZWEA 1G85A 4KCAA 1SWGA 3B2KA 1SRJA 1GX3A 2AMMX 5B10O 3VE2A 1EIOA 1STPA 1GT1A 5HBSA 4RUNA 2AH7X 4WHIA 2QO6A 2MWHA 3PH6A 5B2AO 1JIWI 1L6MA 3OD9A 3FA7A 5D4AA 2BLGA 1O1VA 4PJ2A 5B3MO 2OY1O 5EEDA 1DZMA 2RTRB 1I05A 2RD7C 3P6FA 3UEWA 1RSUB 3VG7A 1VYGA 4CDDA 4JNJA 1VWIB 2FS6A
chains in the Genus database with same CATH topology
4A60A 2LBVA 2FT9A 4ZHFA 2O62A 5HCEC 3KZAA 1X71A 3JQOA 2LKKA 4NLIA 3WOVA 2CM9A 5HCDC 1IFCA 2NNEA 3HWEA 4ID2A 1IW2A 4AYHA 1FE3A 5KIDA 2BS5A 2GTLO 1Y9LA 2LBAA 3CWKA 1GGLA 1EUOA 2QO5A 4IBAA 4I3DA 4I3BA 3AKMA 2FR3A 1GT5A 3ZW0A 4ZJ0A 4ORWA 3SOTA 1T0VA 3PQSA 3ZW1A 3DSZA 2OVDA 4L1NA 4TQ2A 4QGVA 3C76X 1SXXA 1XKIA 1YUPA 3CQRA 4TNNA 2AT3X 2QM9A 3NQKA 4HPAA 4YH0A 4D6AA 4YCHA 5F6ZA 4QYPA 3HWGA 3LV4A 2MO5A 4O4XA 4WBKA 4YGZA 1YIVA 3FR2A 2OFRX 1KOIA 1GXAA 1LNMA 1S44A 2ALLX 2KD2A 2KW1A 3O22A 4IAWA 4ORYA 3C77X 2WUTA 4U3QA 2NP1A 5IO6A 5BVSA 3C78X 4QRLA 1P6PA 1VYFA 3FEPA 3ZW2A 3P6GA 3HTYA 3AKNA 2R74A 1A57A 3WXQA 3I17A 3KFGA 3VG2A 1LPJA 4YMYA 2Q9SA 1YWCA 2CBSA 2A3FX 5EZ2A 4ZHDA 4GDZA 1KZXA 3BSZE 1BBPA 1YWBA 3VG6A 5HTDA 3EBKA 3OE3A 4NLJA 5FFHA 5HZ9A 4AZRA 1DF3A 3STMX 4EQAC 3CR6A 1EIIA 4ZFXA 1LIDA 4QZUA 5CE4A 4JGLA 5F7GA 3HOLA 4KC7A 5K06A 4ORSA 2ZAIA 4CK4A 2Q2PA 3NQ3A 3STNA 2L5PA 1LIEA 3WJCA 1MDCA 1ZNEA 5CYBA 1VPRA 3D4RA 4IABA 1JJJA 3BLGA 1YP7A 1AVGI 1ZNKA 3CBCA 4ORRA 1AELA 2RCTA 3FYFA 2OVEA 1SXYA 3TZSA 1TW4A 3BY0A 4LZVA 4WFUA 2K62A 4ZGFA 5LJDA 1EQDA 4I3CA 2IFBA 1DZJA 1JV4A 2E4JA 1X8NA 1OEKA 4ALOA 2CBRA 1S2PA 2HYSA 3RSWA 1ERXA 3STKA 1KT7A 1ICMA 5D48A 2KTDA 5LKEA 3P02A 2Q39A 2M4LA 2FLJA 2OFMX 3RWXA 3VG5A 5LJKA 3GE2A 1CJ5A 5F58A 4U8UO 1XCAA 2LA7A 1SY1A 3FIQA 1B0OA 1KQXA 2X45A 1IKJA 4A1YA 2G78A 4ALBA 3LHNA 4OS3A 3KFHA 5FENA 1FDQA 3BX7A 2JW1A 2Q2MA 4IMOA 4UU3A 3VPJE 4IB9A 5BVTA 3APVA 4IB8A 5HZ8A 1QQSA 4AZNA 2A2UA 1AB0A 3PECA 1KT6A 1LIBA 4FQBB 3P6CA 1BEBA 3F8AA 2JU7A 4GH7A 2XSTA 1KZWA 4YGGA 4GRJA 1BRPA 1RBPA 1S7DA 2JU3A 3PP6A 3Q6LA 4AW8A 1BLRA 2ANSA 3FELA 3P6EA 4AZQA 2WQ9A 5B27A 2FS7A 5L8NA 1ICNA 1U18A 1E00A 4OS8A 4OS0A 4CSBA 3VU1A 4ES7A 2JMBA 5FQ7E 3FMZA 2GC9A 4BOEA 2AT5X 2GTLM 3GAQA 3B2IA 3HWDA 3F9DA 4OMWA 3E3CA 3UEUA 2FTBA 1X8QA 2GTLN 1B4MA 5AJBA 1OEJA 3OBLA 2YG2A 3B2JA 3VE1A 1DZPA 3D97A 4ORUA 5H9LA 1A2DA 5H9AA 1GM6A 2RN4A 1EXSA 3EYCA 4IB6A 1EI5A 4O4UA 5L8OA 4O3WA 4QQ1A 5L8IA 1GT3A 2P8GA 2DM5A 2WEXA 3NX1A 4EDEA 3VG4A 4FBRA 4FBOA 1AQBA 1BM5A 4KC8A 1OBPA 4KT5A 3P6HA 3DTQA 5LJGA 1SMPI 4ML7B 5HWZA 4NNSA 3UAQA 4ZHGA 1LFOA 4MVKA 2POAA 4TKJA 1SY0A 3ELXA 1IIUA 2RCQA 4YKMA 2W2FA 1ALBA 3WJGA 2A0AA 3N91A 4O4SA 3SAOA 2HLVA 3F6ZB 5HAEA 3BDRA 1YWDA 2Q4NA 3ZUOA 2G79A 2A2GA 3G7XA 3WJDA 1N0SA 1LKEA 4GKCA 1QWDA 2CZUA 1MX8A 2MM3A 1OPAA 3KFFA 2AL0X 5FQ8E 3TGBA 1ERBA 1SXWA 1A18A 1CBSA 1R0UA 5EPQA 3BU9A 1BSQA 4O3ZA 4Y0RA 1GKAB 1GX8A 3RBYA 2LFOA 1DZKA 1BWYA 3RKGA 4ZGUA 2GJ5A 2HZRA 4DQ4A 3TF6A 1ADLA 3NADA 3P6DA 4AZPA 2A13A 5B29A 4MIRA 1MUPA 4FBVA 4I6SA 4YBUA 2QOSC 2AT0X 4YDAA 1QABE 1OPBA 5AEOA 4YFRA 2R73A 3QKGA 4NYQA 5BVQA 3WVMA 3HWFA 2ASNX 3FA6A 1E5PA 4O3YA 5EEEA 1X89A 3ZQ3A 3NQ9A 4XMHA 5KICA 1PBOA 3CMPA 2HNXA 4MVEA 1EPBA 5F1EA 4ZH6A 2OVAA 3V8UA 4U8UM 4GU8A 4GZVA 1OBQA 1EW3A 1RLBE 5DG4A 3FW5A 5HZQA 3NPOA 4U8UN 1T8VA 4HWMA 4EFGA 1HBQA 4YKOA 5H9NA 1JYDA 3NX2A 1SA8A 1OBUA 1UREA 1X8UA 2W2BA 4IMNA 2EU7X 2MJIA 3MBTA 1U17A 1JYJA 3HK1A 1HMRA 1NGLA 3FA8A 3MX7A 4I9RA 5D8JA 1G74A 3APXA 4ZHCA 3BU1A 3BRNA 4LKPA 3O2YA 1HBPA 4HFOA 1GT4A 4LKTA 2AT8X 3RZYA 4BQUA 3OJYC 4M7MA 3FW4A 1ZNDA 2OZQA 4CV7A 2CM4A 2JOZA 1DC9A 2L68A 4TJZA 1QG5A 4GNYA 1U0XA 1QY1A 1HQPA 5LJBA 2MHDA 1GKAA 5EDBA 1NP1A 3WBGA 4KIIA 4YBPA 2RQ0A 3ELZA 5HA1A 1DV9A 4U9CA 4ZCBA 3UEVA 3U9PC 4ON1A 1OEEA 1KQWA 3CBSA 4QGWA 3BS2A 4I95A 2BT9A 4XMCA 4RUUA 1KT5A 3FENA 3IFBA 4YFQA 4I9SA 2G7BA 3U03A 4XMDA 3EMMA 4AZMA 1EALA 1TOUA 4HPDA 5IO5A 1YWAA 3FEKA 4L3RA 3H3IA 1T68X 1QFTA 4R0BA 5HA0A 3HOEA 4A1HA 1IKEA 2X8SA 3NBXX 3S60A 2HMBA 4YFPA 1HMTA 3MVFA 1NP4A 1O1UA 3P24A 3WJFA 1FELA 3NR3A 5D47A 1ZNGA 1SXUA 1E02A 1IFBA 1ZRYA 2XKLA 4MISA 2LB6A 3CQNA 4N7DA 4TKBA 4ZHHA 1ACDA 3FLLA 4IB7A 4LQZA 1A3YA 4EEJA 1O8VA 3FR4A 3BX8A 4IAXA 3O19A 4MVLA 3ZUIA 4M6SA 3APWA 1FEMA 1ML7A 3L4RA 5AJCA 1SY2A 3WJBA 1I04A 4XMEA 3D96A 2FRSA 5D45A 2Z4HA 1B8EA 4Y0QA 4WFVA 2NNDA 1G7NA 1LF7A 2HZQA 5DPQA 2ACOA 1Y9TA 5LJHA 4NNTA 4A8ZA 4Y0SA 3S5VA 1BRQA 2FR2A 1TVQA 3PEDA 1JJXA 3U0DA 1ZNLA 3IA8A 1KT3A 1PM1X 4QAEA 3D95A 4N7CA 4ARHA 5IO7A 2QO4A 4PSQA 3UEXA 2L9CA 4K19A 4UU2A 3APUA 4OMXA 1G5WA 1JZUA 4NW4A 4O3XB 4Y0PA 1YP6A 4NYRA 1TXLA 4O4OA 2K23A 3PPTA 1CBRA 2BS6A 4NP1A 1E06A 4QGXA 1LIFA 5H8TA 4ORXA 2GTFX 3T1DA 3B2LA 1LICA 3PQUA 1KXOA 1QY2A 4GK9A 4COTA 1B56A 3S26A 5BYPA 5JR8A 4QZTA 1CRBA 4YDBA 3FA9A 4FGIB 1JBHA 5HTEA 3TGAA 4ZR2A 4O9SA 1ZNHA 1BJ7A 1DFVA 3K3LA 3PH5A 1CBIA 4QYNA 4INNA 2KTSA 3EBWA 5F6BA 4TLJA 4XMFA 4YGHA 2AT6X 4DQ3A 1BSOA 1KGLA 4O49A 1QY0A 2F73A 3NP1A 1MVGA 4HPBA 5HZ6A 3ZZVA 2PY1A 2W2AA 4EXZA 5HZ5A 5KHPA 2RA6A 3WJEA 5EDCA 1HN2A 1SY3A 1EPAA 4QNIA 3JSQA 3ZW0B 2WQAE 1H91A 1PEEA 3ZW1B 1I06A 1D2UA 1HMSA 3KQ0A 2N93A 2WWPA 4KH8A 5HCCC 2JU8A 4GNWA 4AZOA 2OVSA 5C0NA 4D6BA 4BVMA 3VG3A 2QMIA 2WSJA 3TGCA 3I0AA 4ZH9A 4XMGA 2WR6A 5FAZA 5LJEA 2NNQA 1X8PA 1KT4A 3KFIA 3B2HA 3FR5A 2ACPX 1X8OA 5H9KA 3JS1A 2KT4B 1FENA 2X46A 2BHVA 2AKQA 4MVIA 1FTPA 2CZTA 2ZAGA 1GX9A 4GE1A 1Z24A 5LJCA 1UZ2X 2JN3A 4LZUA 1D3SA 4HPCA 1PMPA 1TOWA 1MX7A 5AQ6A 4GETA 3ZI8A 4YCEA 2F09A 5LKFA 3EM0A 2R56A 4TKHA 3S5XA 1I4UA 2WEWA 2X8TA 2L67A 1BSYA 2YMSA 2FWVA 5FQ6E 2Z4IA 1CBQA 1QFVA 2X8FA 3ZWEA 1G85A 4KCAA 3VE2A 3B2KA 2AMMX 1EIOA 1GT1A 5HBSA 4RUNA 2AH7X 4WHIA 2QO6A 2MWHA 3PH6A 1JIWI 1L6MA 3OD9A 3FA7A 5D4AA 2BLGA 1O1VA 4PJ2A 5EEDA 1DZMA 1I05A 2RD7C 3P6FA 3UEWA 3VG7A 1VYGA 4ODDA 2FS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A60 A;  2LBV A;  2FT9 A;  4ZHF A;  2O62 A;  5HCE C;  3KZA A;  1X71 A;  2LKK A;  4NLI A;  2CM9 A;  5HCD C;  1IFC A;  2NNE A;  3HWE A;  1IW2 A;  4AYH A;  1FE3 A;  5KID A;  2LBA A;  3CWK A;  1GGL A;  1EUO A;  2QO5 A;  4IBA A;  4I3D A;  4I3B A;  3AKM A;  2FR3 A;  1GT5 A;  4ZJ0 A;  4ORW A;  1T0V A;  3DSZ A;  2OVD A;  4TQ2 A;  4QGV A;  3C76 X;  1SXX A;  1XKI A;  1YUP A;  3CQR A;  4TNN A;  2AT3 X;  2QM9 A;  4HPA A;  4YH0 A;  4D6A A;  4YCH A;  5F6Z A;  4QYP A;  3HWG A;  4YGZ A;  2MO5 A;  4WBK A;  1YIV A;  3FR2 A;  2OFR X;  1KOI A;  1GXA A;  1LNM A;  1S44 A;  2ALL X;  3O22 A;  4IAW A;  4ORY A;  3C77 X;  2WUT A;  2NP1 A;  5IO6 A;  5BVS A;  3C78 X;  1P6P A;  1VYF A;  3FEP A;  3P6G A;  3AKN A;  2R74 A;  1A57 A;  3WXQ A;  3I17 A;  3KFG A;  3VG2 A;  1LPJ A;  4YMY A;  2Q9S A;  1YWC A;  2CBS A;  2A3F X;  5EZ2 A;  4ZHD A;  1KZX A;  3BSZ E;  1BBP A;  1YWB A;  3VG6 A;  5HTD A;  3EBK A;  4NLJ A;  5FFH A;  5HZ9 A;  4AZR A;  1DF3 A;  3STM X;  3CR6 A;  1EII A;  4ZFX A;  1LID A;  4QZU A;  5CE4 A;  5F7G A;  5K06 A;  4ORS A;  4CK4 A;  2Q2P A;  3NQ3 A;  3STN A;  2L5P A;  1LIE A;  3WJC A;  1MDC A;  1ZNE A;  1VPR A;  1JJJ A;  3BLG A;  1YP7 A;  1AVG I;  1ZNK A;  3CBC A;  4ORR A;  2RCT A;  2OVE A;  1SXY A;  3TZS A;  1TW4 A;  3BY0 A;  4LZV A;  4WFU A;  2K62 A;  5LJD A;  1EQD A;  4I3C A;  2IFB A;  1DZJ A;  1JV4 A;  2E4J A;  1X8N A;  1OEK A;  4ALO A;  2CBR A;  1S2P A;  2HYS A;  3RSW A;  1ERX A;  3STK A;  1KT7 A;  1ICM A;  5D48 A;  2KTD A;  5LKE A;  2Q39 A;  2FLJ A;  2OFM X;  3VG5 A;  5LJK A;  1CJ5 A;  5F58 A;  1XCA A;  1SY1 A;  3FIQ A;  1B0O A;  1KQX A;  2X45 A;  1IKJ A;  4A1Y A;  2G78 A;  4ALB A;  4OS3 A;  3KFH A;  5FEN A;  1FDQ A;  3BX7 A;  4IMO A;  2Q2M A;  4UU3 A;  4IB9 A;  5BVT A;  3APV A;  4IB8 A;  5HZ8 A;  1QQS A;  4AZN A;  2A2U A;  1AB0 A;  3PEC A;  1KT6 A;  1LIB A;  3P6C A;  1BEB A;  3F8A A;  2JU7 A;  4GH7 A;  2XST A;  1KZW A;  4YGG A;  4GRJ A;  1BRP A;  1RBP A;  1S7D A;  2JU3 A;  3PP6 A;  3Q6L A;  4AW8 A;  1BLR A;  2ANS A;  3FEL A;  3P6E A;  4AZQ A;  2WQ9 A;  5B27 A;  2FS7 A;  5L8N A;  1ICN A;  1U18 A;  1E00 A;  4OS8 A;  4OS0 A;  4ES7 A;  3FMZ A;  2GC9 A;  4BOE A;  2AT5 X;  3GAQ A;  3B2I A;  3HWD A;  3F9D A;  4OMW A;  3UEU A;  2FTB A;  1X8Q A;  1B4M A;  1OEJ A;  2YG2 A;  3B2J A;  1DZP A;  3D97 A;  4ORU A;  5H9L A;  1A2D A;  5H9A A;  1GM6 A;  1EXS A;  3EYC A;  4IB6 A;  5L8O A;  5L8I A;  1GT3 A;  2P8G A;  2DM5 A;  2WEX A;  3NX1 A;  4EDE A;  3VG4 A;  1AQB A;  1BM5 A;  1OBP A;  3P6H A;  3DTQ A;  5LJG A;  5HWZ A;  4NNS A;  4ZHG A;  1LFO A;  4MVK A;  2POA A;  4TKJ A;  1SY0 A;  3ELX A;  1IIU A;  2RCQ A;  4YKM A;  2W2F A;  1ALB A;  3WJG A;  2A0A A;  3SAO A;  2HLV A;  5HAE A;  3BDR A;  1YWD A;  2Q4N A;  3ZUO A;  2G79 A;  2A2G A;  3G7X A;  3WJD A;  1N0S A;  1LKE A;  4GKC A;  1QWD A;  2CZU A;  1MX8 A;  2MM3 A;  1OPA A;  3KFF A;  2AL0 X;  3TGB A;  1ERB A;  1SXW A;  1A18 A;  1CBS A;  1R0U A;  5EPQ A;  3BU9 A;  1BSQ A;  4Y0R A;  1GKA B;  1GX8 A;  2LFO A;  1DZK A;  1BWY A;  4ZGU A;  2GJ5 A;  2HZR A;  4DQ4 A;  3TF6 A;  1ADL A;  3NAD A;  3P6D A;  4AZP A;  2A13 A;  5B29 A;  1MUP A;  4YBU A;  2QOS C;  2AT0 X;  4YDA A;  1QAB E;  1OPB A;  4YFR A;  2R73 A;  3QKG A;  4NYQ A;  5BVQ A;  3WVM A;  3HWF A;  2ASN X;  3FA6 A;  1E5P A;  5EEE A;  1X89 A;  3ZQ3 A;  3NQ9 A;  4XMH A;  5KIC A;  1PBO A;  3CMP A;  2HNX A;  1EPB A;  5F1E A;  4ZH6 A;  2OVA A;  1OBQ A;  1EW3 A;  1RLB E;  5DG4 A;  3FW5 A;  5HZQ A;  3NPO A;  1T8V A;  4EFG A;  1HBQ A;  4YKO A;  5H9N A;  1JYD A;  3NX2 A;  1SA8 A;  1OBU A;  1URE A;  1X8U A;  2W2B A;  4IMN A;  2EU7 X;  2MJI A;  3MBT A;  1U17 A;  1JYJ A;  3HK1 A;  1HMR A;  1NGL A;  3FA8 A;  4I9R A;  5D8J A;  4ZHC A;  1G74 A;  3APX A;  1AEL A;  3BU1 A;  3BRN A;  4LKP A;  3O2Y A;  1HBP A;  4HFO A;  1GT4 A;  4LKT A;  2AT8 X;  3RZY A;  4BQU A;  3OJY C;  4M7M A;  3FW4 A;  1ZND A;  2OZQ A;  2CM4 A;  2JOZ A;  1DC9 A;  2L68 A;  4TJZ A;  1QG5 A;  4GNY A;  1U0X A;  1QY1 A;  1HQP A;  5LJB A;  1GKA A;  5EDB A;  1NP1 A;  3WBG A;  4KII A;  4YBP A;  2RQ0 A;  3ELZ A;  5HA1 A;  1DV9 A;  3UEV A;  4ZCB A;  3U9P C;  1OEE A;  1KQW A;  3CBS A;  4QGW A;  3BS2 A;  4XMC A;  4RUU A;  1KT5 A;  3FEN A;  3IFB A;  4YFQ A;  4I9S A;  2G7B A;  3U03 A;  4XMD A;  3EMM A;  4AZM A;  1EAL A;  1TOU A;  4HPD A;  5IO5 A;  1YWA A;  3FEK A;  1T68 X;  1QFT A;  4R0B A;  5HA0 A;  4A1H A;  1IKE A;  2HMB A;  4YFP A;  1HMT A;  3MVF A;  1NP4 A;  1O1U A;  3WJF A;  1FEL A;  3NR3 A;  5D47 A;  1ZNG A;  1SXU A;  1E02 A;  1IFB A;  1ZRY A;  2XKL A;  2LB6 A;  3CQN A;  4N7D A;  4TKB A;  4ZHH A;  1ACD A;  3FLL A;  4IB7 A;  1A3Y A;  4EEJ A;  1O8V A;  3FR4 A;  3BX8 A;  4IAX A;  3O19 A;  4MVL A;  3ZUI A;  4M6S A;  3APW A;  1FEM A;  1ML7 A;  3L4R A;  1SY2 A;  3WJB A;  1I04 A;  4XME A;  3D96 A;  2FRS A;  5D45 A;  1B8E A;  4Y0Q A;  4WFV A;  2NND A;  1G7N A;  1LF7 A;  2HZQ A;  5DPQ A;  2ACO A;  5LJH A;  4NNT A;  4A8Z A;  4Y0S A;  1BRQ A;  2FR2 A;  1TVQ A;  3PED A;  1JJX A;  3U0D A;  1ZNL A;  3IA8 A;  1KT3 A;  1PM1 X;  4QAE A;  3D95 A;  4N7C A;  4ARH A;  5IO7 A;  2QO4 A;  4PSQ A;  3UEX A;  2L9C A;  4K19 A;  4UU2 A;  3APU A;  4OMX A;  1G5W A;  1JZU A;  4Y0P A;  1YP6 A;  4NYR A;  1TXL A;  2K23 A;  3PPT A;  1CBR A;  4NP1 A;  1E06 A;  4QGX A;  1LIF A;  5H8T A;  4ORX A;  2GTF X;  3T1D A;  3B2L A;  1LIC A;  1KXO A;  1QY2 A;  1B56 A;  3S26 A;  5JR8 A;  4QZT A;  1CRB A;  4YDB A;  3FA9 A;  1JBH A;  5HTE A;  3TGA A;  4ZR2 A;  4O9S A;  1ZNH A;  1BJ7 A;  1DFV A;  3K3L A;  3PH5 A;  1CBI A;  4QYN A;  3EBW A;  5F6B A;  4TLJ A;  4XMF A;  4YGH A;  2AT6 X;  4DQ3 A;  1BSO A;  1KGL A;  1QY0 A;  2F73 A;  3NP1 A;  1MVG A;  4HPB A;  5HZ6 A;  2PY1 A;  2W2A A;  4EXZ A;  5HZ5 A;  5KHP A;  2RA6 A;  3WJE A;  5EDC A;  1HN2 A;  1SY3 A;  1EPA A;  3JSQ A;  2WQA E;  1H91 A;  1PEE A;  1I06 A;  1D2U A;  1HMS A;  3KQ0 A;  2N93 A;  2WWP A;  5HCC C;  2JU8 A;  4GNW A;  4AZO A;  5C0N A;  4D6B A;  4BVM A;  3VG3 A;  2WSJ A;  3TGC A;  3I0A A;  4ZH9 A;  4XMG A;  2WR6 A;  5FAZ A;  5LJE A;  2NNQ A;  1X8P A;  1KT4 A;  3KFI A;  3B2H A;  3FR5 A;  2ACP X;  1X8O A;  5H9K A;  3JS1 A;  2KT4 B;  1FEN A;  2X46 A;  2AKQ A;  4MVI A;  1FTP A;  2CZT A;  4GE1 A;  1GX9 A;  5LJC A;  1Z24 A;  1UZ2 X;  2JN3 A;  4LZU A;  1D3S A;  4HPC A;  1PMP A;  1TOW A;  1MX7 A;  5AQ6 A;  4GET A;  4YCE A;  5LKF A;  3EM0 A;  2R56 A;  4TKH A;  1I4U A;  2WEW A;  2L67 A;  1BSY A;  2FWV A;  1CBQ A;  1QFV A;  1G85 A;  3B2K A;  2AMM X;  1EIO A;  1GT1 A;  5HBS A;  4RUN A;  2AH7 X;  2QO6 A;  3PH6 A;  1L6M A;  3FA7 A;  5D4A A;  2BLG A;  1O1V A;  5EED A;  1DZM A;  1I05 A;  2RD7 C;  3P6F A;  3UEW A;  3VG7 A;  1VYG A;  4ODD A;  2FS6 A; 
#chains in the Genus database with same CATH topology
 4A60 A;  2LBV A;  2FT9 A;  4ZHF A;  2O62 A;  5HCE C;  3KZA A;  1X71 A;  3JQO A;  2LKK A;  4NLI A;  1MM9 A;  3WOV A;  3RDO A;  3WYQ A;  2BSZ A;  3SLO A;  1I9H A;  2CM9 A;  5HCD C;  1IFC A;  2NNE A;  2X34 A;  4GGR A;  3HWE A;  1JJU A;  3WZP A;  4ID2 A;  1IW2 A;  4OEL A;  4AYH A;  1FE3 A;  5KID A;  2BS5 A;  2GTL O;  1Y9L A;  2LBA A;  3CWK A;  1GGL A;  1EUO A;  2QO5 A;  2UZ2 A;  4IBA A;  5JD2 A;  4I3D A;  4I3B A;  3AKM A;  1NBX A;  2FR3 A;  1GT5 A;  3ZW0 A;  4ZJ0 A;  4ORW A;  3SOT A;  1SRF A;  1T0V A;  3PQS A;  2MF6 A;  3ZW1 A;  3DSZ A;  2OVD A;  4L1N A;  4TQ2 A;  4Z2V A;  3RE6 A;  4QGV A;  4CPE A;  3C76 X;  1SXX A;  3AUM O;  1XKI A;  1YUP A;  3CQR A;  3QQ2 A;  1RST B;  2AT3 X;  2QM9 A;  3NQK A;  4HPA A;  4TNN A;  4YH0 A;  4D6A A;  4YCH A;  5F6Z A;  4QYP A;  3HWG A;  3LV4 A;  2MO5 A;  4O4X A;  4WBK A;  2RTO B;  1YIV A;  3FR2 A;  4YGZ A;  2OFR X;  1KOI A;  1GXA A;  1LNM A;  1S44 A;  2ALL X;  2KD2 A;  2KW1 A;  3O22 A;  4IAW A;  4ORY A;  3C77 X;  2WUT A;  4U3Q A;  2NP1 A;  5IO6 A;  2VFB A;  5BVS A;  3C78 X;  4QRL A;  1P6P A;  1VYF A;  3FEP A;  2OY7 A;  3ZW2 A;  1E2T A;  2X4M A;  3HTY A;  3P6G A;  3AKN A;  2R74 A;  1A57 A;  3WXQ A;  2IZI A;  1VWN B;  4CDF A;  3I17 A;  3KFG A;  1SWR A;  3VG2 A;  1LPJ A;  4YMY A;  2Q9S A;  2RTF B;  1YWC A;  4CDE A;  2CBS A;  2A3F X;  1JQP A;  4JO6 A;  5EZ2 A;  4BBO A;  4GDZ A;  4ZHD A;  1SWK A;  1VWE B;  1W4T A;  2C1S A;  3BSZ E;  1KZX A;  1BBP A;  1YWB A;  3VG6 A;  2FKG A;  3EBK A;  1LCV A;  3OE3 A;  4NLJ A;  5FFH A;  5HTD A;  1PTS A;  5HZ9 A;  4AZR A;  3LTW A;  1RXH A;  3STM X;  4EQA C;  1DF3 A;  3CR6 A;  1EII A;  1NQM A;  1LID A;  4ZFX A;  4QZU A;  5CE4 A;  1SRH A;  1VWO B;  4GD9 A;  2RTA A;  4JGL A;  1UYN X;  3HOL A;  4Y5D A;  5F7G A;  4KC7 A;  3VHM A;  5K06 A;  4ORS A;  2AVI A;  2ZAI A;  4CK4 A;  2Q2P A;  3NQ3 A;  3STN A;  1N9Y A;  2L5P A;  1LIE A;  3WJC A;  2DJG A;  1MDC A;  1ZNE A;  5CYB A;  1VPR A;  3D4R A;  4IAB A;  5F2B A;  1JJJ A;  3BLG A;  1YP7 A;  1AVG I;  1LUQ A;  1ZNK A;  2IZL B;  2PI3 O;  3CBC A;  4ORR A;  3WZQ A;  1AEL A;  2RCT A;  3FYF A;  2OVE A;  1SXY A;  1N4J A;  3TZS A;  1TW4 A;  3BY0 A;  4LZV A;  4WFU A;  2K62 A;  4ZGF A;  5LJD A;  1EQD A;  4I3C A;  1I78 A;  2IFB A;  1DZJ A;  1JV4 A;  2E4J A;  1X8N A;  1OEK A;  4ALO A;  2CBR A;  1S2P A;  2HYS A;  3RSW A;  1VWB B;  1ERX A;  2C1Q A;  3STK A;  1KT7 A;  2C4I A;  1ICM A;  5D48 A;  2KTD A;  2RTH B;  5LKE A;  4C5P A;  3P02 A;  2Q39 A;  2M4L A;  4DNE A;  2FLJ A;  2OFM X;  3RWX A;  3VG5 A;  5LJK A;  3GE2 A;  1CJ5 A;  5F58 A;  4U8U O;  1SLE B;  2OY5 O;  1XCA A;  2GH7 A;  1Y53 X;  2LA7 A;  1SY1 A;  3FIQ A;  1B0O A;  1KQX A;  2X45 A;  1MK5 A;  3RDM A;  1IKJ A;  1KL5 A;  4A1Y A;  1SWH A;  2OF8 A;  2G78 A;  2RTP B;  4ALB A;  3LHN A;  4OS3 A;  3KFH A;  5FEN A;  1FDQ A;  3BX7 A;  1SRG A;  2JW1 A;  2Q2M A;  4IMO A;  4UU3 A;  3VPJ E;  4IB9 A;  5BVT A;  1KFF A;  1SWD A;  4Z2P A;  3APV A;  2IZJ A;  2OF9 A;  1SWJ A;  4IB8 A;  5HZ8 A;  1QQS A;  4AZN A;  2RTD B;  2A2U A;  1AB0 A;  3PEC A;  1KT6 A;  1LIB A;  4FQB B;  3P6C A;  4BX5 B;  1BEB A;  1K3B A;  3F8A A;  2JU7 A;  4GH7 A;  2XST A;  1KZW A;  4YGG A;  4GRJ A;  1BRP A;  1RBP A;  1S7D A;  1HXZ A;  1RXK A;  2JU3 A;  3PP6 A;  3Q6L A;  4AW8 A;  1BLR A;  2ANS A;  3FEL A;  3P6E A;  4AZQ A;  2WQ9 A;  5B27 A;  1SRI A;  2FS7 A;  5L8N A;  1NDJ A;  1ICN A;  1U18 A;  1MEP A;  2X55 A;  1E00 A;  1WBI A;  4OS8 A;  4OS0 A;  4CSB A;  3VU1 A;  4ES7 A;  2JMB A;  5FQ7 E;  3FMZ A;  2GC9 A;  1VWM B;  2AT5 X;  4BOE A;  1SWQ A;  2DJF A;  2GTL M;  3GAQ A;  4NV8 A;  3B2I A;  3HWD A;  3F9D A;  4OMW A;  3E3C A;  3UEU A;  2FTB A;  1X8Q A;  2GTL N;  1B4M A;  5AJB A;  1HY2 A;  1OEJ A;  3OBL A;  2YG2 A;  3B2J A;  3VE1 A;  4CDC A;  1DZP A;  1VWG B;  3D97 A;  4ORU A;  5H9L A;  1A2D A;  3VHI A;  1NQN A;  5H9A A;  3TGB A;  1GM6 A;  1W6F A;  2RN4 A;  3EW1 A;  1EXS A;  1K24 A;  3EYC A;  4IB6 A;  1EI5 A;  4O4U A;  5L8O A;  4BX6 B;  4O3W A;  4QQ1 A;  5L8I A;  4GGZ A;  1GT3 A;  2P8G A;  2DM5 A;  2WEX A;  3NX1 A;  4EDE A;  3VG4 A;  4FBR A;  3MG5 A;  1AQB A;  4FBO A;  1BM5 A;  2RTQ B;  4KC8 A;  3RDU A;  1OBP A;  1SWA A;  1VWK B;  4KT5 A;  3T6L A;  3P6H A;  1HXL A;  3DTQ A;  5LJG A;  1SMP I;  4ML7 B;  4BGF A;  5HWZ A;  3MM0 A;  4NNS A;  3UAQ A;  4ZHG A;  1LFO A;  4MVK A;  2POA A;  4TKJ A;  5B5G A;  1LCW A;  1SWN A;  1SY0 A;  2A8G A;  3ELX A;  1IIU A;  2RCQ A;  4YKM A;  2W2F A;  1ALB A;  1W5R A;  2A0A A;  3N91 A;  3WJG A;  4O4S A;  2F01 A;  3SAO A;  2HLV A;  3F6Z B;  5HAE A;  3BDR A;  1YWD A;  1STS B;  2Q4N A;  3ZUO A;  4U46 A;  2G79 A;  2A2G A;  3G7X A;  3Q34 A;  3WYP A;  3WJD A;  1N0S A;  3X00 A;  1LKE A;  5K68 A;  4GKC A;  1QWD A;  2IZK A;  1VWP B;  2CZU A;  1MX8 A;  2MM3 A;  1OPA A;  3KFF A;  2AL0 X;  2QOM A;  5FQ8 E;  1ERB A;  1SXW A;  1A18 A;  4GDA A;  1CBS A;  1R0U A;  3WZO A;  1PBY A;  5EPQ A;  3BU9 A;  1BSQ A;  4Z27 A;  4O3Z A;  3RDS A;  4Y0R A;  1GKA B;  1GX8 A;  3RBY A;  2LFO A;  1DZK A;  4CPI A;  3RKG A;  4Z6J A;  1BWY A;  4ZGU A;  2GJ5 A;  2HZR A;  4DQ4 A;  2IZG B;  3TF6 A;  4EKV A;  1ADL A;  3NAD A;  1SWE A;  3P6D A;  4AZP A;  3RY1 A;  2A13 A;  5B29 A;  4MIR A;  1KL3 A;  1MUP A;  4FBV A;  4I6S A;  2FHL A;  2JGS A;  4YBU A;  2QOS C;  2AT0 X;  4YDA A;  1QAB E;  1OPB A;  4BJ8 A;  5AEO A;  4YFR A;  2R73 A;  3QKG A;  4NYQ A;  5BVQ A;  3WVM A;  3HWF A;  3FDC A;  5IRW A;  2RTE B;  2ASN X;  3FA6 A;  1E5P A;  2RTB B;  4O3Y A;  5EEE A;  1X89 A;  1Y52 X;  3AEH A;  3ZQ3 A;  3NQ9 A;  4I60 A;  4XMH A;  5KIC A;  1PBO A;  2Y3E A;  3CMP A;  2HNX A;  4MVE A;  1EPB A;  5F1E A;  4ZH6 A;  2OVA A;  3V8U A;  2BC3 A;  1VYO A;  4U8U M;  4GU8 A;  4GJV A;  4GZV A;  1OSP O;  1SWC A;  1OBQ A;  1EW3 A;  1RLB E;  5DG4 A;  3FW5 A;  5HZQ A;  1VWR B;  3NPO A;  4U8U N;  5IXG A;  1T8V A;  4HWM A;  2CAM A;  3VGW A;  1HBQ A;  4EFG A;  4YKO A;  5H9N A;  1LCZ A;  2OFA A;  1JYD A;  2FGS A;  2IZD B;  3NX2 A;  1SA8 A;  1OBU A;  3SZI A;  1URE A;  1X8U A;  2W2B A;  2A5C A;  2QCB A;  4IMN A;  1VWJ B;  2EU7 X;  2ZSC A;  2MJI A;  1NC9 A;  3MBT A;  4CPH B;  4BX5 A;  1U17 A;  1JYJ A;  2I5V O;  3HK1 A;  5K67 A;  5CSE A;  1HMR A;  1NGL A;  3FA8 A;  3MX7 A;  4I9R A;  5D8J A;  1G74 A;  3APX A;  4ZHC A;  3BU1 A;  3BRN A;  4LKP A;  3RDX A;  2IZE B;  1SLF B;  3O2Y A;  1HBP A;  4HFO A;  1GT4 A;  4LKT A;  4YVB A;  1STR B;  2AT8 X;  3RZY A;  2IZA A;  4BQU A;  3OJY C;  4M7M A;  1N43 A;  4ODD A;  3FW4 A;  2VDF A;  1ZND A;  3CKF A;  2OZQ A;  4CV7 A;  2CM4 A;  1LDQ A;  1DC9 A;  2JOZ A;  2L68 A;  3PDF A;  4TJZ A;  3T2X A;  1SWU A;  1QG5 A;  4B55 A;  2OL7 A;  4GNY A;  1IJ8 A;  1U0X A;  3T2W A;  1QY1 A;  2X32 A;  1HQP A;  2RTJ A;  5LJB A;  2MHD A;  1GKA A;  5EDB A;  1NP1 A;  3WBG A;  4KII A;  4YBP A;  2UYW A;  2G5L A;  2RQ0 A;  3SZJ A;  3ELZ A;  2OFB A;  3RDQ A;  1SWT A;  5HA1 A;  1DV9 A;  1VWC B;  1Y0G A;  4U9C A;  4ZCB A;  3UEV A;  1AVD A;  3FID A;  3U9P C;  4ON1 A;  1OEE A;  1KQW A;  3CBS A;  4QGW A;  3BS2 A;  4GGT A;  4I95 A;  4IRW A;  2BT9 A;  4XMC A;  4RUU A;  1KT5 A;  3FEN A;  3IFB A;  4YFQ A;  4I9S A;  2G7B A;  1VWA B;  5IRU A;  3U03 A;  1SRE A;  3EMM A;  4XMD A;  2FKJ A;  4AZM A;  1EAL A;  1TOU A;  4HPD A;  5IO5 A;  1YWA A;  3FEK A;  4L3R A;  3H3I A;  1RAV A;  1T68 X;  1QFT A;  4R0B A;  5HA0 A;  3SLJ A;  2OYB O;  1Y55 X;  3HOE A;  4A1H A;  1IKE A;  2X8S A;  3NBX X;  3S60 A;  2HMB A;  4YFP A;  1HMT A;  3MVF A;  1NP4 A;  2Y3F A;  3T6F A;  1LDO A;  1O1U A;  3P24 A;  3WJF A;  1SLG B;  1FEL A;  1SWB A;  1SWF A;  3NR3 A;  5D47 A;  1ZNG A;  4GJS A;  1SXU A;  1E02 A;  1IFB A;  1ZRY A;  2XKL A;  4MIS A;  2LB6 A;  1SWO A;  3CQN A;  4N7D A;  2IZC B;  4TKB A;  4ZHH A;  1ACD A;  3FLL A;  4IB7 A;  4LQZ A;  1A3Y A;  2WPU A;  4CPH A;  1O8V A;  4EEJ A;  5KHP A;  3FR4 A;  3BX8 A;  4NV7 A;  4IAX A;  3O19 A;  4MVL A;  3ZUI A;  4DCB A;  4M6S A;  3APW A;  3SLT A;  1LEL A;  1FEM A;  1ML7 A;  3L4R A;  5AJC A;  1SY2 A;  3WJB A;  1I04 A;  4XME A;  3D96 A;  2FRS A;  5D45 A;  2Z4H A;  1B8E A;  1UYO X;  4WFV A;  4Y0Q A;  2NND A;  1G7N A;  1LF7 A;  2HZQ A;  5DPQ A;  2RTC B;  2ACO A;  1Y9T A;  1WUB A;  2RTN B;  1VWH B;  5LJH A;  4NNT A;  4A8Z A;  4Y0S A;  3S5V A;  1BRQ A;  2FR2 A;  1TVQ A;  2RTI B;  3PED A;  4Z2O A;  1JJX A;  3U0D A;  1ZNL A;  2OY8 A;  3IA8 A;  1KT3 A;  1PM1 X;  4QAE A;  3D95 A;  4N7C A;  4ARH A;  3HPE A;  5IO7 A;  2QO4 A;  4PSQ A;  3UEX A;  2L9C A;  4K19 A;  1HQQ A;  4UU2 A;  3APU A;  1KL4 A;  4OMX A;  1VWL B;  5B5F A;  4BX7 B;  3KVN A;  1G5W A;  1JZU A;  4NW4 A;  4O3X B;  4Y0P A;  1YP6 A;  2OL8 O;  4NYR A;  1TXL A;  4BCS A;  4O4O A;  2K23 A;  3PPT A;  2AF5 A;  1CBR A;  2BS6 A;  4NP1 A;  1E06 A;  4QGX A;  1LIF A;  5H8T A;  1N7Y A;  4ORX A;  2GTF X;  3EW2 A;  3B2L A;  1LIC A;  3PQU A;  4OEM A;  3T1D A;  1KXO A;  1QY2 A;  4GK9 A;  2VFC A;  4COT A;  3SZH A;  1FJ1 E;  1B56 A;  3S26 A;  5BYP A;  5JR8 A;  4QZT A;  1CRB A;  2RTG B;  4YDB A;  1MOY A;  3FA9 A;  4FGI B;  5HTE A;  3TGA A;  4ZR2 A;  1SWL A;  4O9S A;  1ZNH A;  1BJ7 A;  4BX6 A;  1JBH A;  1DFV A;  1SWP A;  3K3L A;  3VHH A;  3PH5 A;  1CBI A;  4QYN A;  4INN A;  3CKG A;  2KTS A;  3EBW A;  5F6B A;  4CPF A;  1JMZ A;  4TLJ A;  4MEE A;  4XMF A;  1VWF B;  4YGH A;  2I5Z O;  2AT6 X;  4DQ3 A;  1BSO A;  1KGL A;  4O49 A;  3WZN A;  1QY0 A;  2F73 A;  2G8C O;  3NP1 A;  1MVG A;  1SLD B;  4GUZ A;  4HPB A;  5HZ6 A;  3ZZV A;  2PY1 A;  2IZB A;  2W2A A;  2A5B A;  1AVE A;  2RA6 A;  3WJE A;  4EXZ A;  5HZ5 A;  1N9M A;  5L3Y A;  2Y32 A;  2RTK A;  1HN2 A;  5EDC A;  4Z28 A;  3RE5 A;  1SY3 A;  1EPA A;  4QNI A;  2HKD A;  3JSQ A;  3ZW0 B;  1VWD B;  1H91 A;  2WQA E;  1PEE A;  1I06 A;  3ZW1 B;  1D2U A;  1HMS A;  5CHK A;  3KQ0 A;  2N93 A;  2WWP A;  4KH8 A;  3RY2 A;  2IZF B;  5HCC C;  2JU8 A;  4GNW A;  4AZO A;  2OVS A;  5C0N A;  4D6B A;  1SWS A;  4BVM A;  3VG3 A;  2QMI A;  2WSJ A;  3EC5 A;  5B11 O;  3I0A A;  5IRA A;  4ZH9 A;  3TGC A;  4XMG A;  2WR6 A;  3PK2 A;  5FAZ A;  2RTL A;  2NNQ A;  1X8P A;  1KT4 A;  3KFI A;  5LJE A;  3B2H A;  3FR5 A;  2ACP X;  2RTM A;  1X8O A;  5H9K A;  4JHQ A;  3JS1 A;  2KT4 B;  1FEN A;  2X46 A;  2BHV A;  2AKQ A;  4MVI A;  1FTP A;  2CZT A;  2ZAG A;  1GX9 A;  4GE1 A;  1Z24 A;  4Y59 A;  1UZ2 X;  5LJC A;  2JN3 A;  4LZU A;  1DF8 A;  1D3S A;  4HPC A;  1PMP A;  1TOW A;  2X56 A;  1MX7 A;  1VWQ B;  4OKA A;  5AQ6 A;  4GET A;  1RXJ A;  4YCE A;  3ZI8 A;  2F09 A;  5LKF A;  3EM0 A;  4BX7 A;  2R56 A;  4TKH A;  3S5X A;  1I4U A;  2IZH B;  2WEW A;  2X8T A;  2L67 A;  1BSY A;  1JMX A;  2FHN X;  2YMS A;  2FWV A;  5FQ6 E;  2OL6 O;  2Z4I A;  3D9W A;  1CBQ A;  1QFV A;  2X8F A;  3ZWE A;  1G85 A;  4KCA A;  1SWG A;  3B2K A;  1SRJ A;  1GX3 A;  2AMM X;  5B10 O;  3VE2 A;  1EIO A;  1STP A;  1GT1 A;  5HBS A;  4RUN A;  2AH7 X;  4WHI A;  2QO6 A;  2MWH A;  3PH6 A;  5B2A O;  1JIW I;  1L6M A;  3OD9 A;  3FA7 A;  5D4A A;  2BLG A;  1O1V A;  4PJ2 A;  5B3M O;  2OY1 O;  5EED A;  1DZM A;  2RTR B;  1I05 A;  2RD7 C;  3P6F A;  3UEW A;  1RSU B;  3VG7 A;  1VYG A;  4CDD A;  4JNJ A;  1VWI B;  2FS6 A; 
#chains in the Genus database with same CATH homology
 4A60 A;  2LBV A;  2FT9 A;  4ZHF A;  2O62 A;  5HCE C;  3KZA A;  1X71 A;  3JQO A;  2LKK A;  4NLI A;  3WOV A;  2CM9 A;  5HCD C;  1IFC A;  2NNE A;  3HWE A;  4ID2 A;  1IW2 A;  4AYH A;  1FE3 A;  5KID A;  2BS5 A;  2GTL O;  1Y9L A;  2LBA A;  3CWK A;  1GGL A;  1EUO A;  2QO5 A;  4IBA A;  4I3D A;  4I3B A;  3AKM A;  2FR3 A;  1GT5 A;  3ZW0 A;  4ZJ0 A;  4ORW A;  3SOT A;  1T0V A;  3PQS A;  3ZW1 A;  3DSZ A;  2OVD A;  4L1N A;  4TQ2 A;  4QGV A;  3C76 X;  1SXX A;  1XKI A;  1YUP A;  3CQR A;  4TNN A;  2AT3 X;  2QM9 A;  3NQK A;  4HPA A;  4YH0 A;  4D6A A;  4YCH A;  5F6Z A;  4QYP A;  3HWG A;  3LV4 A;  2MO5 A;  4O4X A;  4WBK A;  4YGZ A;  1YIV A;  3FR2 A;  2OFR X;  1KOI A;  1GXA A;  1LNM A;  1S44 A;  2ALL X;  2KD2 A;  2KW1 A;  3O22 A;  4IAW A;  4ORY A;  3C77 X;  2WUT A;  4U3Q A;  2NP1 A;  5IO6 A;  5BVS A;  3C78 X;  4QRL A;  1P6P A;  1VYF A;  3FEP A;  3ZW2 A;  3P6G A;  3HTY A;  3AKN A;  2R74 A;  1A57 A;  3WXQ A;  3I17 A;  3KFG A;  3VG2 A;  1LPJ A;  4YMY A;  2Q9S A;  1YWC A;  2CBS A;  2A3F X;  5EZ2 A;  4ZHD A;  4GDZ A;  1KZX A;  3BSZ E;  1BBP A;  1YWB A;  3VG6 A;  5HTD A;  3EBK A;  3OE3 A;  4NLJ A;  5FFH A;  5HZ9 A;  4AZR A;  1DF3 A;  3STM X;  4EQA C;  3CR6 A;  1EII A;  4ZFX A;  1LID A;  4QZU A;  5CE4 A;  4JGL A;  5F7G A;  3HOL A;  4KC7 A;  5K06 A;  4ORS A;  2ZAI A;  4CK4 A;  2Q2P A;  3NQ3 A;  3STN A;  2L5P A;  1LIE A;  3WJC A;  1MDC A;  1ZNE A;  5CYB A;  1VPR A;  3D4R A;  4IAB A;  1JJJ A;  3BLG A;  1YP7 A;  1AVG I;  1ZNK A;  3CBC A;  4ORR A;  1AEL A;  2RCT A;  3FYF A;  2OVE A;  1SXY A;  3TZS A;  1TW4 A;  3BY0 A;  4LZV A;  4WFU A;  2K62 A;  4ZGF A;  5LJD A;  1EQD A;  4I3C A;  2IFB A;  1DZJ A;  1JV4 A;  2E4J A;  1X8N A;  1OEK A;  4ALO A;  2CBR A;  1S2P A;  2HYS A;  3RSW A;  1ERX A;  3STK A;  1KT7 A;  1ICM A;  5D48 A;  2KTD A;  5LKE A;  3P02 A;  2Q39 A;  2M4L A;  2FLJ A;  2OFM X;  3RWX A;  3VG5 A;  5LJK A;  3GE2 A;  1CJ5 A;  5F58 A;  4U8U O;  1XCA A;  2LA7 A;  1SY1 A;  3FIQ A;  1B0O A;  1KQX A;  2X45 A;  1IKJ A;  4A1Y A;  2G78 A;  4ALB A;  3LHN A;  4OS3 A;  3KFH A;  5FEN A;  1FDQ A;  3BX7 A;  2JW1 A;  2Q2M A;  4IMO A;  4UU3 A;  3VPJ E;  4IB9 A;  5BVT A;  3APV A;  4IB8 A;  5HZ8 A;  1QQS A;  4AZN A;  2A2U A;  1AB0 A;  3PEC A;  1KT6 A;  1LIB A;  4FQB B;  3P6C A;  1BEB A;  3F8A A;  2JU7 A;  4GH7 A;  2XST A;  1KZW A;  4YGG A;  4GRJ A;  1BRP A;  1RBP A;  1S7D A;  2JU3 A;  3PP6 A;  3Q6L A;  4AW8 A;  1BLR A;  2ANS A;  3FEL A;  3P6E A;  4AZQ A;  2WQ9 A;  5B27 A;  2FS7 A;  5L8N A;  1ICN A;  1U18 A;  1E00 A;  4OS8 A;  4OS0 A;  4CSB A;  3VU1 A;  4ES7 A;  2JMB A;  5FQ7 E;  3FMZ A;  2GC9 A;  4BOE A;  2AT5 X;  2GTL M;  3GAQ A;  3B2I A;  3HWD A;  3F9D A;  4OMW A;  3E3C A;  3UEU A;  2FTB A;  1X8Q A;  2GTL N;  1B4M A;  5AJB A;  1OEJ A;  3OBL A;  2YG2 A;  3B2J A;  3VE1 A;  1DZP A;  3D97 A;  4ORU A;  5H9L A;  1A2D A;  5H9A A;  1GM6 A;  2RN4 A;  1EXS A;  3EYC A;  4IB6 A;  1EI5 A;  4O4U A;  5L8O A;  4O3W A;  4QQ1 A;  5L8I A;  1GT3 A;  2P8G A;  2DM5 A;  2WEX A;  3NX1 A;  4EDE A;  3VG4 A;  4FBR A;  4FBO A;  1AQB A;  1BM5 A;  4KC8 A;  1OBP A;  4KT5 A;  3P6H A;  3DTQ A;  5LJG A;  1SMP I;  4ML7 B;  5HWZ A;  4NNS A;  3UAQ A;  4ZHG A;  1LFO A;  4MVK A;  2POA A;  4TKJ A;  1SY0 A;  3ELX A;  1IIU A;  2RCQ A;  4YKM A;  2W2F A;  1ALB A;  3WJG A;  2A0A A;  3N91 A;  4O4S A;  3SAO A;  2HLV A;  3F6Z B;  5HAE A;  3BDR A;  1YWD A;  2Q4N A;  3ZUO A;  2G79 A;  2A2G A;  3G7X A;  3WJD A;  1N0S A;  1LKE A;  4GKC A;  1QWD A;  2CZU A;  1MX8 A;  2MM3 A;  1OPA A;  3KFF A;  2AL0 X;  5FQ8 E;  3TGB A;  1ERB A;  1SXW A;  1A18 A;  1CBS A;  1R0U A;  5EPQ A;  3BU9 A;  1BSQ A;  4O3Z A;  4Y0R A;  1GKA B;  1GX8 A;  3RBY A;  2LFO A;  1DZK A;  1BWY A;  3RKG A;  4ZGU A;  2GJ5 A;  2HZR A;  4DQ4 A;  3TF6 A;  1ADL A;  3NAD A;  3P6D A;  4AZP A;  2A13 A;  5B29 A;  4MIR A;  1MUP A;  4FBV A;  4I6S A;  4YBU A;  2QOS C;  2AT0 X;  4YDA A;  1QAB E;  1OPB A;  5AEO A;  4YFR A;  2R73 A;  3QKG A;  4NYQ A;  5BVQ A;  3WVM A;  3HWF A;  2ASN X;  3FA6 A;  1E5P A;  4O3Y A;  5EEE A;  1X89 A;  3ZQ3 A;  3NQ9 A;  4XMH A;  5KIC A;  1PBO A;  3CMP A;  2HNX A;  4MVE A;  1EPB A;  5F1E A;  4ZH6 A;  2OVA A;  3V8U A;  4U8U M;  4GU8 A;  4GZV A;  1OBQ A;  1EW3 A;  1RLB E;  5DG4 A;  3FW5 A;  5HZQ A;  3NPO A;  4U8U N;  1T8V A;  4HWM A;  4EFG A;  1HBQ A;  4YKO A;  5H9N A;  1JYD A;  3NX2 A;  1SA8 A;  1OBU A;  1URE A;  1X8U A;  2W2B A;  4IMN A;  2EU7 X;  2MJI A;  3MBT A;  1U17 A;  1JYJ A;  3HK1 A;  1HMR A;  1NGL A;  3FA8 A;  3MX7 A;  4I9R A;  5D8J A;  1G74 A;  3APX A;  4ZHC A;  3BU1 A;  3BRN A;  4LKP A;  3O2Y A;  1HBP A;  4HFO A;  1GT4 A;  4LKT A;  2AT8 X;  3RZY A;  4BQU A;  3OJY C;  4M7M A;  3FW4 A;  1ZND A;  2OZQ A;  4CV7 A;  2CM4 A;  2JOZ A;  1DC9 A;  2L68 A;  4TJZ A;  1QG5 A;  4GNY A;  1U0X A;  1QY1 A;  1HQP A;  5LJB A;  2MHD A;  1GKA A;  5EDB A;  1NP1 A;  3WBG A;  4KII A;  4YBP A;  2RQ0 A;  3ELZ A;  5HA1 A;  1DV9 A;  4U9C A;  4ZCB A;  3UEV A;  3U9P C;  4ON1 A;  1OEE A;  1KQW A;  3CBS A;  4QGW A;  3BS2 A;  4I95 A;  2BT9 A;  4XMC A;  4RUU A;  1KT5 A;  3FEN A;  3IFB A;  4YFQ A;  4I9S A;  2G7B A;  3U03 A;  4XMD A;  3EMM A;  4AZM A;  1EAL A;  1TOU A;  4HPD A;  5IO5 A;  1YWA A;  3FEK A;  4L3R A;  3H3I A;  1T68 X;  1QFT A;  4R0B A;  5HA0 A;  3HOE A;  4A1H A;  1IKE A;  2X8S A;  3NBX X;  3S60 A;  2HMB A;  4YFP A;  1HMT A;  3MVF A;  1NP4 A;  1O1U A;  3P24 A;  3WJF A;  1FEL A;  3NR3 A;  5D47 A;  1ZNG A;  1SXU A;  1E02 A;  1IFB A;  1ZRY A;  2XKL A;  4MIS A;  2LB6 A;  3CQN A;  4N7D A;  4TKB A;  4ZHH A;  1ACD A;  3FLL A;  4IB7 A;  4LQZ A;  1A3Y A;  4EEJ A;  1O8V A;  3FR4 A;  3BX8 A;  4IAX A;  3O19 A;  4MVL A;  3ZUI A;  4M6S A;  3APW A;  1FEM A;  1ML7 A;  3L4R A;  5AJC A;  1SY2 A;  3WJB A;  1I04 A;  4XME A;  3D96 A;  2FRS A;  5D45 A;  2Z4H A;  1B8E A;  4Y0Q A;  4WFV A;  2NND A;  1G7N A;  1LF7 A;  2HZQ A;  5DPQ A;  2ACO A;  1Y9T A;  5LJH A;  4NNT A;  4A8Z A;  4Y0S A;  3S5V A;  1BRQ A;  2FR2 A;  1TVQ A;  3PED A;  1JJX A;  3U0D A;  1ZNL A;  3IA8 A;  1KT3 A;  1PM1 X;  4QAE A;  3D95 A;  4N7C A;  4ARH A;  5IO7 A;  2QO4 A;  4PSQ A;  3UEX A;  2L9C A;  4K19 A;  4UU2 A;  3APU A;  4OMX A;  1G5W A;  1JZU A;  4NW4 A;  4O3X B;  4Y0P A;  1YP6 A;  4NYR A;  1TXL A;  4O4O A;  2K23 A;  3PPT A;  1CBR A;  2BS6 A;  4NP1 A;  1E06 A;  4QGX A;  1LIF A;  5H8T A;  4ORX A;  2GTF X;  3T1D A;  3B2L A;  1LIC A;  3PQU A;  1KXO A;  1QY2 A;  4GK9 A;  4COT A;  1B56 A;  3S26 A;  5BYP A;  5JR8 A;  4QZT A;  1CRB A;  4YDB A;  3FA9 A;  4FGI B;  1JBH A;  5HTE A;  3TGA A;  4ZR2 A;  4O9S A;  1ZNH A;  1BJ7 A;  1DFV A;  3K3L A;  3PH5 A;  1CBI A;  4QYN A;  4INN A;  2KTS A;  3EBW A;  5F6B A;  4TLJ A;  4XMF A;  4YGH A;  2AT6 X;  4DQ3 A;  1BSO A;  1KGL A;  4O49 A;  1QY0 A;  2F73 A;  3NP1 A;  1MVG A;  4HPB A;  5HZ6 A;  3ZZV A;  2PY1 A;  2W2A A;  4EXZ A;  5HZ5 A;  5KHP A;  2RA6 A;  3WJE A;  5EDC A;  1HN2 A;  1SY3 A;  1EPA A;  4QNI A;  3JSQ A;  3ZW0 B;  2WQA E;  1H91 A;  1PEE A;  3ZW1 B;  1I06 A;  1D2U A;  1HMS A;  3KQ0 A;  2N93 A;  2WWP A;  4KH8 A;  5HCC C;  2JU8 A;  4GNW A;  4AZO A;  2OVS A;  5C0N A;  4D6B A;  4BVM A;  3VG3 A;  2QMI A;  2WSJ A;  3TGC A;  3I0A A;  4ZH9 A;  4XMG A;  2WR6 A;  5FAZ A;  5LJE A;  2NNQ A;  1X8P A;  1KT4 A;  3KFI A;  3B2H A;  3FR5 A;  2ACP X;  1X8O A;  5H9K A;  3JS1 A;  2KT4 B;  1FEN A;  2X46 A;  2BHV A;  2AKQ A;  4MVI A;  1FTP A;  2CZT A;  2ZAG A;  1GX9 A;  4GE1 A;  1Z24 A;  5LJC A;  1UZ2 X;  2JN3 A;  4LZU A;  1D3S A;  4HPC A;  1PMP A;  1TOW A;  1MX7 A;  5AQ6 A;  4GET A;  3ZI8 A;  4YCE A;  2F09 A;  5LKF A;  3EM0 A;  2R56 A;  4TKH A;  3S5X A;  1I4U A;  2WEW A;  2X8T A;  2L67 A;  1BSY A;  2YMS A;  2FWV A;  5FQ6 E;  2Z4I A;  1CBQ A;  1QFV A;  2X8F A;  3ZWE A;  1G85 A;  4KCA A;  3VE2 A;  3B2K A;  2AMM X;  1EIO A;  1GT1 A;  5HBS A;  4RUN A;  2AH7 X;  4WHI A;  2QO6 A;  2MWH A;  3PH6 A;  1JIW I;  1L6M A;  3OD9 A;  3FA7 A;  5D4A A;  2BLG A;  1O1V A;  4PJ2 A;  5EED A;  1DZM A;  1I05 A;  2RD7 C;  3P6F A;  3UEW A;  3VG7 A;  1VYG A;  4ODD A;  2FS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...