2MJYA

Solution structure of synthetic mamba-1 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-pot hydrazide-based native chemical ligation for efficient chemical synthesis and structure determination of toxin Mambalgin-1
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mambalgin-1
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mjyA00
1IDGA 2H8UA 1IQ9A 1KBTA 1NEAA 4BDTB 5DZ5A 3ERAA 1CCQA 1TXAA 3LAQU 1IDIA 1HOYA 2LCRA 2BHIA 4RUDA 1QM7A 1BTEA 1KL8A 1LXGA 3FEVA 2H64B 3U73U 1MR6A 1NYSA 2K3GA 2MHYA 1RGJA 1L4WA 4XJJA 1IKCA 1VB0A 1COEA 2HLRA 1CREA 1BXPA 1IDLA 1MAHF 1V6PA 1CDTA 2CRSA 1NYUA 1F94A 1CRFA 3KFDE 2HLQA 4UY2C 1FF4A 3U74U 4BIKB 1KS6A 4HQPF 3EVSC 1ABTA 1YWHA 2CRTA 2H7ZB 1I02A 5EBXA 5IMTD 1S4YA 2QJBC 2QC1A 4FAOE 1JBDA 1CVOA 3HH7A 1HC9B 2MFAA 1ES7B 1NTXA 4FAOC 1CDSA 2CTXA 4OM4A 1ERAA 2GOOB 2GOOC 1CB9A 1ONJA 1KBSA 1HC9A 2ABXA 2BTXA 1JE9A 4OM5A 3NH7A 1NXBA 1G6MA 2UX2A 5DU1A 3NDSA 3VTSA 1KFHA 1KXIA 2PJYB 1KBAA 1JGKA 1ZADA 2L03A 2N99A 1NTNA 1IJCA 2H64C 2L5SA 4P7UA 3EBXA 1CDQA 1XT3A 1QKDA 1W6BA 1UG4A 4QTIU 1FRAA 5DO6A 1LXHA 1KC4A 2JVEA 1FSCA 1HAJA 2VLWA 3PLCA 1FSSB 2MJ0A 2QJ9C 1CODA 2H62C 2MJYA 2PJYC 3BT1U 4IYEA 2LA1A 2CCXA 3QB4B 1CXOA 1REWC 2CDXA 2J8BA 1TXBA 1RL5A 2UWRA 2ERAA 2OFSA 1TGXA 3KFDI 1KU6B 4DO8A 1M9ZA 1FFJA 1ERGA 1KTZB 1NORA 2H7ZA 1IDHA 1DRSA 1H0JA 1FASA 1HAAA 4AEAA 1CXNA 1PLOA 2FD6U 2I9BE 1LSIA 5IMYC 6EBXA 1QKEA 2QJAC 2H5FA 1F8UB 1B41B 1IK8A 2X8BB 3BT2U 2NBTA 2MUPA 2JQPA 4EY8B 3NEQA 1LJZA 1TFSA 2MUOA 2MJ4A 1CTXA 4LFTA 4ZQYA 1CHVS 2H62D 1CDRA 1LX5B
chains in the Genus database with same CATH superfamily
1IDGA 2H8UA 1IQ9A 1KBTA 1NEAA 4BDTB 5DZ5A 3ERAA 1CCQA 1TXAA 3LAQU 1IDIA 1HOYA 2LCRA 2BHIA 4RUDA 1QM7A 1BTEA 1KL8A 1LXGA 3FEVA 2H64B 3U73U 1MR6A 1NYSA 2K3GA 2MHYA 1RGJA 1L4WA 4XJJA 1IKCA 1VB0A 1COEA 2HLRA 1CREA 1BXPA 1IDLA 1MAHF 1V6PA 1CDTA 2CRSA 1NYUA 1F94A 1CRFA 3KFDE 2HLQA 4UY2C 1FF4A 3U74U 4BIKB 1KS6A 4HQPF 3EVSC 1ABTA 1YWHA 2CRTA 2H7ZB 1I02A 5EBXA 5IMTD 1S4YA 2QJBC 2QC1A 4FAOE 1JBDA 1CVOA 3HH7A 1HC9B 2MFAA 1ES7B 1NTXA 4FAOC 1CDSA 2CTXA 4OM4A 1ERAA 2GOOB 2GOOC 1CB9A 1ONJA 1KBSA 1HC9A 2ABXA 2BTXA 1JE9A 4OM5A 3NH7A 4KSNA 1NXBA 1G6MA 2UX2A 5DU1A 3NDSA 3VTSA 1KFHA 1KXIA 2PJYB 1KBAA 1JGKA 1ZADA 2L03A 2N99A 1NTNA 1IJCA 2H64C 2L5SA 4P7UA 3EBXA 1CDQA 1XT3A 1QKDA 1W6BA 1UG4A 4QTIU 1FRAA 5DO6A 1LXHA 1KC4A 2JVEA 1FSCA 1HAJA 2VLWA 3PLCA 1FSSB 2MJ0A 2QJ9C 1CODA 2H62C 2MJYA 2PJYC 3BT1U 4IYEA 2LA1A 2CCXA 3QB4B 1CXOA 1REWC 2CDXA 2J8BA 1TXBA 1RL5A 2UWRA 2ERAA 2OFSA 1TGXA 3KFDI 1KU6B 4DO8A 1M9ZA 1FFJA 1ERGA 1KTZB 1NORA 2H7ZA 1IDHA 1DRSA 1H0JA 1FASA 1HAAA 4AEAA 1CXNA 1PLOA 2FD6U 2I9BE 1LSIA 5IMYC 6EBXA 1QKEA 2QJAC 2H5FA 1F8UB 1B41B 1IK8A 2X8BB 3BT2U 2NBTA 2MUPA 2JQPA 4EY8B 3NEQA 1LJZA 1TFSA 2MUOA 2MJ4A 1CTXA 4LFTA 4ZQYA 1CHVS 2H62D 1CDRA 1LX5B
chains in the Genus database with same CATH topology
1IDGA 2H8UA 1IQ9A 1KBTA 1NEAA 4BDTB 5DZ5A 3ERAA 1CCQA 1TXAA 3LAQU 1IDIA 1HOYA 2LCRA 2BHIA 4RUDA 1QM7A 1BTEA 1KL8A 1LXGA 3FEVA 2H64B 3U73U 1MR6A 1NYSA 2K3GA 2MHYA 1RGJA 1L4WA 4XJJA 1IKCA 1VB0A 1COEA 2HLRA 1CREA 1BXPA 1IDLA 1MAHF 1V6PA 1CDTA 2CRSA 1NYUA 1F94A 1CRFA 3KFDE 2HLQA 4UY2C 1FF4A 3U74U 4BIKB 1KS6A 4HQPF 3EVSC 1ABTA 1YWHA 2CRTA 2H7ZB 1I02A 5EBXA 5IMTD 1S4YA 2QJBC 2QC1A 4FAOE 1JBDA 1CVOA 3HH7A 1HC9B 2MFAA 1ES7B 1NTXA 4FAOC 1CDSA 2CTXA 4OM4A 1ERAA 2GOOB 2GOOC 1CB9A 1ONJA 1KBSA 1HC9A 2ABXA 2BTXA 1JE9A 4OM5A 3NH7A 4KSNA 1NXBA 1G6MA 2UX2A 5DU1A 3NDSA 3VTSA 1KFHA 1KXIA 2PJYB 1KBAA 1JGKA 1ZADA 2L03A 2N99A 1NTNA 1IJCA 2H64C 2L5SA 4P7UA 3EBXA 1CDQA 1XT3A 1QKDA 1W6BA 1UG4A 4QTIU 1FRAA 5DO6A 1LXHA 1KC4A 2JVEA 1FSCA 1HAJA 2VLWA 3PLCA 1FSSB 2MJ0A 2QJ9C 1CODA 2H62C 2MJYA 2PJYC 3BT1U 4IYEA 2LA1A 2CCXA 3QB4B 1CXOA 1REWC 2CDXA 2J8BA 1TXBA 1RL5A 2UWRA 2ERAA 2OFSA 1TGXA 3KFDI 1KU6B 4DO8A 1M9ZA 1FFJA 1ERGA 1KTZB 1NORA 2H7ZA 1IDHA 1DRSA 1H0JA 1FASA 1HAAA 4AEAA 1CXNA 1PLOA 2FD6U 2I9BE 1LSIA 5IMYC 6EBXA 1QKEA 2QJAC 2H5FA 1F8UB 1B41B 1IK8A 2X8BB 3BT2U 2NBTA 2MUPA 2JQPA 4EY8B 3NEQA 1LJZA 1TFSA 2MUOA 2MJ4A 1CTXA 4LFTA 4ZQYA 1CHVS 2H62D 1CDRA 1LX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDG A;  2H8U A;  1IQ9 A;  1KBT A;  1NEA A;  4BDT B;  5DZ5 A;  3ERA A;  1CCQ A;  1TXA A;  3LAQ U;  1IDI A;  1HOY A;  2LCR A;  2BHI A;  4RUD A;  1QM7 A;  1BTE A;  1KL8 A;  1LXG A;  3FEV A;  2H64 B;  3U73 U;  1MR6 A;  1NYS A;  2K3G A;  2MHY A;  1RGJ A;  1L4W A;  4XJJ A;  1IKC A;  1VB0 A;  1COE A;  2HLR A;  1CRE A;  1BXP A;  1IDL A;  1MAH F;  1V6P A;  1CDT A;  2CRS A;  1NYU A;  1F94 A;  1CRF A;  3KFD E;  2HLQ A;  4UY2 C;  1FF4 A;  3U74 U;  4BIK B;  1KS6 A;  4HQP F;  3EVS C;  1ABT A;  1YWH A;  2CRT A;  2H7Z B;  1I02 A;  5EBX A;  5IMT D;  1S4Y A;  2QJB C;  2QC1 A;  4FAO E;  1JBD A;  1CVO A;  3HH7 A;  1HC9 B;  2MFA A;  1ES7 B;  1NTX A;  4FAO C;  1CDS A;  2CTX A;  4OM4 A;  1ERA A;  2GOO B;  2GOO C;  1CB9 A;  1ONJ A;  1KBS A;  1HC9 A;  2ABX A;  2BTX A;  1JE9 A;  4OM5 A;  3NH7 A;  1NXB A;  1G6M A;  2UX2 A;  5DU1 A;  3NDS A;  3VTS A;  1KFH A;  1KXI A;  2PJY B;  1KBA A;  1JGK A;  1ZAD A;  2L03 A;  2N99 A;  1NTN A;  1IJC A;  2H64 C;  2L5S A;  4P7U A;  3EBX A;  1CDQ A;  1XT3 A;  1QKD A;  1W6B A;  1UG4 A;  4QTI U;  1FRA A;  5DO6 A;  1LXH A;  1KC4 A;  2JVE A;  1FSC A;  1HAJ A;  2VLW A;  3PLC A;  1FSS B;  2MJ0 A;  2QJ9 C;  1COD A;  2H62 C;  2MJY A;  2PJY C;  3BT1 U;  4IYE A;  2LA1 A;  2CCX A;  3QB4 B;  1CXO A;  1REW C;  2CDX A;  2J8B A;  1TXB A;  1RL5 A;  2UWR A;  2ERA A;  2OFS A;  1TGX A;  3KFD I;  1KU6 B;  4DO8 A;  1M9Z A;  1FFJ A;  1ERG A;  1KTZ B;  1NOR A;  2H7Z A;  1IDH A;  1DRS A;  1H0J A;  1FAS A;  1HAA A;  4AEA A;  1CXN A;  1PLO A;  2FD6 U;  2I9B E;  1LSI A;  5IMY C;  6EBX A;  1QKE A;  2QJA C;  2H5F A;  1F8U B;  1B41 B;  1IK8 A;  2X8B B;  3BT2 U;  2NBT A;  2MUP A;  2JQP A;  4EY8 B;  3NEQ A;  1LJZ A;  1TFS A;  2MUO A;  2MJ4 A;  1CTX A;  4LFT A;  4ZQY A;  1CHV S;  2H62 D;  1CDR A;  1LX5 B; 
#chains in the Genus database with same CATH topology
 1IDG A;  2H8U A;  1IQ9 A;  1KBT A;  1NEA A;  4BDT B;  5DZ5 A;  3ERA A;  1CCQ A;  1TXA A;  3LAQ U;  1IDI A;  1HOY A;  2LCR A;  2BHI A;  4RUD A;  1QM7 A;  1BTE A;  1KL8 A;  1LXG A;  3FEV A;  2H64 B;  3U73 U;  1MR6 A;  1NYS A;  2K3G A;  2MHY A;  1RGJ A;  1L4W A;  4XJJ A;  1IKC A;  1VB0 A;  1COE A;  2HLR A;  1CRE A;  1BXP A;  1IDL A;  1MAH F;  1V6P A;  1CDT A;  2CRS A;  1NYU A;  1F94 A;  1CRF A;  3KFD E;  2HLQ A;  4UY2 C;  1FF4 A;  3U74 U;  4BIK B;  1KS6 A;  4HQP F;  3EVS C;  1ABT A;  1YWH A;  2CRT A;  2H7Z B;  1I02 A;  5EBX A;  5IMT D;  1S4Y A;  2QJB C;  2QC1 A;  4FAO E;  1JBD A;  1CVO A;  3HH7 A;  1HC9 B;  2MFA A;  1ES7 B;  1NTX A;  4FAO C;  1CDS A;  2CTX A;  4OM4 A;  1ERA A;  2GOO B;  2GOO C;  1CB9 A;  1ONJ A;  1KBS A;  1HC9 A;  2ABX A;  2BTX A;  1JE9 A;  4OM5 A;  3NH7 A;  4KSN A;  1NXB A;  1G6M A;  2UX2 A;  5DU1 A;  3NDS A;  3VTS A;  1KFH A;  1KXI A;  2PJY B;  1KBA A;  1JGK A;  1ZAD A;  2L03 A;  2N99 A;  1NTN A;  1IJC A;  2H64 C;  2L5S A;  4P7U A;  3EBX A;  1CDQ A;  1XT3 A;  1QKD A;  1W6B A;  1UG4 A;  4QTI U;  1FRA A;  5DO6 A;  1LXH A;  1KC4 A;  2JVE A;  1FSC A;  1HAJ A;  2VLW A;  3PLC A;  1FSS B;  2MJ0 A;  2QJ9 C;  1COD A;  2H62 C;  2MJY A;  2PJY C;  3BT1 U;  4IYE A;  2LA1 A;  2CCX A;  3QB4 B;  1CXO A;  1REW C;  2CDX A;  2J8B A;  1TXB A;  1RL5 A;  2UWR A;  2ERA A;  2OFS A;  1TGX A;  3KFD I;  1KU6 B;  4DO8 A;  1M9Z A;  1FFJ A;  1ERG A;  1KTZ B;  1NOR A;  2H7Z A;  1IDH A;  1DRS A;  1H0J A;  1FAS A;  1HAA A;  4AEA A;  1CXN A;  1PLO A;  2FD6 U;  2I9B E;  1LSI A;  5IMY C;  6EBX A;  1QKE A;  2QJA C;  2H5F A;  1F8U B;  1B41 B;  1IK8 A;  2X8B B;  3BT2 U;  2NBT A;  2MUP A;  2JQP A;  4EY8 B;  3NEQ A;  1LJZ A;  1TFS A;  2MUO A;  2MJ4 A;  1CTX A;  4LFT A;  4ZQY A;  1CHV S;  2H62 D;  1CDR A;  1LX5 B; 
#chains in the Genus database with same CATH homology
 1IDG A;  2H8U A;  1IQ9 A;  1KBT A;  1NEA A;  4BDT B;  5DZ5 A;  3ERA A;  1CCQ A;  1TXA A;  3LAQ U;  1IDI A;  1HOY A;  2LCR A;  2BHI A;  4RUD A;  1QM7 A;  1BTE A;  1KL8 A;  1LXG A;  3FEV A;  2H64 B;  3U73 U;  1MR6 A;  1NYS A;  2K3G A;  2MHY A;  1RGJ A;  1L4W A;  4XJJ A;  1IKC A;  1VB0 A;  1COE A;  2HLR A;  1CRE A;  1BXP A;  1IDL A;  1MAH F;  1V6P A;  1CDT A;  2CRS A;  1NYU A;  1F94 A;  1CRF A;  3KFD E;  2HLQ A;  4UY2 C;  1FF4 A;  3U74 U;  4BIK B;  1KS6 A;  4HQP F;  3EVS C;  1ABT A;  1YWH A;  2CRT A;  2H7Z B;  1I02 A;  5EBX A;  5IMT D;  1S4Y A;  2QJB C;  2QC1 A;  4FAO E;  1JBD A;  1CVO A;  3HH7 A;  1HC9 B;  2MFA A;  1ES7 B;  1NTX A;  4FAO C;  1CDS A;  2CTX A;  4OM4 A;  1ERA A;  2GOO B;  2GOO C;  1CB9 A;  1ONJ A;  1KBS A;  1HC9 A;  2ABX A;  2BTX A;  1JE9 A;  4OM5 A;  3NH7 A;  4KSN A;  1NXB A;  1G6M A;  2UX2 A;  5DU1 A;  3NDS A;  3VTS A;  1KFH A;  1KXI A;  2PJY B;  1KBA A;  1JGK A;  1ZAD A;  2L03 A;  2N99 A;  1NTN A;  1IJC A;  2H64 C;  2L5S A;  4P7U A;  3EBX A;  1CDQ A;  1XT3 A;  1QKD A;  1W6B A;  1UG4 A;  4QTI U;  1FRA A;  5DO6 A;  1LXH A;  1KC4 A;  2JVE A;  1FSC A;  1HAJ A;  2VLW A;  3PLC A;  1FSS B;  2MJ0 A;  2QJ9 C;  1COD A;  2H62 C;  2MJY A;  2PJY C;  3BT1 U;  4IYE A;  2LA1 A;  2CCX A;  3QB4 B;  1CXO A;  1REW C;  2CDX A;  2J8B A;  1TXB A;  1RL5 A;  2UWR A;  2ERA A;  2OFS A;  1TGX A;  3KFD I;  1KU6 B;  4DO8 A;  1M9Z A;  1FFJ A;  1ERG A;  1KTZ B;  1NOR A;  2H7Z A;  1IDH A;  1DRS A;  1H0J A;  1FAS A;  1HAA A;  4AEA A;  1CXN A;  1PLO A;  2FD6 U;  2I9B E;  1LSI A;  5IMY C;  6EBX A;  1QKE A;  2QJA C;  2H5F A;  1F8U B;  1B41 B;  1IK8 A;  2X8B B;  3BT2 U;  2NBT A;  2MUP A;  2JQP A;  4EY8 B;  3NEQ A;  1LJZ A;  1TFS A;  2MUO A;  2MJ4 A;  1CTX A;  4LFT A;  4ZQY A;  1CHV S;  2H62 D;  1CDR A;  1LX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...