2MJYA

Solution structure of synthetic mamba-1 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mambalgin-1
publication title One-pot hydrazide-based native chemical ligation for efficient chemical synthesis and structure determination of toxin Mambalgin-1
pubmed doi rcsb
molecule tags Toxin
total genus 8
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mjyA00
1M9ZA 3HH7A 4EY8B 1KBAA 2CDXA 3LAQU 1IK8A 2OFSA 2J8BA 1LJZA 2QJBC 3EVSC 1TFSA 1QKDA 2JVEA 3FEVA 1V6PA 2MJ0A 1F94A 2H8UA 1KBSA 4LFTA 2N99A 2BTXA 3KFDI 4HQPF 1QM7A 1DRSA 1REWC 1LX5B 4P7UA 1PLOA 1RGJA 1CDTA 1BTEA 2MJ4A 4OM5A 1VB0A 1HC9B 4XJJA 1CDSA 2QC1A 1TXBA 1NTXA 1CREA 1I02A 4BIKB 1KC4A 3U73U 1IDGA 1CB9A 1B41B 5DZ5A 2UWRA 2UX2A 1ONJA 1CTXA 1FASA 1IDIA 2GOOC 1ES7B 2X8BB 3ERAA 1TGXA 2GOOB 3VTSA 1YWHA 2LA1A 2H7ZB 1CCQA 1CDQA 1XT3A 2QJ9C 1RL5A 3KFDE 3QB4B 5DO6A 1MAHF 2CTXA 1KU6B 3NH7A 5DU1A 1L4WA 1NEAA 4RUDA 2QJAC 2L03A 1MR6A 1HAJA 4DO8A 3NDSA 2CRTA 3BT2U 4FAOC 1COEA 2HLRA 1HOYA 1IDHA 5EBXA 2NBTA 1BXPA 2L5SA 1JGKA 2LCRA 2H7ZA 6EBXA 1ABTA 4IYEA 2ERAA 3U74U 1ERAA 2PJYC 2CCXA 2H64C 1CRFA 2PJYB 1FF4A 2H62D 2K3GA 1CVOA 5IMTD 2H5FA 1UG4A 1HC9A 1S4YA 3BT1U 1JE9A 4QTIU 1IJCA 1NYSA 1NYUA 2HLQA 2FD6U 3PLCA 1KBTA 1CODA 1HAAA 1NTNA 5IMYC 1KTZB 1NORA 1FSSB 2JQPA 1CXOA 4ZQYA 1JBDA 1IKCA 4OM4A 1QKEA 1LXGA 1CDRA 1CHVS 1LXHA 1NXBA 2VLWA 1TXAA 2BHIA 4BDTB 2MUOA 1FRAA 1LSIA 1KXIA 2ABXA 4FAOE 1IDLA 1W6BA 1ZADA 1IQ9A 3EBXA 2MHYA 1ERGA 1G6MA 2MJYA 3NEQA 2H64B 4AEAA 2I9BE 2MUPA 1KL8A 1F8UB 4UY2C 1KFHA 1H0JA 1CXNA 2CRSA 1FFJA 1KS6A 2H62C 1FSCA 2MFAA
chains in the Genus database with same CATH superfamily
1M9ZA 3HH7A 4EY8B 1KBAA 2CDXA 3LAQU 1IK8A 2OFSA 2J8BA 1LJZA 2QJBC 3EVSC 1TFSA 1QKDA 2JVEA 3FEVA 1V6PA 2MJ0A 1F94A 2H8UA 1KBSA 4LFTA 2N99A 2BTXA 3KFDI 4HQPF 1QM7A 1DRSA 1REWC 1LX5B 4P7UA 1PLOA 1RGJA 1CDTA 1BTEA 2MJ4A 4OM5A 1VB0A 1HC9B 4XJJA 1CDSA 2QC1A 1TXBA 1NTXA 1CREA 1I02A 4BIKB 1KC4A 3U73U 1IDGA 1CB9A 1B41B 5DZ5A 2UWRA 2UX2A 1ONJA 1CTXA 1FASA 1IDIA 2GOOC 1ES7B 2X8BB 3ERAA 1TGXA 2GOOB 3VTSA 1YWHA 2LA1A 2H7ZB 1CCQA 1CDQA 1XT3A 2QJ9C 1RL5A 3KFDE 3QB4B 5DO6A 1MAHF 2CTXA 1KU6B 3NH7A 5DU1A 1L4WA 1NEAA 4RUDA 2QJAC 2L03A 1MR6A 1HAJA 4DO8A 3NDSA 2CRTA 3BT2U 4FAOC 1COEA 2HLRA 1HOYA 1IDHA 5EBXA 2NBTA 1BXPA 2L5SA 1JGKA 2LCRA 2H7ZA 6EBXA 1ABTA 4IYEA 2ERAA 3U74U 1ERAA 2PJYC 2CCXA 2H64C 1CRFA 2PJYB 1FF4A 2H62D 2K3GA 1CVOA 5IMTD 2H5FA 1UG4A 1HC9A 1S4YA 3BT1U 1JE9A 4QTIU 1IJCA 1NYSA 1NYUA 2HLQA 2FD6U 3PLCA 1KBTA 1CODA 1HAAA 1NTNA 5IMYC 1KTZB 1NORA 1FSSB 2JQPA 1CXOA 4ZQYA 1JBDA 1IKCA 4OM4A 1QKEA 1LXGA 1CDRA 4KSNA 1CHVS 1LXHA 1NXBA 2VLWA 1TXAA 2BHIA 4BDTB 2MUOA 1FRAA 1LSIA 1KXIA 2ABXA 4FAOE 1IDLA 1W6BA 1ZADA 1IQ9A 3EBXA 2MHYA 1ERGA 1G6MA 2MJYA 3NEQA 2H64B 4AEAA 2I9BE 2MUPA 1KL8A 1F8UB 4UY2C 1KFHA 1H0JA 1CXNA 2CRSA 1FFJA 1KS6A 2H62C 1FSCA 2MFAA
chains in the Genus database with same CATH topology
1M9ZA 3HH7A 4EY8B 1KBAA 2CDXA 3LAQU 1IK8A 2OFSA 2J8BA 1LJZA 2QJBC 3EVSC 1TFSA 1QKDA 2JVEA 3FEVA 1V6PA 2MJ0A 1F94A 2H8UA 1KBSA 4LFTA 2N99A 2BTXA 3KFDI 4HQPF 1QM7A 1DRSA 1REWC 1LX5B 4P7UA 1PLOA 1RGJA 1CDTA 1BTEA 2MJ4A 4OM5A 1VB0A 1HC9B 4XJJA 1CDSA 2QC1A 1TXBA 1NTXA 1CREA 1I02A 4BIKB 1KC4A 3U73U 1IDGA 1CB9A 1B41B 5DZ5A 2UWRA 2UX2A 1ONJA 1CTXA 1FASA 1IDIA 2GOOC 1ES7B 2X8BB 3ERAA 1TGXA 2GOOB 3VTSA 1YWHA 2LA1A 2H7ZB 1CCQA 1CDQA 1XT3A 2QJ9C 1RL5A 3KFDE 3QB4B 5DO6A 1MAHF 2CTXA 1KU6B 3NH7A 5DU1A 1L4WA 1NEAA 4RUDA 2QJAC 2L03A 1MR6A 1HAJA 4DO8A 3NDSA 2CRTA 3BT2U 4FAOC 1COEA 2HLRA 1HOYA 1IDHA 5EBXA 2NBTA 1BXPA 2L5SA 1JGKA 2LCRA 2H7ZA 6EBXA 1ABTA 4IYEA 2ERAA 3U74U 1ERAA 2PJYC 2CCXA 2H64C 1CRFA 2PJYB 1FF4A 2H62D 2K3GA 1CVOA 5IMTD 2H5FA 1UG4A 1HC9A 1S4YA 3BT1U 1JE9A 4QTIU 1IJCA 1NYSA 1NYUA 2HLQA 2FD6U 3PLCA 1KBTA 1CODA 1HAAA 1NTNA 5IMYC 1KTZB 1NORA 1FSSB 2JQPA 1CXOA 4ZQYA 1JBDA 1IKCA 4OM4A 1QKEA 1LXGA 1CDRA 4KSNA 1CHVS 1LXHA 1NXBA 2VLWA 1TXAA 2BHIA 4BDTB 2MUOA 1FRAA 1LSIA 1KXIA 2ABXA 4FAOE 1IDLA 1W6BA 1ZADA 1IQ9A 3EBXA 2MHYA 1ERGA 1G6MA 2MJYA 3NEQA 2H64B 4AEAA 2I9BE 2MUPA 1KL8A 1F8UB 4UY2C 1KFHA 1H0JA 1CXNA 2CRSA 1FFJA 1KS6A 2H62C 1FSCA 2MFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9Z A;  3HH7 A;  4EY8 B;  1KBA A;  2CDX A;  3LAQ U;  1IK8 A;  2OFS A;  2J8B A;  1LJZ A;  2QJB C;  3EVS C;  1TFS A;  1QKD A;  2JVE A;  3FEV A;  1V6P A;  2MJ0 A;  1F94 A;  2H8U A;  1KBS A;  4LFT A;  2N99 A;  2BTX A;  3KFD I;  4HQP F;  1QM7 A;  1DRS A;  1REW C;  1LX5 B;  4P7U A;  1PLO A;  1RGJ A;  1CDT A;  1BTE A;  2MJ4 A;  4OM5 A;  1VB0 A;  1HC9 B;  4XJJ A;  1CDS A;  2QC1 A;  1TXB A;  1NTX A;  1CRE A;  1I02 A;  4BIK B;  1KC4 A;  3U73 U;  1IDG A;  1CB9 A;  1B41 B;  5DZ5 A;  2UWR A;  2UX2 A;  1ONJ A;  1CTX A;  1FAS A;  1IDI A;  2GOO C;  1ES7 B;  2X8B B;  3ERA A;  1TGX A;  2GOO B;  3VTS A;  1YWH A;  2LA1 A;  2H7Z B;  1CCQ A;  1CDQ A;  1XT3 A;  2QJ9 C;  1RL5 A;  3KFD E;  3QB4 B;  5DO6 A;  1MAH F;  2CTX A;  1KU6 B;  3NH7 A;  5DU1 A;  1L4W A;  1NEA A;  4RUD A;  2QJA C;  2L03 A;  1MR6 A;  1HAJ A;  4DO8 A;  3NDS A;  2CRT A;  3BT2 U;  4FAO C;  1COE A;  2HLR A;  1HOY A;  1IDH A;  5EBX A;  2NBT A;  1BXP A;  2L5S A;  1JGK A;  2LCR A;  2H7Z A;  6EBX A;  1ABT A;  4IYE A;  2ERA A;  3U74 U;  1ERA A;  2PJY C;  2CCX A;  2H64 C;  1CRF A;  2PJY B;  1FF4 A;  2H62 D;  2K3G A;  1CVO A;  5IMT D;  2H5F A;  1UG4 A;  1HC9 A;  1S4Y A;  3BT1 U;  1JE9 A;  4QTI U;  1IJC A;  1NYS A;  1NYU A;  2HLQ A;  2FD6 U;  3PLC A;  1KBT A;  1COD A;  1HAA A;  1NTN A;  5IMY C;  1KTZ B;  1NOR A;  1FSS B;  2JQP A;  1CXO A;  4ZQY A;  1JBD A;  1IKC A;  4OM4 A;  1QKE A;  1LXG A;  1CDR A;  1CHV S;  1LXH A;  1NXB A;  2VLW A;  1TXA A;  2BHI A;  4BDT B;  2MUO A;  1FRA A;  1LSI A;  1KXI A;  2ABX A;  4FAO E;  1IDL A;  1W6B A;  1ZAD A;  1IQ9 A;  3EBX A;  2MHY A;  1ERG A;  1G6M A;  2MJY A;  3NEQ A;  2H64 B;  4AEA A;  2I9B E;  2MUP A;  1KL8 A;  1F8U B;  4UY2 C;  1KFH A;  1H0J A;  1CXN A;  2CRS A;  1FFJ A;  1KS6 A;  2H62 C;  1FSC A;  2MFA A; 
#chains in the Genus database with same CATH topology
 1M9Z A;  3HH7 A;  4EY8 B;  1KBA A;  2CDX A;  3LAQ U;  1IK8 A;  2OFS A;  2J8B A;  1LJZ A;  2QJB C;  3EVS C;  1TFS A;  1QKD A;  2JVE A;  3FEV A;  1V6P A;  2MJ0 A;  1F94 A;  2H8U A;  1KBS A;  4LFT A;  2N99 A;  2BTX A;  3KFD I;  4HQP F;  1QM7 A;  1DRS A;  1REW C;  1LX5 B;  4P7U A;  1PLO A;  1RGJ A;  1CDT A;  1BTE A;  2MJ4 A;  4OM5 A;  1VB0 A;  1HC9 B;  4XJJ A;  1CDS A;  2QC1 A;  1TXB A;  1NTX A;  1CRE A;  1I02 A;  4BIK B;  1KC4 A;  3U73 U;  1IDG A;  1CB9 A;  1B41 B;  5DZ5 A;  2UWR A;  2UX2 A;  1ONJ A;  1CTX A;  1FAS A;  1IDI A;  2GOO C;  1ES7 B;  2X8B B;  3ERA A;  1TGX A;  2GOO B;  3VTS A;  1YWH A;  2LA1 A;  2H7Z B;  1CCQ A;  1CDQ A;  1XT3 A;  2QJ9 C;  1RL5 A;  3KFD E;  3QB4 B;  5DO6 A;  1MAH F;  2CTX A;  1KU6 B;  3NH7 A;  5DU1 A;  1L4W A;  1NEA A;  4RUD A;  2QJA C;  2L03 A;  1MR6 A;  1HAJ A;  4DO8 A;  3NDS A;  2CRT A;  3BT2 U;  4FAO C;  1COE A;  2HLR A;  1HOY A;  1IDH A;  5EBX A;  2NBT A;  1BXP A;  2L5S A;  1JGK A;  2LCR A;  2H7Z A;  6EBX A;  1ABT A;  4IYE A;  2ERA A;  3U74 U;  1ERA A;  2PJY C;  2CCX A;  2H64 C;  1CRF A;  2PJY B;  1FF4 A;  2H62 D;  2K3G A;  1CVO A;  5IMT D;  2H5F A;  1UG4 A;  1HC9 A;  1S4Y A;  3BT1 U;  1JE9 A;  4QTI U;  1IJC A;  1NYS A;  1NYU A;  2HLQ A;  2FD6 U;  3PLC A;  1KBT A;  1COD A;  1HAA A;  1NTN A;  5IMY C;  1KTZ B;  1NOR A;  1FSS B;  2JQP A;  1CXO A;  4ZQY A;  1JBD A;  1IKC A;  4OM4 A;  1QKE A;  1LXG A;  1CDR A;  4KSN A;  1CHV S;  1LXH A;  1NXB A;  2VLW A;  1TXA A;  2BHI A;  4BDT B;  2MUO A;  1FRA A;  1LSI A;  1KXI A;  2ABX A;  4FAO E;  1IDL A;  1W6B A;  1ZAD A;  1IQ9 A;  3EBX A;  2MHY A;  1ERG A;  1G6M A;  2MJY A;  3NEQ A;  2H64 B;  4AEA A;  2I9B E;  2MUP A;  1KL8 A;  1F8U B;  4UY2 C;  1KFH A;  1H0J A;  1CXN A;  2CRS A;  1FFJ A;  1KS6 A;  2H62 C;  1FSC A;  2MFA A; 
#chains in the Genus database with same CATH homology
 1M9Z A;  3HH7 A;  4EY8 B;  1KBA A;  2CDX A;  3LAQ U;  1IK8 A;  2OFS A;  2J8B A;  1LJZ A;  2QJB C;  3EVS C;  1TFS A;  1QKD A;  2JVE A;  3FEV A;  1V6P A;  2MJ0 A;  1F94 A;  2H8U A;  1KBS A;  4LFT A;  2N99 A;  2BTX A;  3KFD I;  4HQP F;  1QM7 A;  1DRS A;  1REW C;  1LX5 B;  4P7U A;  1PLO A;  1RGJ A;  1CDT A;  1BTE A;  2MJ4 A;  4OM5 A;  1VB0 A;  1HC9 B;  4XJJ A;  1CDS A;  2QC1 A;  1TXB A;  1NTX A;  1CRE A;  1I02 A;  4BIK B;  1KC4 A;  3U73 U;  1IDG A;  1CB9 A;  1B41 B;  5DZ5 A;  2UWR A;  2UX2 A;  1ONJ A;  1CTX A;  1FAS A;  1IDI A;  2GOO C;  1ES7 B;  2X8B B;  3ERA A;  1TGX A;  2GOO B;  3VTS A;  1YWH A;  2LA1 A;  2H7Z B;  1CCQ A;  1CDQ A;  1XT3 A;  2QJ9 C;  1RL5 A;  3KFD E;  3QB4 B;  5DO6 A;  1MAH F;  2CTX A;  1KU6 B;  3NH7 A;  5DU1 A;  1L4W A;  1NEA A;  4RUD A;  2QJA C;  2L03 A;  1MR6 A;  1HAJ A;  4DO8 A;  3NDS A;  2CRT A;  3BT2 U;  4FAO C;  1COE A;  2HLR A;  1HOY A;  1IDH A;  5EBX A;  2NBT A;  1BXP A;  2L5S A;  1JGK A;  2LCR A;  2H7Z A;  6EBX A;  1ABT A;  4IYE A;  2ERA A;  3U74 U;  1ERA A;  2PJY C;  2CCX A;  2H64 C;  1CRF A;  2PJY B;  1FF4 A;  2H62 D;  2K3G A;  1CVO A;  5IMT D;  2H5F A;  1UG4 A;  1HC9 A;  1S4Y A;  3BT1 U;  1JE9 A;  4QTI U;  1IJC A;  1NYS A;  1NYU A;  2HLQ A;  2FD6 U;  3PLC A;  1KBT A;  1COD A;  1HAA A;  1NTN A;  5IMY C;  1KTZ B;  1NOR A;  1FSS B;  2JQP A;  1CXO A;  4ZQY A;  1JBD A;  1IKC A;  4OM4 A;  1QKE A;  1LXG A;  1CDR A;  4KSN A;  1CHV S;  1LXH A;  1NXB A;  2VLW A;  1TXA A;  2BHI A;  4BDT B;  2MUO A;  1FRA A;  1LSI A;  1KXI A;  2ABX A;  4FAO E;  1IDL A;  1W6B A;  1ZAD A;  1IQ9 A;  3EBX A;  2MHY A;  1ERG A;  1G6M A;  2MJY A;  3NEQ A;  2H64 B;  4AEA A;  2I9B E;  2MUP A;  1KL8 A;  1F8U B;  4UY2 C;  1KFH A;  1H0J A;  1CXN A;  2CRS A;  1FFJ A;  1KS6 A;  2H62 C;  1FSC A;  2MFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...