2MJZA

Capsid model of m13 bacteriophage virus from magic-angle spinning nmr and rosetta modeling
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein G8P
publication title The NMR-Rosetta capsid model of M13 bacteriophage reveals a quadrupled hydrophobic packing epitope.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2mjzA00
2CPSA 2MJZA 1IFIA 1IFDA 1FDMA 1HH0A 1NH4A 1HGZA 2C0WA 1HGVA 2C0XA 1IFJA 2CPBA
chains in the Genus database with same CATH superfamily
1FOSE 1QVGO 3L72G 1HGZA 2Y0CA 1ZRTE 2Q3IA 1GZLA 1XTCC 1KB9E 1TU3F 1YQ3C 3H6PA 1KB9H 1SQQK 4YTPC 2YIUC 3E1IA 2QE7H 1S9KE 3JCUE 1NWQA 1EDJA 1JB0J 2GA1A 3A7OA 2A45H 2QG4A 1KQLA 3JCUH 3H32B 3P8CD 2QSIA 1SQXD 3S4RA 5AVYB 2B88A 3MUDA 3RK2B 2Q6QA 1OIPA 2O01J 1MFTA 3LIEA 2XDJA 1RH5B 5APYA 3H1KD 2JWDA 4C46A 3RL0D 1OZHA 1FZGA 2BEZF 4Y99B 2M8RA 1EXIA 1SLQA 3EFGA 3HD7C 1SQQE 2YO3A 3H32A 2P1JA 1HJBA 3BRTB 1NO4A 3BCCJ 1L0NK 1ZN5A 3H1HE 4OH8B 3LIDA 2O1JA 2KYVA 3E1RA 1SFCC 3Q5PA 1LTSC 1PIXA 4OWFA 4R4LA 2FFDC 1OW7A 2KOGA 4C7NB 3CC4P 3NTNA 2I8DA 3Q3DA 1P84D 5APWA 5APVA 5KJ7A 1J1EB 2PAJA 1GW4A 2R3SA 1M1KQ 3W67A 3AEFC 4DJGA 1RF0A 4K3AA 3ZDMA 1HBWA 2AEJA 1SS1A 4H0LB 3VYIA 1ZP0C 4ZKPA 3D71A 1M56D 3H1KG 1L0NE 1ZRTD 3RK3B 1J1DB 1KB9D 1ZLLA 1KILE 3D6YA 1M1JC 2KNCB 2ZVOB 2QA4P 1QEXA 2QJYB 1DIPA 3G4SP 4Y28J 1DH3A 4NPEA 1S9KD 2AEFA 1QGKB 3CWBG 2OYIB 1EDKA 2OTJP 1VQ8P 5CCGC 3VOPA 4L76A 3EFFK 2QJPB 2YXQB 4AQRD 2XV5A 3M9QA 1LT1A 5CCHA 2HPCB 4L73A 1PP9G 1LWUC 1RE3C 4NPFX 2KNCA 2J58A 1RE4C 3MTUE 4WY4B 5DJTB 2UWJE 1EZVD 2WITA 1YTZI 3NFQA 3H1IG 1NTZK 1PPJE 3GW6A 4CPGA 1X79B 1RF1C 1SQQD 1URQB 4KJMA 4KT0J 4YXDC 3NXSA 4HH2A 1VF5D 2QEXP 1N7LA 3H1HD 2NPSC 1LT9C 4PV1C 3CMEP 3O8ZA 2HPCA 1CZQA 1NAYA 1SQQJ 3AE9C 2WT7B 2WSSH 3CCUP 2WPRA 2N1TB 2FYNB 4WY4A 4AYCA 1P84I 3H1HJ 4D6TD 2H43A 2YKQA 3B5NC 1GU5A 3N7NA 1T6AA 1URQA 4D6TJ 2QIWA 2M3BA 1NTZE 1CSBA 4DOJA 2WSEH 2E74B 1JY3O 3Q1MA 4H13C 1KB9I 1K04A 4DZOA 3H1JE 3I56P 2N1TA 4QMAA 1L0ND 1EZVG 3G71P 1Y47A 2W8ZA 3TK1A 3AEGC 3AE1C 3M0DC 3CXHE 1KILD 3RL0g 2E75C 1DD3A 1NU1D 2JDIH 1AV1A 1JO5A 2ZXEB 1LJ2A 3L72E 3ABVC 1L0NJ 2IZ0A 3HD7A 3B8EB 3I5CA 1FBMA 1SVFA 4ASVA 2KK7A 2L5GB 2P10A 2IYPA 1ZR2A 3HE4B 4EOTA 1PGQA 1FZCC 2XZRA 1SFCA 1VPCA 2BCCG 2R3CA 2ZT9C 2D2CD 2IFMA 3OJAB 1EZVI 4IFFA 3AE8C 1IZNB 4A7PA 2YMKA 2CPBA 5KLVG 1ZMEC 2WWWA 3FXEA 1IFMA 3CCSP 1JY2P 3A5TA 2K37A 4H44B 4HJGH 3VMYA 1PPJD 5APTA 4JPZB 3HE4A 2C0WA 1GTWA 1SQXK 1MUUA 4IFDK 2AXTE 3AE4C 1JMBA 5GTHE 1NHLA 1NVOA 5GTHH 1NU1G 1YI2P 2Z5HA 5APUA 1M1JA 4DT0A 3R4YA 2P7JA 5KKZB 5L8RJ 3SWKA 1T2KD 3RL0C 2JJLA 4GODA 3FGAD 3UIAA 4IOIH 2N9BA 1LT9B 4JBZA 1N7SD 1SQXE 4YXWH 3PH0A 1RE3A 2JEEA 3H1JD 2O01H 1HTLC 2KI7B 4RJTA 1GL2D 1NTZJ 2A06G 3MZWB 2Y9ZA 3HUSB 3CXHD 5TISH 3CCLP 3CC7P 1NGMB 3H1JJ 3H1KE 3L72D 1RF1A 1MFZA 2KZJA 1FJKA 1BGYD 3L72J 3RGUA 2XKMA 1LT9A 3FWLA 4LC1A 1G1IA 2JKVA 1R8EA 1BE3G 2FYUG 3CWBE 4H13B 5APQA 1FU1A 4ASWA 3HUSA 1IK7A 3HTKB 3B5NA 4HYTB 1VQ5P 3FWNA 1Q2NA 4R4MA 3WMM0 2FY8A 2B87A 3AE3C 1VQKP 1PP9E 1P84E 5DJUB 1EXJA 3AE7C 3V2PA 3V4QA 1P84H 4WB4A 1WMKA 3L74G 4DCKA 3H1IE 1KTMA 1AVYA 1MKMA 2E76B 1Q82Q 4I7ZB 2M0BA 1KYOE 1Y9BA 3AE5C 1N73C 3HTKA 2W90A 4U3FG 1AFOA 2FXPA 3M0DA 2K1AA 2WZ7A 3L71D 2WQYC 1YHQP 3L73G 2OYHB 3EQ2A 1NKZB 1Q86Q 1BGYG 1DX7A 3H25A 1N8RQ 1S4XA 3RK3E 4YPCA 1FZCA 2FXMA 5KLIC 5BVZA 1ZW0A 1W5CE 2NRGA 1T8ZA 5CMZA 1VF5C 1SP4A 1QX8A 3L36A 3CXHI 3CX5D 1G2CA 1KZUB 2CK3H 2OYHA 1SQXJ 5KLVK 1U7MA 2MJZA 1EZVE 1EQ7A 1G1JA 4N78E 3CCRP 3G6EP 3RK2D 3HRNA 5AVSB 2OQQA 2W6AA 1HF9A 3H1KJ 3C1LA 3TNUA 3E7KA 3CWBD 3L71G 2H8PD 1K73Q 4W7ZA 3BRVB 1OVVA 5B5EE 2IZ1A 1FC2C 2QJKC 3CI9A 1NU1K 2BCCE 5B5EH 3CWBJ 1NYHA 4D6TE 2W6BA 4OGQB 2QVAA 1KILC 1PP9D 3WUVA 1LTIC 2K3RA 1IFJA 5KLVE 2WMMA 1R5SA 4I1LA 2ZXXA 2IFNA 5AW0B 1S5LE 1PP9J 1YYCA 1S5LH 3H1ID 3BATA 1YJWP 1KYOD 4I6MC 2D2CC 3IAOA 1JTHB 2LR2A 3PJSK 3H1IJ 2V4HA 2RH0A 2R44A 1JY3N 1K8AQ 4K35A 1NU1E 5KAFE 4H0LD 3OAKA 1X8YA 2LXBA 1CW5A 1OXZA 1EDIA 3FX0A 1L4AB 1VQNP 2POHA 2CPSA 3RK3D 3L70D 3PRJA 3CX5I 3C8VA 1FDIA 4BWNA 2O3JA 4IL6E 1JTHA 2FYUK 1USDA 1PL5A 1RQUA 1GMJA 1VDFA 1VQ9P 5AW7B 1FZEA 1EC5A 2A06E 2Q1KA 2XU6A 2OTLP 2YIUB 1T2KC 1L4AA 1U7JA 4N78D 1LTBC 3G9RA 2NZ2A 3L75G 1NTMD 3HE5B 2HYNA 3S1KA 2ZJSE 3GHGC 4WY4D 1LTAC 5AVVB 1NTKG 1GU4A 2QM8A 5GTIE 2YNYA 1N7SC 4RESB 2IDBA 5EFWB 5K5GB 5GTIH 1URQD 1BE3E 3CCEP 2FKWB 1GL2C 2FYUE 2BCCD 4PD4E 1KMIZ 1ZR4A 2ITAA 3L70G 4XE5B 1NH4A 1SQBG 3BASA 5KLVD 3HE5A 2WTYA 2BCCJ 2C9LY 2LXCB 3CPWO 2E43A 2N1TD 2GUVA 1FDOA 3HD7B 1KYOI 3VP8A 2RKLA 2KZIA 2A45G 4L74A 2L91A 5KLVJ 1IJDB 1UIXA 1W2BO 3SSUA 1PZQA 1LTJC 2HR3A 1SFCB 3L74E 4W7YA 2QJKB 1AJYA 2C0XA 1GW3A 2FFDB 2E74D 3W68A 1NTMG 2IBZD 4U3FE 1GDTA 3TGUG 1VL2A 2KB7P 2JO1A 1BCCD 1CI6A 1Q90D 3CXHH 1XTGB 3L73E 5AW2B 1BSNA 1BGYE 1NU1J 2KS1B 4C7RA 2ZAEB 2G8YA 5CBNA 3KZIE 1A02J 3V4WA 4Z1MH 2FFDA 3KZIH 4GDOA 4JQ0D 1VQ6P 1KILA 2E5TA 1M1JB 2A06D 2Q7CA 2P67A 1IFIA 1SQVG 4RO0A 3A3YB 2KS1A 1OW6A 2V7QJ 4H44D 2WPSA 1H0TB 3JSVC 4JYBA 3MHVA 2AEMA 2AXTH 2IBZG 1PGPA 1LWUB 1BE3D 2FYUD 1BCCG 2OARA 2PRRA 3L71E 5AW1B 3SFDC 4EI2A 4PD4D 1KFMA 2ZVNB 2W6JH 1BE3J 2FYUJ 1LTGC 5CCGA 5AVXB 3RK2C 1VQMP 1RF1B 1X22A 3GHGB 4BXLA 2I1KA 2BEQD 1L0LD 2Q9IA 1N86A 3OW2O 1H0TA 5H2FE 1Y8AA 3CLQA 2NPSB 4PV1B 3V5BA 1LWUA 5AW3B 3L74D 3GLMA 3CX5E 1FDMA 1RE4A 3L37A 3SWFA 3CX5H 3CCVP 4B86A 4EIJA 3B5NB 4U3FD 3L74J 1RQVA 1RF0C 2B87B 3L73D 1YTZT 3GHGA 2B89A 2Z4EA 3KXDA 1X9VA 1VQ7P 3AEAC 4U3FJ 3RBZA 2NPSA 3L73J 1NTKK 1JCCA 1PGOA 3V2NA 1SQPD 2FXOA 1BGYJ 3G3ZA 5CJ0A 1GD2E 4ZMDA 1J1EC 3II6A 1FZFA 5KTBA 3F5HA 3VMXA 2E75B 1OW8A 1H89A 1DEEG 1QL1A 4H13D 2N9YB 1L0LG 4H0LC 1SQBK 4GOEA 1M90Q 3RK3C 1J1DC 2YO2A 1LTJA 3L75E 5TJHA 1VQPP 1FZCB 3AE6C 1KV4A 2WSFJ 2ZT9B 2QJYC 2C9NY 4PD4I 4OVNF 1NTKE 3SWYA 3TYYA 1KYOH 2OYIC 1G2CB 2KLVA 2OTKE 2E76D 3EWKA 1YIJP 3A0HE 2QJPC 1NTMK 1PGJA 3H1LG 1ZXGA 5AW8B 3A0HH 3L71J 1LTTC 4RKUJ 4XA4A 1OVRA 2JWAA 1R5LA 1FAVA 1HJ0A 2HFED 1HGVA 2ZYAA 2MKVA 3L70E 3V2RA 1SQPG 1SQBE 1Z56A 1A02F 2LKMA 4WY4C 4LLHA 3O6QB 1MZ9A 2ZYDA 1E79H 5AW5B 3CCQP 3TNUB 4BRYB 2IPPA 1IK9A 2HLOA 1DD4A 1FS0E 2FBWC 4I2LC 1JY2O 1URQC 3U1CA 1W2EA 3OA7A 5AW4B 2WSCH 3WUTA 5M1BA 2XNXA 3RL0B 2B9BA 2ZFCA 1JY3P 1NTME 1OWAA 1BSHA 3TGUE 1SQVK 2OYOA 2N1TC 2FYNC 3B4SA 3O6QA 2E42A 2P58A 3ITKA 2KP8A 2WPVB 1YITP 4BRYA 1U57A 3BCCD 1E5WA 5KJ7D 3N4XA 1S3JA 5CBOA 3D70A 2PP6A 2E5YA 2E74C 4TLFA 1S1CX 1LNQA 3L4FA 4GOFA 4OGQD 1IC2A 2ZYGA 3L75D 4UB6E 1SQVE 3L35A 4UB6H 1VQ4P 1NKNA 3JC22 1UIIA 3QWOC 1NTKD 1KQGB 1X0TA 2AXCA 1SQXG 3MGNA 3M9HA 3L75J 4MN4C 3IF4A 1OVUA 3M0AA 2IBZE 3PHLA 4HB1A 1NTKJ 2QRXA 1BCCE 1JCDA 4KHXA 1KQSO 5KAFH 5CCHD 2KLUA 1SQBD 4C7NA 1N2DC 1QL2A 3BCCG 1S72P 1Q7YQ 3NMDA 3IN6A 1JM0A 3KDPB 3M91A 4H44C 1IFNA 1N73B 1AQTA 3WUUA 1J2JB 1L4AD 3GF7A 4IL6H 4N6JA 3L70J 1SQBJ 1QVFO 1HH0A 2FYZA 1K9MQ 1LGHB 2H89C 3P8MC 5CJ4A 2RMZA 1FJPA 2K88A 2KSJA 3TSIA 2BASA 2R32A 1JMMA 2PGDA 5AVTB 2WSCJ 3CD6P 1L0LK 2G3AA 1L2PA 2Y0DA 4M3LA 3TGUD 2W27A 3V6IA 2V7QH 1AVOA 5B66E 5KLIB 1VQOP 3VMZA 1HUCA 1S5LX 1PV3A 2IYOA 3LW5H 4NPDA 5AW9B 5KKZC 1N73A 5B66H 2KSEA 1OFCX 1VF5B 1NTMJ 4WWIA 3TGUJ 2OYIA 1YBKA 5AVUB 1H8AA 2Q5UA 1M7LA 2YXRB 2JR8A 3QH9A 4EDFA 1DEBA 1KD1Q 1AQ5A 2QM7A 4PD4H 3VN0A 1ZV8A 3Q5RA 3TF5A 1CI6B 3Q2YA 3VTPC 2H88C 3HUSC 3IFMA 3VP9A 1L0LE 1BDDA 3U59A 1SQPK 1SQVD 1NOHA 1M8OB 3IR9A 4IL6X 3HD7D 1VQLP 2I1JA 1SQVJ 2Y0EA 3BVHA 5BU5A 3PP5A 3KYQA 1KILB 3KHUA 2WT7A 1SFCD 5APSA 1QLED 4U7JA 4EYYQ 3A2AA 4GIFA 2OGUA 5AVZB 2HODB 3H1LE 2A45I 4O9BA 3AE2C 1BCCJ 5C39A 1JNMA 2KIKA 1SQQG 5CHXA 4N3YB 3FXDA 3F89A 4AUWA 2D2CB 4WBAA 2WPQA 1SQPE 3PLNA 4GT1A 3H1HG 1K05A 3D6ZA 1D7MA 2E76C 3CCJP 3USSA 4I7ZC 4ZKUA 4PJ0E 3RBXA 4D6TG 2HODA 4PJ0H 1YJ9P 3MUDC 2WSFH 2PFXA 3MD0A 1KORA 5AVRB 4GKGA 3S9OA 2OYHC 1PFIA 3LW5J 2YKOA 1H88A 1KFNA 4XFJA 2Q3EA 2H7HA 3M06A 5CCGD 1IFDA 3CMAP 4LGDE 1T3UA 3T97B 1JEKA 1YJNP 2XNDH 2K9YA 3MP7B 2O1KA 2R5BA 1GK4A 4W80A 1FZAA 1L0NG 3K5BA 3GG2A 5E79E 4JF7A 3AEBC 1KQFB 5E79H 1Q81Q 1T3JA 1KN7A 3P32A 1BDCA 3Q5SA 1FOSF 1IO4A 1NJIQ 1USEA 1ZOYC 2JP3A 2R5DA 2WVRA 1LP1B 3PTZA 1N7SB 2GUSA 5H2FH 3CCMP 2IBZI 1S2EA 4ZNCA 1YQ4C 1L0LJ 3T97A 5BU8B 4Y99C 1GL2B 2Y9YA 3B71A 3V2QA 1NTZD 5KJ7C 2DW3A 5AVWB 2NPSD 3GF3A 4PV1D 1HVVA 3P8CE 2SPZA 2WSEJ 3TDKA 3AECC 1JY2N 2P2UA 2RN0A 3SFEC 2K9JB 5TISE 5KAIE 1RHZB 2M5AB 2VRSA 3H1LD 3B5ND 3C9IA 1LP1A 1MV8A 1NAFA 4WVZA 1PPJG 5KAIH 1N7SA 1RY3A 4OGQC 2Z5IA 3KQGA 1WRGA 3A0BE 1LTJB 2GM4A 2J5UA 2KXPB 1GL2A 4L75A 3H1LJ 3BCCE 3R2PA 3A0BH 1IFPA 1KC8Q 1GK6A 3WU2E 1JOCA 5AVQB 3WU2H 1FZBA 3CC2P 1SQPJ 2M3EA 5AW6B 3MIWA 4TT3H 1HWTC 2K9JA 4UB8E 2M5AA 4IFMA 5APXA 3VMAA 3I55P 3AEEC 3U1AA 3GMAA 2W83C 4UB8H 5CCHC 2E75D 4HKZH 1JUNA 2YKPA 1WT6A 3KPEA 1FE6A 2J59M 1AA0A 1NTZG 1OMIA 2KUBA 1OX3A 2IX7C 3CL3D 2O01N 3AEDC 1L4AC 2HG5D 1M57D 3M9BA 1EDLA 3H1JG 2YMYA 3P7KA 2ZT9D 4JYCA
chains in the Genus database with same CATH topology
3M9HA 1T2KD 1FOSE 3RL0C 1IJDB 1HGZA 2JJLA 3UIAA 3M0AA 2Q3IA 1LTJC 1GZLA 1XTCC 1SFCB 4W7YA 1JCDA 2N9BA 4KHXA 2C0XA 1GW3A 3H6PA 2FFDB 1SQQK 1LT9B 1N7SD 3E1IA 5CCHD 1S9KE 1NWQA 1GDTA 1RE3A 2JEEA 4C7NA 2O01H 1N2DC 1QL2A 1HTLC 2KB7P 3NMDA 1CI6A 3A7OA 2A45H 1GL2D 1XTGB 3KDPB 1KQLA 3HUSB 3M91A 3H32B 1IFNA 5AW2B 1N73B 3P8CD 1J2JB 1L4AD 4N6JA 4C7RA 1HH0A 5AVYB 2FYZA 3MUDA 3RK2B 1LGHB 1RF1A 3P8MC 5CJ4A 1FJPA 2KSJA 3LIEA 1MFZA 2XDJA 1A02J 3V4WA 1FJKA 3TSIA 2BASA 2R32A 1JMMA 2FFDA 5APYA 5AVTB 2XKMA 4C46A 1LT9A 3RL0D 1L0LK 4LC1A 1FZGA 1KILA 1G1IA 4M3LA 2W27A 1M1JB 5APQA 4Y99B 2M8RA 1SLQA 1FU1A 3VMZA 1HUCA 3EFGA 3HD7C 3HUSA 3LW5H 2YO3A 3H32A 2Q7CA 5AW9B 1N73A 3HTKB 2P1JA 2P67A 1IFIA 3B5NA 4HYTB 1HJBA 3BRTB 3A3YB 2OYIA 1NO4A 3WMM0 1L0NK 1ZN5A 5AVUB 4OH8B 3LIDA 2O1JA 2KYVA 1H8AA 1SFCC 2Q5UA 1LTSC 1M7LA 2WPSA 4JYBA 2FFDC 1DEBA 2KOGA 3V2PA 3V4QA 1AQ5A 2QM7A 3VN0A 4WB4A 1LWUB 1ZV8A 4C7NB 2OARA 3NTNA 1CI6B 3VTPC 5AW1B 5APWA 5APVA 5KJ7A 3HUSC 3IFMA 1KFMA 3VP9A 1J1EB 2PAJA 1N73C 1GW4A 3HTKA 3U59A 1SQPK 1AFOA 3M0DA 1NOHA 2WZ7A 1RF0A 1LTGC 5CCGA 5AVXB 3RK2C 1RF1B 1HBWA 3GHGB 3IR9A 2I1KA 3HD7D 3VYIA 2Q9IA 4ZKPA 2OYHB 1N86A 3EQ2A 1NKZB 2I1JA 1DX7A 3BVHA 3CLQA 5BU5A 2NPSB 3PP5A 3KYQA 1KILB 3V5BA 1LWUA 3RK3B 1J1DB 5AW3B 2WT7A 1ZLLA 1M1JC 1FZCA 1FDMA 1SFCD 2FXMA 1RE4A 5BVZA 3L37A 3SWFA 5APSA 3A2AA 1DH3A 4GIFA 4B86A 1T8ZA 4EIJA 3B5NB 5CMZA 5AVZB 2HODB 1SP4A 1S9KD 2A45I 3L36A 4O9BA 2OYIB 1JNMA 1G2CA 1RF0C 5CCGC 3VOPA 1YTZT 3GHGA 5CHXA 4N3YB 1KZUB 4AUWA 4AQRD 4WBAA 2Z4EA 2WPQA 2OYHA 5KLVK 1X9VA 2XV5A 3M9QA 2MJZA 4GT1A 2NPSA 1EQ7A 1G1JA 5CCHA 2HPCB 1NTKK 4N78E 1LWUC 1RE3C 1JCCA 3RK2D 3HRNA 5AVSB 3V2NA 2J58A 2W6AA 1RE4C 3MTUE 4WY4B 3G3ZA 5CJ0A 4ZKUA 1GD2E 1J1EC 2WITA 3TNUA 2HODA 3II6A 1FZFA 1YTZI 3NFQA 5KTBA 1NTZK 3VMXA 1H89A 2H8PD 1QL1A 2WSFH 1X79B 4W7ZA 1RF1C 3BRVB 3MD0A 1URQB 4GKGA 5AVRB 3CI9A 3NXSA 2OYHC 1NU1K 1SQBK 1PFIA 4HH2A 2YKOA 1H88A 1N7LA 2W6BA 1KFNA 1LT9C 2NPSC 3O8ZA 2HPCA 1CZQA 2H7HA 1KILC 3M06A 3RK3C 1J1DC 2YO2A 1LTIC 1LTJA 1IFDA 5CCGD 2WT7B 4LGDE 1T3UA 1IFJA 1FZCB 2WPRA 2N1TB 2O1KA 2R5BA 1GK4A 4I1LA 4WY4A 4W80A 2C9NY 1FZAA 4AYCA 2IFNA 5AW0B 2H43A 2YKQA 3B5NC 4JF7A 3SWYA 3TYYA 1YYCA 1GU5A 2OYIC 3BATA 1T3JA 1G2CB 2KLVA 3N7NA 3P32A 1URQA 1FOSF 1IO4A 4I6MC 1NTMK 2R5DA 1JTHB 2M3BA 5AW8B 1CSBA 1LTTC 4XA4A 4DOJA 2WSEH 1N7SB 1JY3N 1FAVA 2GUSA 2HFED 1JY3O 1HGVA 3T97A 5BU8B 4DZOA 3V2RA 4Y99C 1GL2B 1Z56A 1A02F 2N1TA 2LKMA 1X8YA 3OAKA 4WY4C 3V2QA 4LLHA 5KJ7C 1MZ9A 1CW5A 1OXZA 5AW5B 3TNUB 1L4AB 5AVWB 3TK1A 2NPSD 1HVVA 3P8CE 3M0DC 2IPPA 2POHA 1KILD 1IK9A 2CPSA 3RK3D 1JO5A 2ZXEB 2HLOA 1JY2N 2P2UA 4I2LC 1JY2O 1URQC 3U1CA 1W2EA 3OA7A 3HD7A 3B8EB 5AW4B 3I5CA 2WSCH 1JTHA 2FYUK 2VRSA 1FBMA 1SVFA 3B5ND 3C9IA 1MV8A 1NAFA 2XNXA 2L5GB 3RL0B 1N7SA 1RY3A 2Z5IA 3KQGA 1ZR2A 1WRGA 2ZFCA 1VDFA 3HE4B 1JY3P 1LTJB 4EOTA 1OWAA 2GM4A 1GL2A 1FZCC 2XZRA 5AW7B 1SFCA 1SQVK 1VPCA 2R3CA 1FZEA 2N1TC 3R2PA 2IFMA 3OJAB 2E42A 1GK6A 2XU6A 2KP8A 4IFFA 1L4AA 1T2KC 4N78D 1LTBC 1JOCA 5AVQB 2CPBA 1FZBA 3HE5B 2HYNA 2WWWA 5AW6B 3MIWA 1IFMA 3GHGC 1HWTC 4WY4D 1JY2P 1E5WA 1LTAC 5AVVB 5KJ7D 3A5TA 1GU4A 3N4XA 4IFMA 5APXA 3VMYA 3U1AA 2QM8A 2PP6A 2YNYA 5APTA 1N7SC 4RESB 5CCHC 1JUNA 3HE4A 2YKPA 2C0WA 1WT6A 1GTWA 3KPEA 1SQXK 1URQD 1MUUA 2FKWB 1GL2C 4IFDK 2J59M 1ZR4A 3L4FA 2IX7C 3CL3D 1NHLA 1L4AC 2HG5D 1IC2A 3M9BA 1NH4A 4XE5B 3BASA 2YMYA 3HE5A 2WTYA 2Z5HA 5APUA 1M1JA 3P7KA 3L35A 2C9LY 2E43A 2N1TD 2GUVA 1NKNA 3HD7B 4JYCA 2P7JA 3VP8A 2A45G 3MGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPS A;  2MJZ A;  1IFI A;  1IFD A;  1FDM A;  1HH0 A;  1NH4 A;  1HGZ A;  2C0W A;  1HGV A;  2C0X A;  1IFJ A;  2CPB A; 
#chains in the Genus database with same CATH topology
 1FOS E;  1QVG O;  3L72 G;  1HGZ A;  2Y0C A;  1ZRT E;  2Q3I A;  1GZL A;  1XTC C;  1KB9 E;  1TU3 F;  1YQ3 C;  3H6P A;  1KB9 H;  1SQQ K;  4YTP C;  2YIU C;  3E1I A;  2QE7 H;  1S9K E;  3JCU E;  1NWQ A;  1EDJ A;  1JB0 J;  2GA1 A;  3A7O A;  2A45 H;  2QG4 A;  1KQL A;  3JCU H;  3H32 B;  3P8C D;  2QSI A;  1SQX D;  3S4R A;  5AVY B;  2B88 A;  3MUD A;  3RK2 B;  2Q6Q A;  1OIP A;  2O01 J;  1MFT A;  3LIE A;  2XDJ A;  1RH5 B;  5APY A;  3H1K D;  2JWD A;  4C46 A;  3RL0 D;  1OZH A;  1FZG A;  2BEZ F;  4Y99 B;  2M8R A;  1EXI A;  1SLQ A;  3EFG A;  3HD7 C;  1SQQ E;  2YO3 A;  3H32 A;  2P1J A;  1HJB A;  3BRT B;  1NO4 A;  3BCC J;  1L0N K;  1ZN5 A;  3H1H E;  4OH8 B;  3LID A;  2O1J A;  2KYV A;  3E1R A;  1SFC C;  3Q5P A;  1LTS C;  1PIX A;  4OWF A;  4R4L A;  2FFD C;  1OW7 A;  2KOG A;  4C7N B;  3CC4 P;  3NTN A;  2I8D A;  3Q3D A;  1P84 D;  5APW A;  5APV A;  5KJ7 A;  1J1E B;  2PAJ A;  1GW4 A;  2R3S A;  1M1K Q;  3W67 A;  3AEF C;  4DJG A;  1RF0 A;  4K3A A;  3ZDM A;  1HBW A;  2AEJ A;  1SS1 A;  4H0L B;  3VYI A;  1ZP0 C;  4ZKP A;  3D71 A;  1M56 D;  3H1K G;  1L0N E;  1ZRT D;  3RK3 B;  1J1D B;  1KB9 D;  1ZLL A;  1KIL E;  3D6Y A;  1M1J C;  2KNC B;  2ZVO B;  2QA4 P;  1QEX A;  2QJY B;  1DIP A;  3G4S P;  4Y28 J;  1DH3 A;  4NPE A;  1S9K D;  2AEF A;  1QGK B;  3CWB G;  2OYI B;  1EDK A;  2OTJ P;  1VQ8 P;  5CCG C;  3VOP A;  4L76 A;  3EFF K;  2QJP B;  2YXQ B;  4AQR D;  2XV5 A;  3M9Q A;  1LT1 A;  5CCH A;  2HPC B;  4L73 A;  1PP9 G;  1LWU C;  1RE3 C;  4NPF X;  2KNC A;  2J58 A;  1RE4 C;  3MTU E;  4WY4 B;  5DJT B;  2UWJ E;  1EZV D;  2WIT A;  1YTZ I;  3NFQ A;  3H1I G;  1NTZ K;  1PPJ E;  3GW6 A;  4CPG A;  1X79 B;  1RF1 C;  1SQQ D;  1URQ B;  4KJM A;  4KT0 J;  4YXD C;  3NXS A;  4HH2 A;  1VF5 D;  2QEX P;  1N7L A;  3H1H D;  2NPS C;  1LT9 C;  4PV1 C;  3CME P;  3O8Z A;  2HPC A;  1CZQ A;  1NAY A;  1SQQ J;  3AE9 C;  2WT7 B;  2WSS H;  3CCU P;  2WPR A;  2N1T B;  2FYN B;  4WY4 A;  4AYC A;  1P84 I;  3H1H J;  4D6T D;  2H43 A;  2YKQ A;  3B5N C;  1GU5 A;  3N7N A;  1T6A A;  1URQ A;  4D6T J;  2QIW A;  2M3B A;  1NTZ E;  1CSB A;  4DOJ A;  2WSE H;  2E74 B;  1JY3 O;  3Q1M A;  4H13 C;  1KB9 I;  1K04 A;  4DZO A;  3H1J E;  3I56 P;  2N1T A;  4QMA A;  1L0N D;  1EZV G;  3G71 P;  1Y47 A;  2W8Z A;  3TK1 A;  3AEG C;  3AE1 C;  3M0D C;  3CXH E;  1KIL D;  3RL0 g;  2E75 C;  1DD3 A;  1NU1 D;  2JDI H;  1AV1 A;  1JO5 A;  2ZXE B;  1LJ2 A;  3L72 E;  3ABV C;  1L0N J;  2IZ0 A;  3HD7 A;  3B8E B;  3I5C A;  1FBM A;  1SVF A;  4ASV A;  2KK7 A;  2L5G B;  2P10 A;  2IYP A;  1ZR2 A;  3HE4 B;  4EOT A;  1PGQ A;  1FZC C;  2XZR A;  1SFC A;  1VPC A;  2BCC G;  2R3C A;  2ZT9 C;  2D2C D;  2IFM A;  3OJA B;  1EZV I;  4IFF A;  3AE8 C;  1IZN B;  4A7P A;  2YMK A;  2CPB A;  5KLV G;  1ZME C;  2WWW A;  3FXE A;  1IFM A;  3CCS P;  1JY2 P;  3A5T A;  2K37 A;  4H44 B;  4HJG H;  3VMY A;  1PPJ D;  5APT A;  4JPZ B;  3HE4 A;  2C0W A;  1GTW A;  1SQX K;  1MUU A;  4IFD K;  2AXT E;  3AE4 C;  1JMB A;  5GTH E;  1NHL A;  1NVO A;  5GTH H;  1NU1 G;  1YI2 P;  2Z5H A;  5APU A;  1M1J A;  4DT0 A;  3R4Y A;  2P7J A;  5KKZ B;  5L8R J;  3SWK A;  1T2K D;  3RL0 C;  2JJL A;  4GOD A;  3FGA D;  3UIA A;  4IOI H;  2N9B A;  1LT9 B;  4JBZ A;  1N7S D;  1SQX E;  4YXW H;  3PH0 A;  1RE3 A;  2JEE A;  3H1J D;  2O01 H;  1HTL C;  2KI7 B;  4RJT A;  1GL2 D;  1NTZ J;  2A06 G;  3MZW B;  2Y9Z A;  3HUS B;  3CXH D;  5TIS H;  3CCL P;  3CC7 P;  1NGM B;  3H1J J;  3H1K E;  3L72 D;  1RF1 A;  1MFZ A;  2KZJ A;  1FJK A;  1BGY D;  3L72 J;  3RGU A;  2XKM A;  1LT9 A;  3FWL A;  4LC1 A;  1G1I A;  2JKV A;  1R8E A;  1BE3 G;  2FYU G;  3CWB E;  4H13 B;  5APQ A;  1FU1 A;  4ASW A;  3HUS A;  1IK7 A;  3HTK B;  3B5N A;  4HYT B;  1VQ5 P;  3FWN A;  1Q2N A;  4R4M A;  3WMM 0;  2FY8 A;  2B87 A;  3AE3 C;  1VQK P;  1PP9 E;  1P84 E;  5DJU B;  1EXJ A;  3AE7 C;  3V2P A;  3V4Q A;  1P84 H;  4WB4 A;  1WMK A;  3L74 G;  4DCK A;  3H1I E;  1KTM A;  1AVY A;  1MKM A;  2E76 B;  1Q82 Q;  4I7Z B;  2M0B A;  1KYO E;  1Y9B A;  3AE5 C;  1N73 C;  3HTK A;  2W90 A;  4U3F G;  1AFO A;  2FXP A;  3M0D A;  2K1A A;  2WZ7 A;  3L71 D;  2WQY C;  1YHQ P;  3L73 G;  2OYH B;  3EQ2 A;  1NKZ B;  1Q86 Q;  1BGY G;  1DX7 A;  3H25 A;  1N8R Q;  1S4X A;  3RK3 E;  4YPC A;  1FZC A;  2FXM A;  5KLI C;  5BVZ A;  1ZW0 A;  1W5C E;  2NRG A;  1T8Z A;  5CMZ A;  1VF5 C;  1SP4 A;  1QX8 A;  3L36 A;  3CXH I;  3CX5 D;  1G2C A;  1KZU B;  2CK3 H;  2OYH A;  1SQX J;  5KLV K;  1U7M A;  2MJZ A;  1EZV E;  1EQ7 A;  1G1J A;  4N78 E;  3CCR P;  3G6E P;  3RK2 D;  3HRN A;  5AVS B;  2OQQ A;  2W6A A;  1HF9 A;  3H1K J;  3C1L A;  3TNU A;  3E7K A;  3CWB D;  3L71 G;  2H8P D;  1K73 Q;  4W7Z A;  3BRV B;  1OVV A;  5B5E E;  2IZ1 A;  1FC2 C;  2QJK C;  3CI9 A;  1NU1 K;  2BCC E;  5B5E H;  3CWB J;  1NYH A;  4D6T E;  2W6B A;  4OGQ B;  2QVA A;  1KIL C;  1PP9 D;  3WUV A;  1LTI C;  2K3R A;  1IFJ A;  5KLV E;  2WMM A;  1R5S A;  4I1L A;  2ZXX A;  2IFN A;  5AW0 B;  1S5L E;  1PP9 J;  1YYC A;  1S5L H;  3H1I D;  3BAT A;  1YJW P;  1KYO D;  4I6M C;  2D2C C;  3IAO A;  1JTH B;  2LR2 A;  3PJS K;  3H1I J;  2V4H A;  2RH0 A;  2R44 A;  1JY3 N;  1K8A Q;  4K35 A;  1NU1 E;  5KAF E;  4H0L D;  3OAK A;  1X8Y A;  2LXB A;  1CW5 A;  1OXZ A;  1EDI A;  3FX0 A;  1L4A B;  1VQN P;  2POH A;  2CPS A;  3RK3 D;  3L70 D;  3PRJ A;  3CX5 I;  3C8V A;  1FDI A;  4BWN A;  2O3J A;  4IL6 E;  1JTH A;  2FYU K;  1USD A;  1PL5 A;  1RQU A;  1GMJ A;  1VDF A;  1VQ9 P;  5AW7 B;  1FZE A;  1EC5 A;  2A06 E;  2Q1K A;  2XU6 A;  2OTL P;  2YIU B;  1T2K C;  1L4A A;  1U7J A;  4N78 D;  1LTB C;  3G9R A;  2NZ2 A;  3L75 G;  1NTM D;  3HE5 B;  2HYN A;  3S1K A;  2ZJS E;  3GHG C;  4WY4 D;  1LTA C;  5AVV B;  1NTK G;  1GU4 A;  2QM8 A;  5GTI E;  2YNY A;  1N7S C;  4RES B;  2IDB A;  5EFW B;  5K5G B;  5GTI H;  1URQ D;  1BE3 E;  3CCE P;  2FKW B;  1GL2 C;  2FYU E;  2BCC D;  4PD4 E;  1KMI Z;  1ZR4 A;  2ITA A;  3L70 G;  4XE5 B;  1NH4 A;  1SQB G;  3BAS A;  5KLV D;  3HE5 A;  2WTY A;  2BCC J;  2C9L Y;  2LXC B;  3CPW O;  2E43 A;  2N1T D;  2GUV A;  1FDO A;  3HD7 B;  1KYO I;  3VP8 A;  2RKL A;  2KZI A;  2A45 G;  4L74 A;  2L91 A;  5KLV J;  1IJD B;  1UIX A;  1W2B O;  3SSU A;  1PZQ A;  1LTJ C;  2HR3 A;  1SFC B;  3L74 E;  4W7Y A;  2QJK B;  1AJY A;  2C0X A;  1GW3 A;  2FFD B;  2E74 D;  3W68 A;  1NTM G;  2IBZ D;  4U3F E;  1GDT A;  3TGU G;  1VL2 A;  2KB7 P;  2JO1 A;  1BCC D;  1CI6 A;  1Q90 D;  3CXH H;  1XTG B;  3L73 E;  5AW2 B;  1BSN A;  1BGY E;  1NU1 J;  2KS1 B;  4C7R A;  2ZAE B;  2G8Y A;  5CBN A;  3KZI E;  1A02 J;  3V4W A;  4Z1M H;  2FFD A;  3KZI H;  4GDO A;  4JQ0 D;  1VQ6 P;  1KIL A;  2E5T A;  1M1J B;  2A06 D;  2Q7C A;  2P67 A;  1IFI A;  1SQV G;  4RO0 A;  3A3Y B;  2KS1 A;  1OW6 A;  2V7Q J;  4H44 D;  2WPS A;  1H0T B;  3JSV C;  4JYB A;  3MHV A;  2AEM A;  2AXT H;  2IBZ G;  1PGP A;  1LWU B;  1BE3 D;  2FYU D;  1BCC G;  2OAR A;  2PRR A;  3L71 E;  5AW1 B;  3SFD C;  4EI2 A;  4PD4 D;  1KFM A;  2ZVN B;  2W6J H;  1BE3 J;  2FYU J;  1LTG C;  5CCG A;  5AVX B;  3RK2 C;  1VQM P;  1RF1 B;  1X22 A;  3GHG B;  4BXL A;  2I1K A;  2BEQ D;  1L0L D;  2Q9I A;  1N86 A;  3OW2 O;  1H0T A;  5H2F E;  1Y8A A;  3CLQ A;  2NPS B;  4PV1 B;  3V5B A;  1LWU A;  5AW3 B;  3L74 D;  3GLM A;  3CX5 E;  1FDM A;  1RE4 A;  3L37 A;  3SWF A;  3CX5 H;  3CCV P;  4B86 A;  4EIJ A;  3B5N B;  4U3F D;  3L74 J;  1RQV A;  1RF0 C;  2B87 B;  3L73 D;  1YTZ T;  3GHG A;  2B89 A;  2Z4E A;  3KXD A;  1X9V A;  1VQ7 P;  3AEA C;  4U3F J;  3RBZ A;  2NPS A;  3L73 J;  1NTK K;  1JCC A;  1PGO A;  3V2N A;  1SQP D;  2FXO A;  1BGY J;  3G3Z A;  5CJ0 A;  1GD2 E;  4ZMD A;  1J1E C;  3II6 A;  1FZF A;  5KTB A;  3F5H A;  3VMX A;  2E75 B;  1OW8 A;  1H89 A;  1DEE G;  1QL1 A;  4H13 D;  2N9Y B;  1L0L G;  4H0L C;  1SQB K;  4GOE A;  1M90 Q;  3RK3 C;  1J1D C;  2YO2 A;  1LTJ A;  3L75 E;  5TJH A;  1VQP P;  1FZC B;  3AE6 C;  1KV4 A;  2WSF J;  2ZT9 B;  2QJY C;  2C9N Y;  4PD4 I;  4OVN F;  1NTK E;  3SWY A;  3TYY A;  1KYO H;  2OYI C;  1G2C B;  2KLV A;  2OTK E;  2E76 D;  3EWK A;  1YIJ P;  3A0H E;  2QJP C;  1NTM K;  1PGJ A;  3H1L G;  1ZXG A;  5AW8 B;  3A0H H;  3L71 J;  1LTT C;  4RKU J;  4XA4 A;  1OVR A;  2JWA A;  1R5L A;  1FAV A;  1HJ0 A;  2HFE D;  1HGV A;  2ZYA A;  2MKV A;  3L70 E;  3V2R A;  1SQP G;  1SQB E;  1Z56 A;  1A02 F;  2LKM A;  4WY4 C;  4LLH A;  3O6Q B;  1MZ9 A;  2ZYD A;  1E79 H;  5AW5 B;  3CCQ P;  3TNU B;  4BRY B;  2IPP A;  1IK9 A;  2HLO A;  1DD4 A;  1FS0 E;  2FBW C;  4I2L C;  1JY2 O;  1URQ C;  3U1C A;  1W2E A;  3OA7 A;  5AW4 B;  2WSC H;  3WUT A;  5M1B A;  2XNX A;  3RL0 B;  2B9B A;  2ZFC A;  1JY3 P;  1NTM E;  1OWA A;  1BSH A;  3TGU E;  1SQV K;  2OYO A;  2N1T C;  2FYN C;  3B4S A;  3O6Q A;  2E42 A;  2P58 A;  3ITK A;  2KP8 A;  2WPV B;  1YIT P;  4BRY A;  1U57 A;  3BCC D;  1E5W A;  5KJ7 D;  3N4X A;  1S3J A;  5CBO A;  3D70 A;  2PP6 A;  2E5Y A;  2E74 C;  4TLF A;  1S1C X;  1LNQ A;  3L4F A;  4GOF A;  4OGQ D;  1IC2 A;  2ZYG A;  3L75 D;  4UB6 E;  1SQV E;  3L35 A;  4UB6 H;  1VQ4 P;  1NKN A;  3JC2 2;  1UII A;  3QWO C;  1NTK D;  1KQG B;  1X0T A;  2AXC A;  1SQX G;  3MGN A;  3M9H A;  3L75 J;  4MN4 C;  3IF4 A;  1OVU A;  3M0A A;  2IBZ E;  3PHL A;  4HB1 A;  1NTK J;  2QRX A;  1BCC E;  1JCD A;  4KHX A;  1KQS O;  5KAF H;  5CCH D;  2KLU A;  1SQB D;  4C7N A;  1N2D C;  1QL2 A;  3BCC G;  1S72 P;  1Q7Y Q;  3NMD A;  3IN6 A;  1JM0 A;  3KDP B;  3M91 A;  4H44 C;  1IFN A;  1N73 B;  1AQT A;  3WUU A;  1J2J B;  1L4A D;  3GF7 A;  4IL6 H;  4N6J A;  3L70 J;  1SQB J;  1QVF O;  1HH0 A;  2FYZ A;  1K9M Q;  1LGH B;  2H89 C;  3P8M C;  5CJ4 A;  2RMZ A;  1FJP A;  2K88 A;  2KSJ A;  3TSI A;  2BAS A;  2R32 A;  1JMM A;  2PGD A;  5AVT B;  2WSC J;  3CD6 P;  1L0L K;  2G3A A;  1L2P A;  2Y0D A;  4M3L A;  3TGU D;  2W27 A;  3V6I A;  2V7Q H;  1AVO A;  5B66 E;  5KLI B;  1VQO P;  3VMZ A;  1HUC A;  1S5L X;  1PV3 A;  2IYO A;  3LW5 H;  4NPD A;  5AW9 B;  5KKZ C;  1N73 A;  5B66 H;  2KSE A;  1OFC X;  1VF5 B;  1NTM J;  4WWI A;  3TGU J;  2OYI A;  1YBK A;  5AVU B;  1H8A A;  2Q5U A;  1M7L A;  2YXR B;  2JR8 A;  3QH9 A;  4EDF A;  1DEB A;  1KD1 Q;  1AQ5 A;  2QM7 A;  4PD4 H;  3VN0 A;  1ZV8 A;  3Q5R A;  3TF5 A;  1CI6 B;  3Q2Y A;  3VTP C;  2H88 C;  3HUS C;  3IFM A;  3VP9 A;  1L0L E;  1BDD A;  3U59 A;  1SQP K;  1SQV D;  1NOH A;  1M8O B;  3IR9 A;  4IL6 X;  3HD7 D;  1VQL P;  2I1J A;  1SQV J;  2Y0E A;  3BVH A;  5BU5 A;  3PP5 A;  3KYQ A;  1KIL B;  3KHU A;  2WT7 A;  1SFC D;  5APS A;  1QLE D;  4U7J A;  4EYY Q;  3A2A A;  4GIF A;  2OGU A;  5AVZ B;  2HOD B;  3H1L E;  2A45 I;  4O9B A;  3AE2 C;  1BCC J;  5C39 A;  1JNM A;  2KIK A;  1SQQ G;  5CHX A;  4N3Y B;  3FXD A;  3F89 A;  4AUW A;  2D2C B;  4WBA A;  2WPQ A;  1SQP E;  3PLN A;  4GT1 A;  3H1H G;  1K05 A;  3D6Z A;  1D7M A;  2E76 C;  3CCJ P;  3USS A;  4I7Z C;  4ZKU A;  4PJ0 E;  3RBX A;  4D6T G;  2HOD A;  4PJ0 H;  1YJ9 P;  3MUD C;  2WSF H;  2PFX A;  3MD0 A;  1KOR A;  5AVR B;  4GKG A;  3S9O A;  2OYH C;  1PFI A;  3LW5 J;  2YKO A;  1H88 A;  1KFN A;  4XFJ A;  2Q3E A;  2H7H A;  3M06 A;  5CCG D;  1IFD A;  3CMA P;  4LGD E;  1T3U A;  3T97 B;  1JEK A;  1YJN P;  2XND H;  2K9Y A;  3MP7 B;  2O1K A;  2R5B A;  1GK4 A;  4W80 A;  1FZA A;  1L0N G;  3K5B A;  3GG2 A;  5E79 E;  4JF7 A;  3AEB C;  1KQF B;  5E79 H;  1Q81 Q;  1T3J A;  1KN7 A;  3P32 A;  1BDC A;  3Q5S A;  1FOS F;  1IO4 A;  1NJI Q;  1USE A;  1ZOY C;  2JP3 A;  2R5D A;  2WVR A;  1LP1 B;  3PTZ A;  1N7S B;  2GUS A;  5H2F H;  3CCM P;  2IBZ I;  1S2E A;  4ZNC A;  1YQ4 C;  1L0L J;  3T97 A;  5BU8 B;  4Y99 C;  1GL2 B;  2Y9Y A;  3B71 A;  3V2Q A;  1NTZ D;  5KJ7 C;  2DW3 A;  5AVW B;  2NPS D;  3GF3 A;  4PV1 D;  1HVV A;  3P8C E;  2SPZ A;  2WSE J;  3TDK A;  3AEC C;  1JY2 N;  2P2U A;  2RN0 A;  3SFE C;  2K9J B;  5TIS E;  5KAI E;  1RHZ B;  2M5A B;  2VRS A;  3H1L D;  3B5N D;  3C9I A;  1LP1 A;  1MV8 A;  1NAF A;  4WVZ A;  1PPJ G;  5KAI H;  1N7S A;  1RY3 A;  4OGQ C;  2Z5I A;  3KQG A;  1WRG A;  3A0B E;  1LTJ B;  2GM4 A;  2J5U A;  2KXP B;  1GL2 A;  4L75 A;  3H1L J;  3BCC E;  3R2P A;  3A0B H;  1IFP A;  1KC8 Q;  1GK6 A;  3WU2 E;  1JOC A;  5AVQ B;  3WU2 H;  1FZB A;  3CC2 P;  1SQP J;  2M3E A;  5AW6 B;  3MIW A;  4TT3 H;  1HWT C;  2K9J A;  4UB8 E;  2M5A A;  4IFM A;  5APX A;  3VMA A;  3I55 P;  3AEE C;  3U1A A;  3GMA A;  2W83 C;  4UB8 H;  5CCH C;  2E75 D;  4HKZ H;  1JUN A;  2YKP A;  1WT6 A;  3KPE A;  1FE6 A;  2J59 M;  1AA0 A;  1NTZ G;  1OMI A;  2KUB A;  1OX3 A;  2IX7 C;  3CL3 D;  2O01 N;  3AED C;  1L4A C;  2HG5 D;  1M57 D;  3M9B A;  1EDL A;  3H1J G;  2YMY A;  3P7K A;  2ZT9 D;  4JYC A; 
#chains in the Genus database with same CATH homology
 3M9H A;  1T2K D;  1FOS E;  3RL0 C;  1IJD B;  1HGZ A;  2JJL A;  3UIA A;  3M0A A;  2Q3I A;  1LTJ C;  1GZL A;  1XTC C;  1SFC B;  4W7Y A;  1JCD A;  2N9B A;  4KHX A;  2C0X A;  1GW3 A;  3H6P A;  2FFD B;  1SQQ K;  1LT9 B;  1N7S D;  3E1I A;  5CCH D;  1S9K E;  1NWQ A;  1GDT A;  1RE3 A;  2JEE A;  4C7N A;  2O01 H;  1N2D C;  1QL2 A;  1HTL C;  2KB7 P;  3NMD A;  1CI6 A;  3A7O A;  2A45 H;  1GL2 D;  1XTG B;  3KDP B;  1KQL A;  3HUS B;  3M91 A;  3H32 B;  1IFN A;  5AW2 B;  1N73 B;  3P8C D;  1J2J B;  1L4A D;  4N6J A;  4C7R A;  1HH0 A;  5AVY B;  2FYZ A;  3MUD A;  3RK2 B;  1LGH B;  1RF1 A;  3P8M C;  5CJ4 A;  1FJP A;  2KSJ A;  3LIE A;  1MFZ A;  2XDJ A;  1A02 J;  3V4W A;  1FJK A;  3TSI A;  2BAS A;  2R32 A;  1JMM A;  2FFD A;  5APY A;  5AVT B;  2XKM A;  4C46 A;  1LT9 A;  3RL0 D;  1L0L K;  4LC1 A;  1FZG A;  1KIL A;  1G1I A;  4M3L A;  2W27 A;  1M1J B;  5APQ A;  4Y99 B;  2M8R A;  1SLQ A;  1FU1 A;  3VMZ A;  1HUC A;  3EFG A;  3HD7 C;  3HUS A;  3LW5 H;  2YO3 A;  3H32 A;  2Q7C A;  5AW9 B;  1N73 A;  3HTK B;  2P1J A;  2P67 A;  1IFI A;  3B5N A;  4HYT B;  1HJB A;  3BRT B;  3A3Y B;  2OYI A;  1NO4 A;  3WMM 0;  1L0N K;  1ZN5 A;  5AVU B;  4OH8 B;  3LID A;  2O1J A;  2KYV A;  1H8A A;  1SFC C;  2Q5U A;  1LTS C;  1M7L A;  2WPS A;  4JYB A;  2FFD C;  1DEB A;  2KOG A;  3V2P A;  3V4Q A;  1AQ5 A;  2QM7 A;  3VN0 A;  4WB4 A;  1LWU B;  1ZV8 A;  4C7N B;  2OAR A;  3NTN A;  1CI6 B;  3VTP C;  5AW1 B;  5APW A;  5APV A;  5KJ7 A;  3HUS C;  3IFM A;  1KFM A;  3VP9 A;  1J1E B;  2PAJ A;  1N73 C;  1GW4 A;  3HTK A;  3U59 A;  1SQP K;  1AFO A;  3M0D A;  1NOH A;  2WZ7 A;  1RF0 A;  1LTG C;  5CCG A;  5AVX B;  3RK2 C;  1RF1 B;  1HBW A;  3GHG B;  3IR9 A;  2I1K A;  3HD7 D;  3VYI A;  2Q9I A;  4ZKP A;  2OYH B;  1N86 A;  3EQ2 A;  1NKZ B;  2I1J A;  1DX7 A;  3BVH A;  3CLQ A;  5BU5 A;  2NPS B;  3PP5 A;  3KYQ A;  1KIL B;  3V5B A;  1LWU A;  3RK3 B;  1J1D B;  5AW3 B;  2WT7 A;  1ZLL A;  1M1J C;  1FZC A;  1FDM A;  1SFC D;  2FXM A;  1RE4 A;  5BVZ A;  3L37 A;  3SWF A;  5APS A;  3A2A A;  1DH3 A;  4GIF A;  4B86 A;  1T8Z A;  4EIJ A;  3B5N B;  5CMZ A;  5AVZ B;  2HOD B;  1SP4 A;  1S9K D;  2A45 I;  3L36 A;  4O9B A;  2OYI B;  1JNM A;  1G2C A;  1RF0 C;  5CCG C;  3VOP A;  1YTZ T;  3GHG A;  5CHX A;  4N3Y B;  1KZU B;  4AUW A;  4AQR D;  4WBA A;  2Z4E A;  2WPQ A;  2OYH A;  5KLV K;  1X9V A;  2XV5 A;  3M9Q A;  2MJZ A;  4GT1 A;  2NPS A;  1EQ7 A;  1G1J A;  5CCH A;  2HPC B;  1NTK K;  4N78 E;  1LWU C;  1RE3 C;  1JCC A;  3RK2 D;  3HRN A;  5AVS B;  3V2N A;  2J58 A;  2W6A A;  1RE4 C;  3MTU E;  4WY4 B;  3G3Z A;  5CJ0 A;  4ZKU A;  1GD2 E;  1J1E C;  2WIT A;  3TNU A;  2HOD A;  3II6 A;  1FZF A;  1YTZ I;  3NFQ A;  5KTB A;  1NTZ K;  3VMX A;  1H89 A;  2H8P D;  1QL1 A;  2WSF H;  1X79 B;  4W7Z A;  1RF1 C;  3BRV B;  3MD0 A;  1URQ B;  4GKG A;  5AVR B;  3CI9 A;  3NXS A;  2OYH C;  1NU1 K;  1SQB K;  1PFI A;  4HH2 A;  2YKO A;  1H88 A;  1N7L A;  2W6B A;  1KFN A;  1LT9 C;  2NPS C;  3O8Z A;  2HPC A;  1CZQ A;  2H7H A;  1KIL C;  3M06 A;  3RK3 C;  1J1D C;  2YO2 A;  1LTI C;  1LTJ A;  1IFD A;  5CCG D;  2WT7 B;  4LGD E;  1T3U A;  1IFJ A;  1FZC B;  2WPR A;  2N1T B;  2O1K A;  2R5B A;  1GK4 A;  4I1L A;  4WY4 A;  4W80 A;  2C9N Y;  1FZA A;  4AYC A;  2IFN A;  5AW0 B;  2H43 A;  2YKQ A;  3B5N C;  4JF7 A;  3SWY A;  3TYY A;  1YYC A;  1GU5 A;  2OYI C;  3BAT A;  1T3J A;  1G2C B;  2KLV A;  3N7N A;  3P32 A;  1URQ A;  1FOS F;  1IO4 A;  4I6M C;  1NTM K;  2R5D A;  1JTH B;  2M3B A;  5AW8 B;  1CSB A;  1LTT C;  4XA4 A;  4DOJ A;  2WSE H;  1N7S B;  1JY3 N;  1FAV A;  2GUS A;  2HFE D;  1JY3 O;  1HGV A;  3T97 A;  5BU8 B;  4DZO A;  3V2R A;  4Y99 C;  1GL2 B;  1Z56 A;  1A02 F;  2N1T A;  2LKM A;  1X8Y A;  3OAK A;  4WY4 C;  3V2Q A;  4LLH A;  5KJ7 C;  1MZ9 A;  1CW5 A;  1OXZ A;  5AW5 B;  3TNU B;  1L4A B;  5AVW B;  3TK1 A;  2NPS D;  1HVV A;  3P8C E;  3M0D C;  2IPP A;  2POH A;  1KIL D;  1IK9 A;  2CPS A;  3RK3 D;  1JO5 A;  2ZXE B;  2HLO A;  1JY2 N;  2P2U A;  4I2L C;  1JY2 O;  1URQ C;  3U1C A;  1W2E A;  3OA7 A;  3HD7 A;  3B8E B;  5AW4 B;  3I5C A;  2WSC H;  1JTH A;  2FYU K;  2VRS A;  1FBM A;  1SVF A;  3B5N D;  3C9I A;  1MV8 A;  1NAF A;  2XNX A;  2L5G B;  3RL0 B;  1N7S A;  1RY3 A;  2Z5I A;  3KQG A;  1ZR2 A;  1WRG A;  2ZFC A;  1VDF A;  3HE4 B;  1JY3 P;  1LTJ B;  4EOT A;  1OWA A;  2GM4 A;  1GL2 A;  1FZC C;  2XZR A;  5AW7 B;  1SFC A;  1SQV K;  1VPC A;  2R3C A;  1FZE A;  2N1T C;  3R2P A;  2IFM A;  3OJA B;  2E42 A;  1GK6 A;  2XU6 A;  2KP8 A;  4IFF A;  1L4A A;  1T2K C;  4N78 D;  1LTB C;  1JOC A;  5AVQ B;  2CPB A;  1FZB A;  3HE5 B;  2HYN A;  2WWW A;  5AW6 B;  3MIW A;  1IFM A;  3GHG C;  1HWT C;  4WY4 D;  1JY2 P;  1E5W A;  1LTA C;  5AVV B;  5KJ7 D;  3A5T A;  1GU4 A;  3N4X A;  4IFM A;  5APX A;  3VMY A;  3U1A A;  2QM8 A;  2PP6 A;  2YNY A;  5APT A;  1N7S C;  4RES B;  5CCH C;  1JUN A;  3HE4 A;  2YKP A;  2C0W A;  1WT6 A;  1GTW A;  3KPE A;  1SQX K;  1URQ D;  1MUU A;  2FKW B;  1GL2 C;  4IFD K;  2J59 M;  1ZR4 A;  3L4F A;  2IX7 C;  3CL3 D;  1NHL A;  1L4A C;  2HG5 D;  1IC2 A;  3M9B A;  1NH4 A;  4XE5 B;  3BAS A;  2YMY A;  3HE5 A;  2WTY A;  2Z5H A;  5APU A;  1M1J A;  3P7K A;  3L35 A;  2C9L Y;  2E43 A;  2N1T D;  2GUV A;  1NKN A;  3HD7 B;  4JYC A;  2P7J A;  3VP8 A;  2A45 G;  3MGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...