2MJZA

Capsid model of m13 bacteriophage virus from magic-angle spinning nmr and rosetta modeling
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR-Rosetta capsid model of M13 bacteriophage reveals a quadrupled hydrophobic packing epitope.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
molecule keywords Capsid protein G8P
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2mjzA00
2CPSA 1IFIA 1HH0A 1IFDA 1HGVA 2MJZA 2C0WA 1IFJA 1FDMA 1HGZA 2CPBA 1NH4A 2C0XA
chains in the Genus database with same CATH superfamily
1VQLP 1BE3J 4H13B 4L73A 3D6YA 5M1BA 3R2PA 3M0DA 2J59M 3M9BA 3CXHI 3BCCG 3H1HD 4H44D 5KLVE 2NPSB 2IZ1A 5APQA 2R5DA 1LT1A 1R8EA 2P10A 2QE7H 3GHGB 1YTZT 1KORA 3E1RA 5APWA 5B5EH 3KQGA 2IYPA 1JCDA 2Q3EA 3L75D 3AE6C 1SQPK 1PGJA 1Q2NA 2KNCB 3K5BA 1T2KD 1PGOA 1S5LE 2JWAA 4DJGA 2OYIC 2YXQB 4C7NA 3FWLA 1HWTC 3HRNA 1NTZD 1J1EC 2JKVA 3GW6A 1P84I 4XFJA 3OW2O 3H1HE 2QJPB 2OYHA 1GL2D 2BCCD 2JO1A 1LWUC 5AW2B 1NTZK 2W8ZA 1SLQA 1NVOA 2CPBA 3P8CE 1SQPD 1CSBA 2JDIH 3HE4B 1PIXA 4H0LB 5AVUB 5TISE 2Q1KA 5BU5A 1VQ5P 4WY4B 4JF7A 4GODA 5AVZB 3D71A 4NPFX 1NYHA 2KSJA 3W68A 1KQSO 1SQBD 4YXDC 4Y28J 3L4FA 1JM0A 2QVAA 1OW7A 4N78D 3JC22 1IFMA 2QRXA 5CCHA 3T97B 1X9VA 5L8RJ 2ZYGA 3V5BA 3MTUE 1SQBG 1HF9A 1RY3A 2V4HA 2JR8A 5C39A 4JBZA 2G3AA 2J58A 3CX5D 3H1LG 4JYBA 4OVNF 1SQVE 2NZ2A 2Y9YA 3RBZA 1GD2E 4ASVA 1ZOYC 3C9IA 2QJKC 1MUUA 2N1TA 3L74D 1PPJG 1S5LX 3P8MC 4IFFA 4LC1A 5DJUB 1EXJA 2ZAEB 1SFCA 1U7JA 1L4AC 1WT6A 1SP4A 2C0WA 2WSFJ 1WRGA 3EFFK 3L74G 1P84H 1FS0E 1VDFA 3EWKA 3R4YA 3L70D 1FZCB 2ZXXA 1E79H 1FZCA 3LIEA 2MKVA 2FYNC 1DD3A 1KILE 4DOJA 3CMAP 1KN7A 1G1JA 1NTKK 2BEZF 1ZW0A 4UB6E 1KYOI 3WU2H 2E76B 1FJKA 1M56D 1LGHB 1YHQP 4ZNCA 3H1IG 1FZAA 3D6ZA 1SQXD 2KS1B 3BCCD 3H1HG 1KQLA 1NTKD 2FKWB 2H7HA 1FE6A 1OIPA 1VF5D 4L74A 3JCUE 2HG5D 3FXDA 1S9KD 1K9MQ 1L0NJ 1PFIA 1NO4A 3T97A 1AVYA 2R3CA 2JJLA 2E75D 2KP8A 1SVFA 3MGNA 1PZQA 1L0LG 5AVYB 1KFNA 3MUDA 5TISH 5AW7B 3AE7C 1NU1K 3L71D 3II6A 1KQGB 3CMEP 4IOIH 1NTZG 5CJ4A 1N73B 3L70E 1SQXE 1SQVG 3CWBJ 3HE4A 4IL6H 2OYHC 3RGUA 3HUSB 1BE3D 1OMIA 3AEEC 3IN6A 3P8CD 2FFDB 2OARA 2OYOA 1D7MA 1SQVJ 2D2CC 3CWBG 1SQBE 1BCCJ 3L75E 1S3JA 1J2JB 3H1KE 2FYZA 1NH4A 3KZIE 4PV1D 4Y99B 5AW4B 3S4RA 3BRVB 4BXLA 1IFDA 1BGYD 3CI9A 1VQMP 1DD4A 2FYUD 1N73C 3RL0B 4C7NB 1A02F 1GW4A 1NTMK 1R5LA 4DT0A 1RE3C 3L74J 3L74E 1LNQA 5CCHC 3GHGA 5H2FE 2E5YA 4RO0A 2HODB 1CI6A 1A02J 1J1DC 2XNXA 5CBNA 3TF5A 1DEEG 2H89C 3AE3C 2QG4A 4UB6H 4NPDA 1QL2A 3LW5H 3M9HA 5AVQB 5B66E 5KKZB 3CCMP 2P67A 1FZGA 2H88C 4PJ0H 3CC2P 3RK3E 3Q5RA 1GZLA 1LTIC 2E76D 1FZEA 1GW3A 2AEJA 2O3JA 4R4MA 3L36A 3JCUH 3VTPC 1JY2N 3H1JD 1NTZE 4WVZA 3D70A 3H32B 1RF0A 3RL0C 3MIWA 2FBWC 2WZ7A 3PP5A 1S2EA 1FU1A 2XNDH 3VMXA 2JP3A 2A45H 3MP7B 4A7PA 1BDCA 3VN0A 1SQPE 2R3SA 3G6EP 2YKOA 1EDLA 4HJGH 2KLVA 1AVOA 3HUSC 4AQRD 3NMDA 3IFMA 3H1JJ 1N7SD 1QEXA 2ZVOB 4RKUJ 4CPGA 2BCCE 2P7JA 1RH5B 1M7LA 3SFDC 3U1AA 3CXHH 2PGDA 1KB9I 2C0XA 2R32A 3RL0D 4O9BA 1KV4A 3FGAD 3L70J 1JEKA 1N86A 3SWFA 4GOFA 1GL2A 1S9KE 2HLOA 3PHLA 2WSCJ 2J5UA 3L73J 1BGYJ 1BGYE 1IK7A 1OXZA 4N3YB 2FXMA 3P32A 1JY3O 3WUUA 1LTJC 4B86A 1KZUB 4PV1B 4U3FJ 4KT0J 1LWUB 3HE5B 1YJ9P 3GMAA 4DZOA 2PP6A 1VF5C 2E76C 4I7ZB 3FXEA 1EQ7A 4H13D 4PD4E 5DJTB 1EZVG 1RHZB 1J1EB 5KTBA 2VRSA 3C1LA 3N7NA 1QX8A 5AVRB 2OYIB 5CCHD 3TNUB 2QM8A 4ZKUA 3I55P 1Q81Q 3H6PA 1FZCC 2IDBA 1RE3A 2HPCA 1JY3P 1PP9D 1RE4A 1SQXK 2A06G 5E79E 3CC4P 3GHGC 3M9QA 1NU1E 1KYOH 3AE2C 2O01N 5AW0B 2A06E 1N2DC 2QJKB 2O1KA 1PP9G 1W2EA 4GIFA 4C46A 1SQQE 2Y0CA 2W83C 3V2QA 2B87B 2Y9ZA 2AEMA 3GG2A 2ZXEB 3V2PA 2KZJA 2QEXP 3V2NA 4OGQC 2GUVA 1AQ5A 2K88A 5GTIH 3L75G 4NPEA 4IFMA 2AXTE 3KDPB 3LW5J 3B5NB 1ZRTE 2B89A 3HD7D 3L71E 1T3UA 2Q5UA 3H1JG 3OA7A 3AEBC 5KLVG 3BCCE 2R5BA 1H8AA 3QH9A 1PPJE 5CJ0A 3S9OA 4OWFA 4WY4C 1VQPP 3H25A 3KHUA 1Y47A 1K04A 1P84D 2IZ0A 4RJTA 2Z5IA 1CZQA 4R4LA 3TYYA 1LJ2A 1FAVA 3QWOC 3G71P 1KD1Q 3NFQA 4ASWA 1JMBA 1ZMEC 1N7SC 4N6JA 3A2AA 3PLNA 3VOPA 1Y8AA 4UB8H 1HTLC 1NTMJ 2QJYC 4RESB 3HUSA 2I1JA 2M0BA 2QJPC 3L72G 4GDOA 2OTKE 1N73A 1MKMA 3HD7A 2XZRA 3AEFC 1KILD 1NOHA 3CXHD 3A0HH 2Q3IA 3L72D 4YPCA 2I8DA 5K5GB 4BRYB 1GDTA 2QM7A 2IPPA 3CPWO 5CHXA 1GK4A 1QL1A 2B88A 4I6MC 1RF1A 1NU1J 4PD4I 3F5HA 2C9NY 1VQKP 2WSSH 1CI6B 2NPSC 4H0LD 4W7ZA 3TK1A 3CD6P 2K9YA 2IBZG 1LTJA 2WITA 4D6TG 1KTMA 1IC2A 1IFJA 1URQD 2KS1A 4EDFA 4I1LA 3CCEP 2PFXA 1IO4A 5AW5B 1YJNP 2O01H 2KI7B 2LXCB 3M91A 2GUSA 3L70G 2FXOA 3H1JE 3TSIA 1EZVD 2Q6QA 5H2FH 3AEDC 1GK6A 2OQQA 3V6IA 3WU2E 1NAFA 1KQFB 4I7ZC 5AVSB 1QGKB 1R5SA 1SQBJ 1WMKA 2E74C 2QJYB 2W6BA 2M8RA 3IAOA 3RK3B 2WQYC 1RF0C 3CX5E 1LT9A 1N7SB 1LTSC 3VP9A 1YI2P 2I1KA 3A0BH 1OVVA 4HKZH 1Q86Q 2L5GB 1SFCB 2FFDA 4H44C 1W2BO 1FDOA 1JTHB 1ZP0C 2V7QH 3IR9A 2K9JA 1URQA 3V4QA 3O6QA 3W67A 4L75A 3GF3A 2KIKA 1OVUA 1IFIA 1EDJA 2LKMA 2L91A 1G1IA 1EDIA 2IYOA 2OGUA 5B5EE 1FOSF 1M1JA 1KILC 2KXPB 1BCCD 1VQ6P 1USEA 1X0TA 1XTCC 1KB9H 2IFMA 2YIUB 1FDIA 2JWDA 1YBKA 1OW8A 1EZVE 3L35A 3NXSA 2JEEA 4GOEA 4U3FE 4OGQB 1FZBA 1T3JA 4W80A 1AFOA 1GL2C 1U57A 4WY4A 3Q5SA 5AVVB 4AYCA 2KSEA 3A0HE 2WSEH 2RKLA 3G9RA 2K9JB 1QLED 1JTHA 2P58A 3U1CA 2K37A 5AW9B 1L0LE 1L0LJ 1T2KC 1GTWA 1IJDB 1SFCD 2E75C 1M8OB 1N7SA 1MV8A 1W5CE 2WSFH 2XDJA 2YMYA 3V4WA 1EDKA 3AECC 2KLUA 5KAIE 3AEGC 3B8EB 2HYNA 5KLVJ 1OWAA 3H1LD 2WSEJ 3HD7C 1JY2O 5APUA 5AVWB 3RK2B 1KC8Q 1NGMB 1UIXA 4MN4C 2KNCA 4JYCA 1AQTA 1Q90D 1YYCA 1VF5B 3CCRP 1ZXGA 2YKQA 4XE5B 5BU8B 2Q9IA 3H1KD 4OH8B 1RE4C 2XKMA 5KKZC 1L0LK 4PV1C 2ZT9C 1LTJB 1USDA 1QVGO 1FBMA 1OZHA 1X22A 1Y9BA 2QSIA 3AE9C 3P7KA 1JY2P 2NPSA 5AVXB 3AEAC 3WMM0 1GMJA 1FC2C 1NKZB 3H1KG 4YXWH 2IX7C 3B71A 3C8VA 1U7MA 4HYTB 1E5WA 4AUWA 2Z5HA 2ZYAA 2FYUE 3SWKA 5KAFH 2C9LY 1PPJD 1FJPA 2BCCJ 4JPZB 1YJWP 1P84E 3H1ID 1KYOE 3HTKB 2WPQA 2KOGA 2H8PD 3H1KJ 1NTKG 2Q7CA 4EI2A 1ZN5A 3KXDA 1OFCX 1HH0A 1KMIZ 2RH0A 3CLQA 3L72J 4Y99C 1NTKE 2IFNA 1KB9E 1NTKJ 3HTKA 2M3EA 4EIJA 1JO5A 3NTNA 1SQXJ 5AW6B 1K05A 1YITP 3H1IE 1JY3N 3OAKA 3B4SA 2CPSA 5TJHA 1ZRTD 3WUVA 2FFDC 2O01J 3FWNA 2OYHB 1Z56A 1EZVI 1URQC 2ZVNB 3CCQP 2KB7P 4K35A 1UIIA 2E42A 1S4XA 1K73Q 5AW1B 3KPEA 2V7QJ 2YO3A 2KYVA 3O8ZA 1HGVA 4IL6E 2H43A 1T6AA 3VMYA 1M1JC 1KILA 3G3ZA 1SQVK 1KB9D 1NKNA 1L0LD 3L71J 4DCKA 3BVHA 3L75J 1LTTC 2D2CD 2QA4P 1DH3A 3KYQA 1OVRA 1EC5A 2E74D 1RF1C 2B87A 3CL3D 1JMMA 1SQVD 3LIDA 1S1CX 3H1LJ 1KYOD 3H1LE 4KJMA 1SQQJ 2YMKA 1J1DB 1RQVA 1BE3G 5KLIC 1SQPG 1VL2A 1H88A 1ZR4A 1IFPA 5APXA 1AV1A 4XA4A 3ABVC 4QMAA 5CCGD 2DW3A 1X8YA 2WWWA 5APVA 3VMAA 3BRTB 1HJ0A 1M1JB 1G2CB 2FYUJ 1NTME 4EYYQ 1PGQA 2HPCB 4IFDK 1BSHA 2M5AA 2W27A 1AJYA 2YO2A 3TNUA 5E79H 1BGYG 2FYUG 1OW6A 3MD0A 1BDDA 2PAJA 3BCCJ 3F89A 2A06D 4HB1A 1YQ4C 3O6QB 3Q1MA 1URQB 2M3BA 4LGDE 3CCVP 1NWQA 1DEBA 3OJAB 1LP1B 4U7JA 3L37A 3AE5C 3BATA 1JNMA 1EXIA 3H1HJ 4LLHA 1LT9C 1LT9B 3M0AA 3Q2YA 2D2CB 4U3FG 5KLIB 3H1IJ 2AXTH 2KZIA 3MHVA 1NHLA 2QIWA 3VP8A 5CCGA 1VQOP 1GU5A 1QVFO 4WB4A 5B66H 2GM4A 4PJ0E 4U3FD 2BASA 1LTGC 1CW5A 1YQ3C 3A7OA 5KLVD 3ITKA 2R44A 3A0BE 4KHXA 1ZR2A 1NTZJ 4M3LA 3M0DC 2WPSA 4L76A 5AW3B 1ZLLA 3G4SP 1NJIQ 1S5LH 1DIPA 2UWJE 3FX0A 4WY4D 1NTMD 2N9BA 4K3AA 1SQXG 2ZT9B 1BE3E 3JSVC 3MZWB 3RBXA 1Q7YQ 1M90Q 1HJBA 1RF1B 2G8YA 2RN0A 3U59A 2E43A 1KFMA 1SQPJ 3SSUA 4BRYA 3AE1C 2Y0DA 1NTMG 1JB0J 4OGQD 3CXHE 3GF7A 3CCUP 3RK2C 1H0TA 3HD7B 2FYNB 2FY8A 2GA1A 5KJ7C 3VYIA 2WTYA 1HUCA 3AE8C 2WT7B 1LTBC 3L71G 3SFEC 3CC7P 2YNYA 1YIJP 1L4AB 2Y0EA 3Q3DA 3WUTA 1K8AQ 4JQ0D 1L0NG 1HBWA 1N8RQ 3E1IA 1AA0A 1JCCA 3CWBD 2IBZD 4D6TD 1IZNB 2B9BA 2N1TD 1L0NE 5KLVK 3PTZA 2K1AA 2ITAA 4H13C 3ZDMA 5CMZA 2HODA 2XV5A 1MZ9A 2IBZI 3E7KA 4WWIA 2YIUC 3RK3D 2HR3A 1XTGB 3B5NA 2HFED 2YKPA 3L72E 4IL6X 4PD4H 3L73E 5GTHE 3A5TA 1S72P 2PRRA 1IFNA 4YTPC 3CX5H 1N7LA 3GLMA 3RL0g 2WSCH 3S1KA 1VQ9P 1BSNA 1HGZA 1PP9J 2BEQD 4TT3H 2P2UA 4D6TJ 5AVTB 4H0LC 2OTLP 1MFZA 1SFCC 3IF4A 1L4AA 2A45I 2A45G 2NPSD 4ZMDA 2WPRA 3TGUD 1OX3A 5GTIE 3CCJP 3RK3C 2WT7A 2KUBA 2E74B 3EQ2A 4WBAA 1GU4A 2KK7A 5CCGC 1RQUA 1PV3A 3TGUG 3UIAA 3B5ND 4BWNA 2OYIA 2XU6A 1H0TB 1MFTA 1BCCG 5APTA 2WPVB 3CCLP 2N9YB 1X79B 4PD4D 2YXRB 3TGUE 2ZFCA 3I5CA 1VQ4P 1H89A 2BCCG 4TLFA 3CCSP 3PRJA 1M1KQ 1G2CA 1LWUA 2SPZA 3HE5A 5APYA 2W90A 2E75B 1T8ZA 3Q5PA 5EFWB 4ZKPA 1JOCA 1ZV8A 1Q82Q 2ZT9D 2Z4EA 1L4AD 3A3YB 3CX5I 2LR2A 1PL5A 2FYUK 2ZYDA 4C7RA 1SS1A 4W7YA 1LTAC 3V2RA 3RK2D 1GL2B 5KAIH 1HVVA 1VQ7P 1M57D 1NAYA 3MUDC 1FOSE 2NRGA 1SQQK 1VPCA 1L2PA 2FXPA 4UB8E 3KZIH 3VMZA 1L0NK 2K3RA 2RMZA 4Z1MH 3BASA 3EFGA 1JUNA 1KILB 1PGPA 4I2LC 5KJ7A 4GT1A 2W6AA 1VQ8P 3USSA 3PJSK 1IK9A 4GKGA 5CBOA 1VQNP 1NU1D 2AXCA 2ZJSE 3L73G 5GTHH 2P1JA 1YTZI 2IBZE 3TDKA 1PP9E 4N78E 4D6TE 5AW8B 1SQBK 2N1TC 3I56P 2CK3H 1L0ND 3AE4C 4H44B 1LP1A 1SQQD 2N1TB 1NU1G 2LXBA 3L73D 2AEFA 2O1JA 2WMMA 5KAFE 2POHA 5BVZA 4EOTA 3N4XA 1FZFA 2W6JH 3H32A 5APSA 3SWYA 4HH2A 1DX7A 1BCCE 1SQQG 2M5AB 2WVRA 2OTJP 2MJZA 3M06A 3PH0A 5KJ7D 3B5NC 1TU3F 2E5TA 3TGUJ 3CWBE 1FDMA
chains in the Genus database with same CATH topology
3R2PA 3M0DA 2J59M 3M9BA 2NPSB 5APQA 2R5DA 3GHGB 1YTZT 5APWA 3KQGA 1JCDA 1T2KD 1CW5A 1SQPK 2OYIC 4C7NA 1HWTC 3HRNA 1J1EC 2OYHA 1GL2D 1LWUC 5AW2B 1NTZK 1SLQA 2CPBA 3P8CE 1CSBA 5AVUB 3HE4B 5BU5A 4WY4B 4JF7A 5AVZB 2KSJA 3L4FA 4N78D 1IFMA 5CCHA 1X9VA 3V5BA 3MTUE 1RY3A 3TSIA 2J58A 4JYBA 1GD2E 3C9IA 1MUUA 2N1TA 3P8MC 4IFFA 4LC1A 1SFCA 1L4AC 1WT6A 2C0WA 1SP4A 1WRGA 1VDFA 1FZCB 1FZCA 3LIEA 4DOJA 1G1JA 1NTKK 1FJKA 1LGHB 1FZAA 1KQLA 2H7HA 2FKWB 2HG5D 1S9KD 1PFIA 1NO4A 3T97A 2R3CA 2JJLA 2KP8A 1SVFA 3MGNA 5AVYB 1KFNA 3MUDA 5AW7B 1NU1K 3II6A 5CJ4A 1N73B 3HE4A 2OYHC 3HUSB 2FFDB 3P8CD 2OARA 1NWQA 1J2JB 2FYZA 1NH4A 4Y99B 5AW4B 3BRVB 1IFDA 3CI9A 1A02F 1N73C 3RL0B 4C7NB 1GW4A 1NTMK 1RE3C 5CCHC 3GHGA 2HODB 1CI6A 1A02J 1J1DC 2XNXA 5AVQB 1QL2A 3LW5H 3M9HA 1FZGA 2P67A 1GZLA 1LTIC 1FZEA 1GW3A 3L36A 3VTPC 1JY2N 3H32B 1RF0A 3RL0C 3MIWA 2WZ7A 3PP5A 1FU1A 3VMXA 2A45H 3VN0A 2YKOA 2KLVA 3HUSC 4AQRD 3NMDA 3IFMA 1N7SD 2P7JA 1M7LA 3U1AA 3RL0D 2C0XA 2R32A 4O9BA 1N86A 3SWFA 1GL2A 1S9KE 2HLOA 4N3YB 1OXZA 2FXMA 3P32A 1JY3O 1LTJC 4B86A 1KZUB 1LWUB 3HE5B 4DZOA 2PP6A 2C9LY 1EQ7A 5KTBA 1J1EB 2VRSA 3N7NA 5AVRB 2OYIB 5CCHD 3TNUB 2QM8A 4ZKUA 3H6PA 1FZCC 1RE3A 2HPCA 1JY3P 1RE4A 1SQXK 3GHGC 3M9QA 5AW0B 1N2DC 4GIFA 2O1KA 1W2EA 5BVZA 4C46A 3V2QA 2ZXEB 3V2PA 3V2NA 2GUVA 1AQ5A 4IFMA 3KDPB 3B5NB 3HD7D 1T3UA 2Q5UA 3OA7A 1H8AA 2R5BA 5CJ0A 4WY4C 2Z5IA 1CZQA 3TYYA 1FAVA 3NFQA 1N7SC 4N6JA 3A2AA 3VOPA 1HTLC 4RESB 3HUSA 2I1JA 1N73A 3HD7A 2XZRA 1KILD 1NOHA 2Q3IA 1GDTA 2QM7A 2IPPA 1RF1A 5CHXA 1GK4A 1QL1A 4I6MC 2C9NY 1CI6B 2NPSC 4W7ZA 3TK1A 2WITA 1LTJA 1IC2A 1IFJA 1URQD 4I1LA 1IO4A 5AW5B 2O01H 3M91A 2GUSA 1GK6A 1NAFA 5AVSB 2W6BA 2M8RA 3RK3B 1RF0C 1LT9A 1N7SB 1LTSC 3VP9A 2I1KA 2L5GB 1SFCB 2FFDA 1JTHB 3IR9A 1URQA 3V4QA 1IFIA 2LKMA 1G1IA 1FOSF 1M1JA 1KILC 1XTCC 2IFMA 3NXSA 3L35A 4W80A 2JEEA 1FZBA 1T3JA 1AFOA 1GL2C 4WY4A 5AVVB 4AYCA 2WSEH 1JTHA 3U1CA 5AW9B 1T2KC 1GTWA 1IJDB 1SFCD 1N7SA 1MV8A 2XDJA 2WSFH 2YMYA 3V4WA 3B8EB 2HYNA 1OWAA 3HD7C 1JY2O 5APUA 5AVWB 3RK2B 4JYCA 1YYCA 2YKQA 4XE5B 5BU8B 2Q9IA 4OH8B 1RE4C 2XKMA 1L0LK 1LTJB 1FBMA 5AVXB 3P7KA 3WMM0 1JY2P 2NPSA 1NKZB 2IX7C 4HYTB 4AUWA 1E5WA 2Z5HA 1FJPA 3HTKB 2WPQA 2KOGA 2H8PD 2Q7CA 1ZN5A 1HH0A 3CLQA 4Y99C 2IFNA 1JO5A 4EIJA 3NTNA 5AW6B 3OAKA 1JY3N 2FFDC 2CPSA 2OYHB 1Z56A 1URQC 2KB7P 2E42A 5AW1B 3KPEA 2YO3A 2KYVA 3O8ZA 1HGVA 2H43A 3VMYA 1M1JC 1KILA 3G3ZA 1SQVK 1NKNA 3BVHA 1LTTC 1DH3A 3KYQA 1RF1C 3CL3D 1JMMA 3LIDA 1J1DB 1H88A 1ZR4A 5APXA 4XA4A 5CCGD 1X8YA 2WWWA 5APVA 3BRTB 1M1JB 1G2CB 2HPCB 4IFDK 2W27A 2YO2A 3TNUA 3MD0A 2PAJA 1URQB 2M3BA 4LGDE 1DEBA 3OJAB 3L37A 3BATA 1JNMA 4LLHA 1LT9C 1LT9B 3M0AA 3VP8A 1NHLA 5CCGA 1GU5A 4WB4A 2GM4A 2BASA 1LTGC 3A7OA 4KHXA 1ZR2A 4M3LA 3M0DC 2WPSA 5AW3B 1ZLLA 4WY4D 2N9BA 1HJBA 1RF1B 3U59A 2E43A 1KFMA 3RK2C 3HD7B 5KJ7C 3VYIA 2WTYA 1HUCA 2WT7B 1LTBC 2YNYA 1L4AB 1HBWA 3E1IA 1JCCA 2N1TD 5KLVK 5CMZA 2HODA 2XV5A 1MZ9A 3RK3D 1XTGB 3B5NA 2HFED 2YKPA 3A5TA 1IFNA 1N7LA 2WSCH 1HGZA 2P2UA 5AVTB 1MFZA 1SFCC 1L4AA 2A45I 2A45G 2NPSD 2WPRA 3RK3C 2WT7A 3EQ2A 4WBAA 1GU4A 5CCGC 3UIAA 3B5ND 2OYIA 2XU6A 5APTA 1X79B 2ZFCA 3I5CA 1H89A 1G2CA 1LWUA 3HE5A 5APYA 1T8ZA 1JOCA 1ZV8A 2Z4EA 1L4AD 3A3YB 2FYUK 4C7RA 4W7YA 1LTAC 3V2RA 3RK2D 1GL2B 1HVVA 1FOSE 1SQQK 1VPCA 3VMZA 1L0NK 1JUNA 3BASA 3EFGA 1KILB 4I2LC 5KJ7A 4GT1A 2W6AA 1IK9A 4GKGA 2P1JA 1YTZI 4N78E 5AW8B 1SQBK 2N1TC 2N1TB 2O1JA 2POHA 4EOTA 3N4XA 1FZFA 3H32A 5APSA 3SWYA 4HH2A 1DX7A 2MJZA 3M06A 5KJ7D 3B5NC 4ZKPA 3HTKA 1FDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPS A;  1IFI A;  1HH0 A;  1IFD A;  1HGV A;  2MJZ A;  2C0W A;  1IFJ A;  1FDM A;  1HGZ A;  2CPB A;  1NH4 A;  2C0X A; 
#chains in the Genus database with same CATH topology
 1VQL P;  1BE3 J;  4H13 B;  4L73 A;  3D6Y A;  5M1B A;  3R2P A;  3M0D A;  2J59 M;  3M9B A;  3CXH I;  3BCC G;  3H1H D;  4H44 D;  5KLV E;  2NPS B;  2IZ1 A;  5APQ A;  2R5D A;  1LT1 A;  1R8E A;  2P10 A;  2QE7 H;  3GHG B;  1YTZ T;  1KOR A;  3E1R A;  5APW A;  5B5E H;  3KQG A;  2IYP A;  1JCD A;  2Q3E A;  3L75 D;  3AE6 C;  1SQP K;  1PGJ A;  1Q2N A;  2KNC B;  3K5B A;  1T2K D;  1PGO A;  1S5L E;  2JWA A;  4DJG A;  2OYI C;  2YXQ B;  4C7N A;  3FWL A;  1HWT C;  3HRN A;  1NTZ D;  1J1E C;  2JKV A;  3GW6 A;  1P84 I;  4XFJ A;  3OW2 O;  3H1H E;  2QJP B;  2OYH A;  1GL2 D;  2BCC D;  2JO1 A;  1LWU C;  5AW2 B;  1NTZ K;  2W8Z A;  1SLQ A;  1NVO A;  2CPB A;  3P8C E;  1SQP D;  1CSB A;  2JDI H;  3HE4 B;  1PIX A;  4H0L B;  5AVU B;  5TIS E;  2Q1K A;  5BU5 A;  1VQ5 P;  4WY4 B;  4JF7 A;  4GOD A;  5AVZ B;  3D71 A;  4NPF X;  1NYH A;  2KSJ A;  3W68 A;  1KQS O;  1SQB D;  4YXD C;  4Y28 J;  3L4F A;  1JM0 A;  2QVA A;  1OW7 A;  4N78 D;  3JC2 2;  1IFM A;  2QRX A;  5CCH A;  3T97 B;  1X9V A;  5L8R J;  2ZYG A;  3V5B A;  3MTU E;  1SQB G;  1HF9 A;  1RY3 A;  2V4H A;  2JR8 A;  5C39 A;  4JBZ A;  2G3A A;  2J58 A;  3CX5 D;  3H1L G;  4JYB A;  4OVN F;  1SQV E;  2NZ2 A;  2Y9Y A;  3RBZ A;  1GD2 E;  4ASV A;  1ZOY C;  3C9I A;  2QJK C;  1MUU A;  2N1T A;  3L74 D;  1PPJ G;  1S5L X;  3P8M C;  4IFF A;  4LC1 A;  5DJU B;  1EXJ A;  2ZAE B;  1SFC A;  1U7J A;  1L4A C;  1WT6 A;  1SP4 A;  2C0W A;  2WSF J;  1WRG A;  3EFF K;  3L74 G;  1P84 H;  1FS0 E;  1VDF A;  3EWK A;  3R4Y A;  3L70 D;  1FZC B;  2ZXX A;  1E79 H;  1FZC A;  3LIE A;  2MKV A;  2FYN C;  1DD3 A;  1KIL E;  4DOJ A;  3CMA P;  1KN7 A;  1G1J A;  1NTK K;  2BEZ F;  1ZW0 A;  4UB6 E;  1KYO I;  3WU2 H;  2E76 B;  1FJK A;  1M56 D;  1LGH B;  1YHQ P;  4ZNC A;  3H1I G;  1FZA A;  3D6Z A;  1SQX D;  2KS1 B;  3BCC D;  3H1H G;  1KQL A;  1NTK D;  2FKW B;  2H7H A;  1FE6 A;  1OIP A;  1VF5 D;  4L74 A;  3JCU E;  2HG5 D;  3FXD A;  1S9K D;  1K9M Q;  1L0N J;  1PFI A;  1NO4 A;  3T97 A;  1AVY A;  2R3C A;  2JJL A;  2E75 D;  2KP8 A;  1SVF A;  3MGN A;  1PZQ A;  1L0L G;  5AVY B;  1KFN A;  3MUD A;  5TIS H;  5AW7 B;  3AE7 C;  1NU1 K;  3L71 D;  3II6 A;  1KQG B;  3CME P;  4IOI H;  1NTZ G;  5CJ4 A;  1N73 B;  3L70 E;  1SQX E;  1SQV G;  3CWB J;  3HE4 A;  4IL6 H;  2OYH C;  3RGU A;  3HUS B;  1BE3 D;  1OMI A;  3AEE C;  3IN6 A;  3P8C D;  2FFD B;  2OAR A;  2OYO A;  1D7M A;  1SQV J;  2D2C C;  3CWB G;  1SQB E;  1BCC J;  3L75 E;  1S3J A;  1J2J B;  3H1K E;  2FYZ A;  1NH4 A;  3KZI E;  4PV1 D;  4Y99 B;  5AW4 B;  3S4R A;  3BRV B;  4BXL A;  1IFD A;  1BGY D;  3CI9 A;  1VQM P;  1DD4 A;  2FYU D;  1N73 C;  3RL0 B;  4C7N B;  1A02 F;  1GW4 A;  1NTM K;  1R5L A;  4DT0 A;  1RE3 C;  3L74 J;  3L74 E;  1LNQ A;  5CCH C;  3GHG A;  5H2F E;  2E5Y A;  4RO0 A;  2HOD B;  1CI6 A;  1A02 J;  1J1D C;  2XNX A;  5CBN A;  3TF5 A;  1DEE G;  2H89 C;  3AE3 C;  2QG4 A;  4UB6 H;  4NPD A;  1QL2 A;  3LW5 H;  3M9H A;  5AVQ B;  5B66 E;  5KKZ B;  3CCM P;  2P67 A;  1FZG A;  2H88 C;  4PJ0 H;  3CC2 P;  3RK3 E;  3Q5R A;  1GZL A;  1LTI C;  2E76 D;  1FZE A;  1GW3 A;  2AEJ A;  2O3J A;  4R4M A;  3L36 A;  3JCU H;  3VTP C;  1JY2 N;  3H1J D;  1NTZ E;  4WVZ A;  3D70 A;  3H32 B;  1RF0 A;  3RL0 C;  3MIW A;  2FBW C;  2WZ7 A;  3PP5 A;  1S2E A;  1FU1 A;  2XND H;  3VMX A;  2JP3 A;  2A45 H;  3MP7 B;  4A7P A;  1BDC A;  3VN0 A;  1SQP E;  2R3S A;  3G6E P;  2YKO A;  1EDL A;  4HJG H;  2KLV A;  1AVO A;  3HUS C;  4AQR D;  3NMD A;  3IFM A;  3H1J J;  1N7S D;  1QEX A;  2ZVO B;  4RKU J;  4CPG A;  2BCC E;  2P7J A;  1RH5 B;  1M7L A;  3SFD C;  3U1A A;  3CXH H;  2PGD A;  1KB9 I;  2C0X A;  2R32 A;  3RL0 D;  4O9B A;  1KV4 A;  3FGA D;  3L70 J;  1JEK A;  1N86 A;  3SWF A;  4GOF A;  1GL2 A;  1S9K E;  2HLO A;  3PHL A;  2WSC J;  2J5U A;  3L73 J;  1BGY J;  1BGY E;  1IK7 A;  1OXZ A;  4N3Y B;  2FXM A;  3P32 A;  1JY3 O;  3WUU A;  1LTJ C;  4B86 A;  1KZU B;  4PV1 B;  4U3F J;  4KT0 J;  1LWU B;  3HE5 B;  1YJ9 P;  3GMA A;  4DZO A;  2PP6 A;  1VF5 C;  2E76 C;  4I7Z B;  3FXE A;  1EQ7 A;  4H13 D;  4PD4 E;  5DJT B;  1EZV G;  1RHZ B;  1J1E B;  5KTB A;  2VRS A;  3C1L A;  3N7N A;  1QX8 A;  5AVR B;  2OYI B;  5CCH D;  3TNU B;  2QM8 A;  4ZKU A;  3I55 P;  1Q81 Q;  3H6P A;  1FZC C;  2IDB A;  1RE3 A;  2HPC A;  1JY3 P;  1PP9 D;  1RE4 A;  1SQX K;  2A06 G;  5E79 E;  3CC4 P;  3GHG C;  3M9Q A;  1NU1 E;  1KYO H;  3AE2 C;  2O01 N;  5AW0 B;  2A06 E;  1N2D C;  2QJK B;  2O1K A;  1PP9 G;  1W2E A;  4GIF A;  4C46 A;  1SQQ E;  2Y0C A;  2W83 C;  3V2Q A;  2B87 B;  2Y9Z A;  2AEM A;  3GG2 A;  2ZXE B;  3V2P A;  2KZJ A;  2QEX P;  3V2N A;  4OGQ C;  2GUV A;  1AQ5 A;  2K88 A;  5GTI H;  3L75 G;  4NPE A;  4IFM A;  2AXT E;  3KDP B;  3LW5 J;  3B5N B;  1ZRT E;  2B89 A;  3HD7 D;  3L71 E;  1T3U A;  2Q5U A;  3H1J G;  3OA7 A;  3AEB C;  5KLV G;  3BCC E;  2R5B A;  1H8A A;  3QH9 A;  1PPJ E;  5CJ0 A;  3S9O A;  4OWF A;  4WY4 C;  1VQP P;  3H25 A;  3KHU A;  1Y47 A;  1K04 A;  1P84 D;  2IZ0 A;  4RJT A;  2Z5I A;  1CZQ A;  4R4L A;  3TYY A;  1LJ2 A;  1FAV A;  3QWO C;  3G71 P;  1KD1 Q;  3NFQ A;  4ASW A;  1JMB A;  1ZME C;  1N7S C;  4N6J A;  3A2A A;  3PLN A;  3VOP A;  1Y8A A;  4UB8 H;  1HTL C;  1NTM J;  2QJY C;  4RES B;  3HUS A;  2I1J A;  2M0B A;  2QJP C;  3L72 G;  4GDO A;  2OTK E;  1N73 A;  1MKM A;  3HD7 A;  2XZR A;  3AEF C;  1KIL D;  1NOH A;  3CXH D;  3A0H H;  2Q3I A;  3L72 D;  4YPC A;  2I8D A;  5K5G B;  4BRY B;  1GDT A;  2QM7 A;  2IPP A;  3CPW O;  5CHX A;  1GK4 A;  1QL1 A;  2B88 A;  4I6M C;  1RF1 A;  1NU1 J;  4PD4 I;  3F5H A;  2C9N Y;  1VQK P;  2WSS H;  1CI6 B;  2NPS C;  4H0L D;  4W7Z A;  3TK1 A;  3CD6 P;  2K9Y A;  2IBZ G;  1LTJ A;  2WIT A;  4D6T G;  1KTM A;  1IC2 A;  1IFJ A;  1URQ D;  2KS1 A;  4EDF A;  4I1L A;  3CCE P;  2PFX A;  1IO4 A;  5AW5 B;  1YJN P;  2O01 H;  2KI7 B;  2LXC B;  3M91 A;  2GUS A;  3L70 G;  2FXO A;  3H1J E;  3TSI A;  1EZV D;  2Q6Q A;  5H2F H;  3AED C;  1GK6 A;  2OQQ A;  3V6I A;  3WU2 E;  1NAF A;  1KQF B;  4I7Z C;  5AVS B;  1QGK B;  1R5S A;  1SQB J;  1WMK A;  2E74 C;  2QJY B;  2W6B A;  2M8R A;  3IAO A;  3RK3 B;  2WQY C;  1RF0 C;  3CX5 E;  1LT9 A;  1N7S B;  1LTS C;  3VP9 A;  1YI2 P;  2I1K A;  3A0B H;  1OVV A;  4HKZ H;  1Q86 Q;  2L5G B;  1SFC B;  2FFD A;  4H44 C;  1W2B O;  1FDO A;  1JTH B;  1ZP0 C;  2V7Q H;  3IR9 A;  2K9J A;  1URQ A;  3V4Q A;  3O6Q A;  3W67 A;  4L75 A;  3GF3 A;  2KIK A;  1OVU A;  1IFI A;  1EDJ A;  2LKM A;  2L91 A;  1G1I A;  1EDI A;  2IYO A;  2OGU A;  5B5E E;  1FOS F;  1M1J A;  1KIL C;  2KXP B;  1BCC D;  1VQ6 P;  1USE A;  1X0T A;  1XTC C;  1KB9 H;  2IFM A;  2YIU B;  1FDI A;  2JWD A;  1YBK A;  1OW8 A;  1EZV E;  3L35 A;  3NXS A;  2JEE A;  4GOE A;  4U3F E;  4OGQ B;  1FZB A;  1T3J A;  4W80 A;  1AFO A;  1GL2 C;  1U57 A;  4WY4 A;  3Q5S A;  5AVV B;  4AYC A;  2KSE A;  3A0H E;  2WSE H;  2RKL A;  3G9R A;  2K9J B;  1QLE D;  1JTH A;  2P58 A;  3U1C A;  2K37 A;  5AW9 B;  1L0L E;  1L0L J;  1T2K C;  1GTW A;  1IJD B;  1SFC D;  2E75 C;  1M8O B;  1N7S A;  1MV8 A;  1W5C E;  2WSF H;  2XDJ A;  2YMY A;  3V4W A;  1EDK A;  3AEC C;  2KLU A;  5KAI E;  3AEG C;  3B8E B;  2HYN A;  5KLV J;  1OWA A;  3H1L D;  2WSE J;  3HD7 C;  1JY2 O;  5APU A;  5AVW B;  3RK2 B;  1KC8 Q;  1NGM B;  1UIX A;  4MN4 C;  2KNC A;  4JYC A;  1AQT A;  1Q90 D;  1YYC A;  1VF5 B;  3CCR P;  1ZXG A;  2YKQ A;  4XE5 B;  5BU8 B;  2Q9I A;  3H1K D;  4OH8 B;  1RE4 C;  2XKM A;  5KKZ C;  1L0L K;  4PV1 C;  2ZT9 C;  1LTJ B;  1USD A;  1QVG O;  1FBM A;  1OZH A;  1X22 A;  1Y9B A;  2QSI A;  3AE9 C;  3P7K A;  1JY2 P;  2NPS A;  5AVX B;  3AEA C;  3WMM 0;  1GMJ A;  1FC2 C;  1NKZ B;  3H1K G;  4YXW H;  2IX7 C;  3B71 A;  3C8V A;  1U7M A;  4HYT B;  1E5W A;  4AUW A;  2Z5H A;  2ZYA A;  2FYU E;  3SWK A;  5KAF H;  2C9L Y;  1PPJ D;  1FJP A;  2BCC J;  4JPZ B;  1YJW P;  1P84 E;  3H1I D;  1KYO E;  3HTK B;  2WPQ A;  2KOG A;  2H8P D;  3H1K J;  1NTK G;  2Q7C A;  4EI2 A;  1ZN5 A;  3KXD A;  1OFC X;  1HH0 A;  1KMI Z;  2RH0 A;  3CLQ A;  3L72 J;  4Y99 C;  1NTK E;  2IFN A;  1KB9 E;  1NTK J;  3HTK A;  2M3E A;  4EIJ A;  1JO5 A;  3NTN A;  1SQX J;  5AW6 B;  1K05 A;  1YIT P;  3H1I E;  1JY3 N;  3OAK A;  3B4S A;  2CPS A;  5TJH A;  1ZRT D;  3WUV A;  2FFD C;  2O01 J;  3FWN A;  2OYH B;  1Z56 A;  1EZV I;  1URQ C;  2ZVN B;  3CCQ P;  2KB7 P;  4K35 A;  1UII A;  2E42 A;  1S4X A;  1K73 Q;  5AW1 B;  3KPE A;  2V7Q J;  2YO3 A;  2KYV A;  3O8Z A;  1HGV A;  4IL6 E;  2H43 A;  1T6A A;  3VMY A;  1M1J C;  1KIL A;  3G3Z A;  1SQV K;  1KB9 D;  1NKN A;  1L0L D;  3L71 J;  4DCK A;  3BVH A;  3L75 J;  1LTT C;  2D2C D;  2QA4 P;  1DH3 A;  3KYQ A;  1OVR A;  1EC5 A;  2E74 D;  1RF1 C;  2B87 A;  3CL3 D;  1JMM A;  1SQV D;  3LID A;  1S1C X;  3H1L J;  1KYO D;  3H1L E;  4KJM A;  1SQQ J;  2YMK A;  1J1D B;  1RQV A;  1BE3 G;  5KLI C;  1SQP G;  1VL2 A;  1H88 A;  1ZR4 A;  1IFP A;  5APX A;  1AV1 A;  4XA4 A;  3ABV C;  4QMA A;  5CCG D;  2DW3 A;  1X8Y A;  2WWW A;  5APV A;  3VMA A;  3BRT B;  1HJ0 A;  1M1J B;  1G2C B;  2FYU J;  1NTM E;  4EYY Q;  1PGQ A;  2HPC B;  4IFD K;  1BSH A;  2M5A A;  2W27 A;  1AJY A;  2YO2 A;  3TNU A;  5E79 H;  1BGY G;  2FYU G;  1OW6 A;  3MD0 A;  1BDD A;  2PAJ A;  3BCC J;  3F89 A;  2A06 D;  4HB1 A;  1YQ4 C;  3O6Q B;  3Q1M A;  1URQ B;  2M3B A;  4LGD E;  3CCV P;  1NWQ A;  1DEB A;  3OJA B;  1LP1 B;  4U7J A;  3L37 A;  3AE5 C;  3BAT A;  1JNM A;  1EXI A;  3H1H J;  4LLH A;  1LT9 C;  1LT9 B;  3M0A A;  3Q2Y A;  2D2C B;  4U3F G;  5KLI B;  3H1I J;  2AXT H;  2KZI A;  3MHV A;  1NHL A;  2QIW A;  3VP8 A;  5CCG A;  1VQO P;  1GU5 A;  1QVF O;  4WB4 A;  5B66 H;  2GM4 A;  4PJ0 E;  4U3F D;  2BAS A;  1LTG C;  1CW5 A;  1YQ3 C;  3A7O A;  5KLV D;  3ITK A;  2R44 A;  3A0B E;  4KHX A;  1ZR2 A;  1NTZ J;  4M3L A;  3M0D C;  2WPS A;  4L76 A;  5AW3 B;  1ZLL A;  3G4S P;  1NJI Q;  1S5L H;  1DIP A;  2UWJ E;  3FX0 A;  4WY4 D;  1NTM D;  2N9B A;  4K3A A;  1SQX G;  2ZT9 B;  1BE3 E;  3JSV C;  3MZW B;  3RBX A;  1Q7Y Q;  1M90 Q;  1HJB A;  1RF1 B;  2G8Y A;  2RN0 A;  3U59 A;  2E43 A;  1KFM A;  1SQP J;  3SSU A;  4BRY A;  3AE1 C;  2Y0D A;  1NTM G;  1JB0 J;  4OGQ D;  3CXH E;  3GF7 A;  3CCU P;  3RK2 C;  1H0T A;  3HD7 B;  2FYN B;  2FY8 A;  2GA1 A;  5KJ7 C;  3VYI A;  2WTY A;  1HUC A;  3AE8 C;  2WT7 B;  1LTB C;  3L71 G;  3SFE C;  3CC7 P;  2YNY A;  1YIJ P;  1L4A B;  2Y0E A;  3Q3D A;  3WUT A;  1K8A Q;  4JQ0 D;  1L0N G;  1HBW A;  1N8R Q;  3E1I A;  1AA0 A;  1JCC A;  3CWB D;  2IBZ D;  4D6T D;  1IZN B;  2B9B A;  2N1T D;  1L0N E;  5KLV K;  3PTZ A;  2K1A A;  2ITA A;  4H13 C;  3ZDM A;  5CMZ A;  2HOD A;  2XV5 A;  1MZ9 A;  2IBZ I;  3E7K A;  4WWI A;  2YIU C;  3RK3 D;  2HR3 A;  1XTG B;  3B5N A;  2HFE D;  2YKP A;  3L72 E;  4IL6 X;  4PD4 H;  3L73 E;  5GTH E;  3A5T A;  1S72 P;  2PRR A;  1IFN A;  4YTP C;  3CX5 H;  1N7L A;  3GLM A;  3RL0 g;  2WSC H;  3S1K A;  1VQ9 P;  1BSN A;  1HGZ A;  1PP9 J;  2BEQ D;  4TT3 H;  2P2U A;  4D6T J;  5AVT B;  4H0L C;  2OTL P;  1MFZ A;  1SFC C;  3IF4 A;  1L4A A;  2A45 I;  2A45 G;  2NPS D;  4ZMD A;  2WPR A;  3TGU D;  1OX3 A;  5GTI E;  3CCJ P;  3RK3 C;  2WT7 A;  2KUB A;  2E74 B;  3EQ2 A;  4WBA A;  1GU4 A;  2KK7 A;  5CCG C;  1RQU A;  1PV3 A;  3TGU G;  3UIA A;  3B5N D;  4BWN A;  2OYI A;  2XU6 A;  1H0T B;  1MFT A;  1BCC G;  5APT A;  2WPV B;  3CCL P;  2N9Y B;  1X79 B;  4PD4 D;  2YXR B;  3TGU E;  2ZFC A;  3I5C A;  1VQ4 P;  1H89 A;  2BCC G;  4TLF A;  3CCS P;  3PRJ A;  1M1K Q;  1G2C A;  1LWU A;  2SPZ A;  3HE5 A;  5APY A;  2W90 A;  2E75 B;  1T8Z A;  3Q5P A;  5EFW B;  4ZKP A;  1JOC A;  1ZV8 A;  1Q82 Q;  2ZT9 D;  2Z4E A;  1L4A D;  3A3Y B;  3CX5 I;  2LR2 A;  1PL5 A;  2FYU K;  2ZYD A;  4C7R A;  1SS1 A;  4W7Y A;  1LTA C;  3V2R A;  3RK2 D;  1GL2 B;  5KAI H;  1HVV A;  1VQ7 P;  1M57 D;  1NAY A;  3MUD C;  1FOS E;  2NRG A;  1SQQ K;  1VPC A;  1L2P A;  2FXP A;  4UB8 E;  3KZI H;  3VMZ A;  1L0N K;  2K3R A;  2RMZ A;  4Z1M H;  3BAS A;  3EFG A;  1JUN A;  1KIL B;  1PGP A;  4I2L C;  5KJ7 A;  4GT1 A;  2W6A A;  1VQ8 P;  3USS A;  3PJS K;  1IK9 A;  4GKG A;  5CBO A;  1VQN P;  1NU1 D;  2AXC A;  2ZJS E;  3L73 G;  5GTH H;  2P1J A;  1YTZ I;  2IBZ E;  3TDK A;  1PP9 E;  4N78 E;  4D6T E;  5AW8 B;  1SQB K;  2N1T C;  3I56 P;  2CK3 H;  1L0N D;  3AE4 C;  4H44 B;  1LP1 A;  1SQQ D;  2N1T B;  1NU1 G;  2LXB A;  3L73 D;  2AEF A;  2O1J A;  2WMM A;  5KAF E;  2POH A;  5BVZ A;  4EOT A;  3N4X A;  1FZF A;  2W6J H;  3H32 A;  5APS A;  3SWY A;  4HH2 A;  1DX7 A;  1BCC E;  1SQQ G;  2M5A B;  2WVR A;  2OTJ P;  2MJZ A;  3M06 A;  3PH0 A;  5KJ7 D;  3B5N C;  1TU3 F;  2E5T A;  3TGU J;  3CWB E;  1FDM A; 
#chains in the Genus database with same CATH homology
 3R2P A;  3M0D A;  2J59 M;  3M9B A;  2NPS B;  5APQ A;  2R5D A;  3GHG B;  1YTZ T;  5APW A;  3KQG A;  1JCD A;  1T2K D;  1CW5 A;  1SQP K;  2OYI C;  4C7N A;  1HWT C;  3HRN A;  1J1E C;  2OYH A;  1GL2 D;  1LWU C;  5AW2 B;  1NTZ K;  1SLQ A;  2CPB A;  3P8C E;  1CSB A;  5AVU B;  3HE4 B;  5BU5 A;  4WY4 B;  4JF7 A;  5AVZ B;  2KSJ A;  3L4F A;  4N78 D;  1IFM A;  5CCH A;  1X9V A;  3V5B A;  3MTU E;  1RY3 A;  3TSI A;  2J58 A;  4JYB A;  1GD2 E;  3C9I A;  1MUU A;  2N1T A;  3P8M C;  4IFF A;  4LC1 A;  1SFC A;  1L4A C;  1WT6 A;  2C0W A;  1SP4 A;  1WRG A;  1VDF A;  1FZC B;  1FZC A;  3LIE A;  4DOJ A;  1G1J A;  1NTK K;  1FJK A;  1LGH B;  1FZA A;  1KQL A;  2H7H A;  2FKW B;  2HG5 D;  1S9K D;  1PFI A;  1NO4 A;  3T97 A;  2R3C A;  2JJL A;  2KP8 A;  1SVF A;  3MGN A;  5AVY B;  1KFN A;  3MUD A;  5AW7 B;  1NU1 K;  3II6 A;  5CJ4 A;  1N73 B;  3HE4 A;  2OYH C;  3HUS B;  2FFD B;  3P8C D;  2OAR A;  1NWQ A;  1J2J B;  2FYZ A;  1NH4 A;  4Y99 B;  5AW4 B;  3BRV B;  1IFD A;  3CI9 A;  1A02 F;  1N73 C;  3RL0 B;  4C7N B;  1GW4 A;  1NTM K;  1RE3 C;  5CCH C;  3GHG A;  2HOD B;  1CI6 A;  1A02 J;  1J1D C;  2XNX A;  5AVQ B;  1QL2 A;  3LW5 H;  3M9H A;  1FZG A;  2P67 A;  1GZL A;  1LTI C;  1FZE A;  1GW3 A;  3L36 A;  3VTP C;  1JY2 N;  3H32 B;  1RF0 A;  3RL0 C;  3MIW A;  2WZ7 A;  3PP5 A;  1FU1 A;  3VMX A;  2A45 H;  3VN0 A;  2YKO A;  2KLV A;  3HUS C;  4AQR D;  3NMD A;  3IFM A;  1N7S D;  2P7J A;  1M7L A;  3U1A A;  3RL0 D;  2C0X A;  2R32 A;  4O9B A;  1N86 A;  3SWF A;  1GL2 A;  1S9K E;  2HLO A;  4N3Y B;  1OXZ A;  2FXM A;  3P32 A;  1JY3 O;  1LTJ C;  4B86 A;  1KZU B;  1LWU B;  3HE5 B;  4DZO A;  2PP6 A;  2C9L Y;  1EQ7 A;  5KTB A;  1J1E B;  2VRS A;  3N7N A;  5AVR B;  2OYI B;  5CCH D;  3TNU B;  2QM8 A;  4ZKU A;  3H6P A;  1FZC C;  1RE3 A;  2HPC A;  1JY3 P;  1RE4 A;  1SQX K;  3GHG C;  3M9Q A;  5AW0 B;  1N2D C;  4GIF A;  2O1K A;  1W2E A;  5BVZ A;  4C46 A;  3V2Q A;  2ZXE B;  3V2P A;  3V2N A;  2GUV A;  1AQ5 A;  4IFM A;  3KDP B;  3B5N B;  3HD7 D;  1T3U A;  2Q5U A;  3OA7 A;  1H8A A;  2R5B A;  5CJ0 A;  4WY4 C;  2Z5I A;  1CZQ A;  3TYY A;  1FAV A;  3NFQ A;  1N7S C;  4N6J A;  3A2A A;  3VOP A;  1HTL C;  4RES B;  3HUS A;  2I1J A;  1N73 A;  3HD7 A;  2XZR A;  1KIL D;  1NOH A;  2Q3I A;  1GDT A;  2QM7 A;  2IPP A;  1RF1 A;  5CHX A;  1GK4 A;  1QL1 A;  4I6M C;  2C9N Y;  1CI6 B;  2NPS C;  4W7Z A;  3TK1 A;  2WIT A;  1LTJ A;  1IC2 A;  1IFJ A;  1URQ D;  4I1L A;  1IO4 A;  5AW5 B;  2O01 H;  3M91 A;  2GUS A;  1GK6 A;  1NAF A;  5AVS B;  2W6B A;  2M8R A;  3RK3 B;  1RF0 C;  1LT9 A;  1N7S B;  1LTS C;  3VP9 A;  2I1K A;  2L5G B;  1SFC B;  2FFD A;  1JTH B;  3IR9 A;  1URQ A;  3V4Q A;  1IFI A;  2LKM A;  1G1I A;  1FOS F;  1M1J A;  1KIL C;  1XTC C;  2IFM A;  3NXS A;  3L35 A;  4W80 A;  2JEE A;  1FZB A;  1T3J A;  1AFO A;  1GL2 C;  4WY4 A;  5AVV B;  4AYC A;  2WSE H;  1JTH A;  3U1C A;  5AW9 B;  1T2K C;  1GTW A;  1IJD B;  1SFC D;  1N7S A;  1MV8 A;  2XDJ A;  2WSF H;  2YMY A;  3V4W A;  3B8E B;  2HYN A;  1OWA A;  3HD7 C;  1JY2 O;  5APU A;  5AVW B;  3RK2 B;  4JYC A;  1YYC A;  2YKQ A;  4XE5 B;  5BU8 B;  2Q9I A;  4OH8 B;  1RE4 C;  2XKM A;  1L0L K;  1LTJ B;  1FBM A;  5AVX B;  3P7K A;  3WMM 0;  1JY2 P;  2NPS A;  1NKZ B;  2IX7 C;  4HYT B;  4AUW A;  1E5W A;  2Z5H A;  1FJP A;  3HTK B;  2WPQ A;  2KOG A;  2H8P D;  2Q7C A;  1ZN5 A;  1HH0 A;  3CLQ A;  4Y99 C;  2IFN A;  1JO5 A;  4EIJ A;  3NTN A;  5AW6 B;  3OAK A;  1JY3 N;  2FFD C;  2CPS A;  2OYH B;  1Z56 A;  1URQ C;  2KB7 P;  2E42 A;  5AW1 B;  3KPE A;  2YO3 A;  2KYV A;  3O8Z A;  1HGV A;  2H43 A;  3VMY A;  1M1J C;  1KIL A;  3G3Z A;  1SQV K;  1NKN A;  3BVH A;  1LTT C;  1DH3 A;  3KYQ A;  1RF1 C;  3CL3 D;  1JMM A;  3LID A;  1J1D B;  1H88 A;  1ZR4 A;  5APX A;  4XA4 A;  5CCG D;  1X8Y A;  2WWW A;  5APV A;  3BRT B;  1M1J B;  1G2C B;  2HPC B;  4IFD K;  2W27 A;  2YO2 A;  3TNU A;  3MD0 A;  2PAJ A;  1URQ B;  2M3B A;  4LGD E;  1DEB A;  3OJA B;  3L37 A;  3BAT A;  1JNM A;  4LLH A;  1LT9 C;  1LT9 B;  3M0A A;  3VP8 A;  1NHL A;  5CCG A;  1GU5 A;  4WB4 A;  2GM4 A;  2BAS A;  1LTG C;  3A7O A;  4KHX A;  1ZR2 A;  4M3L A;  3M0D C;  2WPS A;  5AW3 B;  1ZLL A;  4WY4 D;  2N9B A;  1HJB A;  1RF1 B;  3U59 A;  2E43 A;  1KFM A;  3RK2 C;  3HD7 B;  5KJ7 C;  3VYI A;  2WTY A;  1HUC A;  2WT7 B;  1LTB C;  2YNY A;  1L4A B;  1HBW A;  3E1I A;  1JCC A;  2N1T D;  5KLV K;  5CMZ A;  2HOD A;  2XV5 A;  1MZ9 A;  3RK3 D;  1XTG B;  3B5N A;  2HFE D;  2YKP A;  3A5T A;  1IFN A;  1N7L A;  2WSC H;  1HGZ A;  2P2U A;  5AVT B;  1MFZ A;  1SFC C;  1L4A A;  2A45 I;  2A45 G;  2NPS D;  2WPR A;  3RK3 C;  2WT7 A;  3EQ2 A;  4WBA A;  1GU4 A;  5CCG C;  3UIA A;  3B5N D;  2OYI A;  2XU6 A;  5APT A;  1X79 B;  2ZFC A;  3I5C A;  1H89 A;  1G2C A;  1LWU A;  3HE5 A;  5APY A;  1T8Z A;  1JOC A;  1ZV8 A;  2Z4E A;  1L4A D;  3A3Y B;  2FYU K;  4C7R A;  4W7Y A;  1LTA C;  3V2R A;  3RK2 D;  1GL2 B;  1HVV A;  1FOS E;  1SQQ K;  1VPC A;  3VMZ A;  1L0N K;  1JUN A;  3BAS A;  3EFG A;  1KIL B;  4I2L C;  5KJ7 A;  4GT1 A;  2W6A A;  1IK9 A;  4GKG A;  2P1J A;  1YTZ I;  4N78 E;  5AW8 B;  1SQB K;  2N1T C;  2N1T B;  2O1J A;  2POH A;  4EOT A;  3N4X A;  1FZF A;  3H32 A;  5APS A;  3SWY A;  4HH2 A;  1DX7 A;  2MJZ A;  3M06 A;  5KJ7 D;  3B5N C;  4ZKP A;  3HTK A;  1FDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...