2MJZA

Capsid model of m13 bacteriophage virus from magic-angle spinning nmr and rosetta modeling
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein G8P
publication title The NMR-Rosetta capsid model of M13 bacteriophage reveals a quadrupled hydrophobic packing epitope.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 24
structure length 50
sequence length 50
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X, Y, Z, a, b, c, d, e, f, g, h, i
ec nomenclature
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2mjzA00
1HGZA 1IFJA 1IFDA 2CPSA 1FDMA 1NH4A 1IFIA 2MJZA 2CPBA 2C0XA 1HH0A 1HGVA 2C0WA
chains in the Genus database with same CATH superfamily
1IFDA 5CCGA 3BRTB 3MHVA 1YQ4C 2O01J 4YPCA 3H1KJ 4PV1D 1PL5A 1M7LA 2IBZD 2KSJA 4N6JA 3H1LE 1FZCB 3GHGB 2KZJA 3I5CA 1K8AQ 1HH0A 1SQXK 3TNUB 1SQBG 4JYCA 1SQVD 1RH5B 1CSBA 4KJMA 1E5WA 3PHLA 2D2CD 4QMAA 3H1ID 4PD4D 4OVNF 1KILC 3FXDA 1SQXE 3FGAD 1GL2B 1FDOA 1NJIQ 3MZWB 1ZXGA 1A02J 3AE7C 1NTZD 1S2EA 2FBWC 1N73A 3MUDA 3L75E 4HYTB 2HODA 2R44A 4M3LA 3S1KA 1N2DC 1VQ6P 1A02F 2IFMA 2HPCA 1SQVJ 4A7PA 4JBZA 1LJ2A 2I1KA 4GOFA 3P8MC 5AVRB 3P7KA 2H43A 2P10A 1N86A 4EOTA 2IYPA 3V2QA 3VMYA 4H0LC 1RF0C 3RL0D 2ZVOB 3FXEA 1N8RQ 1BCCE 3Q3DA 1K05A 2KLVA 1W2BO 2KSEA 3HD7C 3AEAC 2W6AA 3B5ND 1NTZJ 2QM7A 1JB0J 2M3EA 2KUBA 4IL6X 5GTHH 5CMZA 3HTKA 3CWBE 1X0TA 3AEFC 1AQTA 2WPSA 3GMAA 1CZQA 4XFJA 1JTHA 3L73E 3B5NB 2FYUK 4D6TE 1EDLA 3GW6A 4Y99C 2WSEH 1URQD 1ZRTD 1KILB 3M91A 4L76A 1KC8Q 1YYCA 2OTJP 4WBAA 2L5GB 2FYZA 3L71E 4L73A 4I1LA 4L75A 1KQLA 5B5EH 2BEZF 5H2FH 1H8AA 1GK4A 1RHZB 3HRNA 2AEMA 2IPPA 3EFFK 4NPDA 1SVFA 3CXHH 1NTKK 4JYBA 2Y0CA 3BCCG 1AA0A 3P8CD 2I1JA 3CC7P 1EDIA 3KXDA 3L74G 2BCCE 1J1EB 2O01H 3SFEC 1DEBA 5KLIC 3CX5H 1P84E 3A0HE 4CPGA 4H44D 1VL2A 1X8YA 2MJZA 3HE5A 1KZUB 1SQBD 4IL6H 1JY2P 4O9BA 4ZKPA 1G2CA 2GUSA 1ZR2A 2E74C 3CCRP 1NU1D 3M0DA 1GW3A 1NO4A 1BGYE 5TISH 1RF1A 3A2AA 1LNQA 3PTZA 5C39A 3CL3D 4IFMA 3RK2C 5APTA 3USSA 1J1DB 2YIUB 2WVRA 5CCHA 1KFNA 3ZDMA 2IBZE 3RGUA 3PLNA 1NU1J 1EZVG 1PP9D 2WT7A 3AE4C 1MUUA 3BVHA 2WSCJ 4K3AA 3ABVC 4KHXA 2Q7CA 2XNDH 2LR2A 1SQVE 1Q2NA 3NMDA 1S5LE 1OIPA 3UIAA 2E75D 4TT3H 3H1IE 5KAFE 1OX3A 4PD4E 3A0BE 1VF5C 2FYNC 5KLVG 1KYOD 1VQ7P 3CMEP 1S72P 3AE3C 1FZGA 3BRVB 1PGPA 3G3ZA 2WPRA 2A06G 1PP9J 3AE5C 4HB1A 3U1CA 1VPCA 4HJGH 1NTZE 3M0AA 1NGMB 4MN4C 1T2KD 1L4AD 4ASWA 2E75B 3RK2B 3V5BA 3AEDC 5AW5B 3RBZA 2QVAA 5KKZC 2FFDB 4B86A 4WY4C 1J2JB 3WU2E 5AVWB 5KTBA 1K73Q 1IFMA 1MKMA 1HVVA 1P84I 2OYHA 2YMYA 2WQYC 5AW3B 4EIJA 3SWKA 3TDKA 3II6A 4N78D 1PPJG 4H13D 3L74D 1FZCA 1OW8A 2B88A 4C7NB 1KILE 1IZNB 2HFED 2GUVA 1SQXD 4L74A 3H1LJ 2P7JA 2H88C 2KNCB 5E79H 3TNUA 5AW1B 4WB4A 3R2PA 3L75D 2K9JA 2B87A 1VF5B 2FYNB 1ZRTE 2YKQA 3CLQA 2IZ0A 1X79B 3W67A 2GA1A 5AW8B 2YXRB 3AE9C 2G8YA 2IBZI 2KS1A 1HGZA 3TGUD 1M8OB 1NAYA 3G9RA 5APYA 1SQXJ 1BCCD 5KKZB 1N7SD 1DD3A 4WY4B 2H7HA 3NXSA 1KB9D 1Q82Q 3L75J 2P58A 3P8CE 3A3YB 3G71P 2ZJSE 4KT0J 4PD4I 1Q90D 2Q6QA 5APSA 1JY2O 1OMIA 2C0XA 1LP1B 1LWUA 1X22A 3OW2O 1SQBE 4OWFA 1BCCJ 2Q1KA 1SFCD 2WSCH 2O01N 1KQSO 3S9OA 1RQVA 2JDIH 1S3JA 2FYUD 3MIWA 1PIXA 2IDBA 3B5NA 2N9BA 4C7RA 5AW9B 1WMKA 4R4MA 1YJ9P 1SQPK 1MZ9A 4D6TJ 1JY3P 2Y0EA 2W90A 1BDDA 2N1TC 5KJ7D 1RE4A 1IO4A 2AEJA 3VN0A 1PP9E 3O6QB 3H1HG 3M9BA 1URQA 1NTKD 2M5AB 2C0WA 2JR8A 3EFGA 2QIWA 1L0NG 2WPQA 2FYUJ 1JNMA 3TYYA 1YTZI 2JJLA 2WMMA 1BGYD 4EDFA 1PPJD 3F5HA 2QJKB 1KYOE 1IJDB 1D7MA 1CI6A 1ZOYC 4OGQC 2O3JA 2BCCJ 5APWA 3CCUP 4ZMDA 2L91A 1XTGB 1NTKJ 3L36A 4BRYB 1SQQK 5APVA 2QM8A 2OQQA 3CCEP 1H0TB 3AE2C 1BGYJ 1NTMK 1LT9A 2N1TB 1LTJC 1NOHA 2KB7P 1RE3C 3KDPB 1GL2D 1U7JA 1OVRA 2DW3A 5DJTB 3L72D 3AE6C 3BCCE 3L70G 3TF5A 2P2UA 5BVZA 4N78E 3L74E 3D6ZA 3RL0C 3U1AA 3Q1MA 2H8PD 4AQRD 3WUVA 3OAKA 1FZAA 4I7ZC 3KZIE 1YIJP 4OGQB 1Q7YQ 1ZW0A 1LTBC 2J59M 3RK3B 1OWAA 1SLQA 2E43A 3HUSA 2M0BA 1HGVA 1PFIA 2A45G 2O1KA 4RJTA 1SQPG 3H1IJ 3JC22 5APXA 3TGUE 1X9VA 1QX8A 3HE4A 3VMAA 3B71A 5AVQB 2Q9IA 3C1LA 1Q81Q 1KB9E 2R32A 1K04A 4DZOA 2OYIA 2FFDA 2KZIA 1LTJB 1NAFA 3LIEA 1KILD 3C9IA 3SWYA 1BE3D 2QA4P 1L0LK 3AE8C 1L4AA 1EC5A 1KYOI 1EXIA 1AVOA 2SPZA 2K3RA 5KLVK 1LTIC 1GMJA 1M1JC 2NPSC 4LC1A 5CCGC 3CMAP 3V2RA 2ZYGA 4H0LD 5KLVE 2FYUE 2CK3H 4I7ZB 3KPEA 4PJ0E 3PP5A 1SQQG 1FBMA 4WWIA 1JY3O 2M8RA 1OXZA 2A06E 1BE3J 3HD7D 1M57D 4RKUJ 1M90Q 1WRGA 3FX0A 5DJUB 2ZAEB 2KIKA 2N9YB 1NTMG 4H0LB 3L4FA 2IX7C 2QG4A 1KD1Q 1NHLA 1S5LX 3V4QA 2AXTH 1P84H 3E1RA 3HD7B 3A0HH 3VP9A 1YJWP 1IFNA 1HUCA 1H89A 4GOEA 1IC2A 1NTKE 2WZ7A 2AXTE 1KORA 5EFWB 3EQ2A 5L8RJ 2LXCB 1N73C 3MUDC 4EI2A 1PPJE 2FXOA 2GM4A 4Y99B 1M1JB 2NPSB 3AECC 1N7SA 3FWLA 3T97A 1JMBA 1ZN5A 1JCCA 2JP3A 3RL0g 1LP1A 3W68A 1HWTC 1NKZB 2V7QJ 1L2PA 1QL1A 5CBOA 4U3FG 2YO2A 1RQUA 3VMXA 1SQBJ 1KB9I 4C46A 3LW5J 3F89A 3VYIA 3H1JG 3NTNA 3QWOC 2K9YA 2Z5IA 1SQPD 1SFCA 3PH0A 5AVUB 2Q3IA 3OJAB 3CD6P 2E74D 1S5LH 3CWBG 3K5BA 4R4LA 1NYHA 2BEQD 3L72E 5KAFH 4PD4H 5KLIB 3A0BH 1L0LG 2PAJA 3B8EB 2QRXA 2PGDA 3L73G 2R5BA 3RK2D 3TSIA 3CC4P 3IF4A 3O6QA 4D6TG 1USDA 1U57A 3B4SA 4K35A 4UB6E 4HKZH 1KQFB 1N73B 2E74B 3RK3E 4DT0A 4ZKUA 4OH8B 1EXJA 3E1IA 1GK6A 1Z56A 3PRJA 5AVVB 5KJ7A 1ZMEC 3R4YA 1W2EA 3L71G 4H13C 2Y0DA 1KN7A 5AW6B 4NPFX 3WU2H 1YHQP 3CCMP 2QJYC 1YITP 1LTAC 1FZFA 3V2PA 1IFIA 1AJYA 1SQQD 1AFOA 2J5UA 2VRSA 4W7ZA 3WUTA 3CC2P 2ZXEB 4JQ0D 4ZNCA 3SWFA 1JY2N 3BCCD 1VQ9P 1L0NK 3HTKB 1NTMD 1VF5D 1FE6A 3GHGA 5AVTB 4UB8E 5BU5A 1EDKA 2ZFCA 3M0DC 3H1KG 1T8ZA 1RF1C 1BE3E 5GTIE 4LLHA 3H1HE 3M9HA 4NPEA 2WITA 1L0NE 5CJ4A 3CPWO 1KMIZ 1DX7A 2RN0A 2HR3A 1JO5A 1KTMA 1GD2E 2RMZA 2B9BA 3SFDC 2FXMA 2XNXA 3BCCJ 4WY4D 2E5TA 3GF3A 1VQ5P 5CCHC 2QE7H 1GL2A 3L74J 1VQOP 2E5YA 2RH0A 1FJKA 2IYOA 1CW5A 3CCLP 2QEXP 2J58A 2Y9ZA 2KK7A 1VQPP 4U3FD 2ZT9C 3L35A 3KQGA 5CBNA 5AVZB 1RY3A 4N3YB 2XU6A 1YJNP 2V7QH 1EZVD 4GODA 5KAIE 3I56P 1JUNA 1SQVG 3HE5B 1QL2A 2PP6A 4ASVA 1S4XA 3LW5H 5AW4B 4TLFA 2KLUA 3TGUJ 5M1BA 4W80A 1HJBA 1RF1B 2W6JH 2POHA 3L70E 1ZP0C 1L0LD 2WTYA 5AW2B 2OTLP 1VQKP 2Z5HA 1YQ3C 1NTZG 5KLVD 3AEEC 2A06D 2XZRA 2ZVNB 2LXBA 4GDOA 2UWJE 1FOSE 1KILA 1FC2C 1E79H 2OGUA 3MTUE 2OYHC 2WT7B 2G3AA 1XTCC 3E7KA 1PGQA 1VDFA 3L37A 3JCUE 2E76C 3P32A 1FZCC 1LTGC 2IZ1A 1ZR4A 1DEEG 2ZT9B 4LGDE 1SQPE 4Y28J 1QEXA 5KLVJ 2JWDA 2R5DA 2XKMA 1NWQA 3CXHD 4PV1C 3G4SP 1IK9A 3O8ZA 2C9LY 3VOPA 1RF0A 1KQGB 1QVFO 1KYOH 4YXDC 4DJGA 3U59A 3HD7A 4JF7A 5B66E 3H1KD 2MKVA 3CX5D 2KXPB 2YKPA 4JPZB 3N7NA 1PGOA 2JWAA 2XV5A 3IFMA 1T3JA 3VP8A 4RESB 1YTZT 1WT6A 3IAOA 1ZLLA 2D2CC 2N1TD 5AVSB 1FAVA 1JM0A 3GF7A 1IK7A 2AXCA 1VQNP 3WUUA 3H6PA 2OYHB 3D71A 1SQQE 3H32B 2W27A 2K1AA 2E76B 1LWUC 2ZYDA 1NTME 1G1JA 1Q86Q 4YXWH 1OVUA 4PV1B 4OGQD 1MFTA 2M3BA 3RK3D 1AVYA 2K9JB 2B87B 5AW7B 2W8ZA 3KZIH 1NU1G 1OZHA 3IN6A 3B5NC 3WMM0 3MD0A 2PRRA 3C8VA 2WSFJ 2R3CA 1OVVA 1JY3N 2V4HA 5K5GB 2KS1B 2FXPA 1S1CX 1NVOA 1R8EA 3L72J 1DD4A 1VQMP 3GLMA 4IFFA 1M1KQ 1GTWA 4XE5B 1RE4C 2D2CB 1QLED 1GW4A 2A45I 1FZEA 1YI2P 3G6EP 5APQA 1KB9H 1URQC 3EWKA 1FU1A 1Y47A 1FJPA 3S4RA 1PP9G 4U3FE 4GT1A 4U7JA 3H1JE 3IR9A 1EZVE 2O1JA 1LWUB 1J1EC 3H1HD 2Y9YA 1L0ND 1HJ0A 3TK1A 3RL0B 4HH2A 3A5TA 1L0LE 5GTHE 4C7NA 4PJ0H 2PFXA 3Q5RA 1GU5A 1NKNA 1UIIA 2IFNA 2LKMA 2KNCA 4H44C 1LT9C 1FDMA 1J1DC 3H1HJ 5BU8B 1OW6A 3H1LG 1LT1A 2CPSA 1L0NJ 2JEEA 2YIUC 2YNYA 3CCQP 1VQ8P 2KI7B 1JMMA 1URQB 2K88A 1TU3F 1ZV8A 1YBKA 4EYYQ 5B5EE 5H2FE 1GU4A 1PGJA 2NPSD 3CXHE 4WY4A 3JSVC 5CCGD 3L70D 1SQXG 1SP4A 4AYCA 2XDJA 1S9KE 3CCJP 2E42A 3NFQA 5AVXB 1CI6B 2FY8A 3MGNA 3H1KE 3L75G 3M06A 2RKLA 3CX5E 5AVYB 3HUSC 2QSIA 1Y8AA 1U7MA 3FWNA 1DH3A 4RO0A 4IL6E 2OTKE 2YKOA 2Z4EA 2E75C 4H44B 1BDCA 1BSHA 5TISE 3TGUG 1PZQA 5CJ0A 2YMKA 1LT9B 3A7OA 1NH4A 4AUWA 2BASA 3L70J 3Q5SA 1BCCG 3CI9A 2OYIC 2WSFH 2FFDC 1EZVI 2ZYAA 2I8DA 4IFDK 3GG2A 1HBWA 1T2KC 1OW7A 1L4AC 2OARA 5TJHA 1SQVK 1T3UA 1W5CE 3BASA 3M9QA 1R5LA 4UB6H 3KHUA 1MV8A 1FOSF 3ITKA 1UIXA 2M5AA 5CHXA 2HG5D 2JKVA 2HODB 1NTZK 1SQPJ 3Q2YA 2HPCB 1FZBA 1DIPA 2R3SA 2FYUG 3HUSB 3SSUA 2CPBA 2KOGA 2WPVB 2YO3A 3HE4B 4I6MC 5APUA 3PJSK 1MFZA 3AEGC 1GZLA 1N7LA 4BRYA 3V4WA 2OYIB 3CXHI 3H1LD 1LTSC 2P1JA 2BCCG 4UB8H 2NZ2A 2HLOA 1LTTC 2ITAA 2WSSH 1NTKG 5GTIH 1H0TA 1L4AB 1JTHB 3BATA 1AQ5A 1OFCX 1K9MQ 3OA7A 2NRGA 2N1TA 3CX5I 3H32A 3I55P 1HF9A 3VTPC 1EQ7A 1N7SC 1BGYG 4I2LC 1SQQJ 1KV4A 1JOCA 1AV1A 3KYQA 1NTMJ 2WWWA 4GIFA 2H89C 3D70A 2Q5UA 3H25A 4H13B 5E79E 3QH9A 1GDTA 4YTPC 4DOJA 2QJYB 2IBZG 3CCSP 1SFCC 2JO1A 1G1IA 2AEFA 3VMZA 3CCVP 4XA4A 2Q3EA 5KAIH 4IOIH 1IFPA 1IFJA 3H1JD 2P67A 3LIDA 2W83C 1LGHB 3V6IA 2KP8A 1EDJA 1VQLP 3L72G 1G2CB 1SS1A 2FKWB 1VQ4P 1SQBK 3RBXA 3H1IG 2KYVA 3CWBD 2ZXXA 2OYOA 5KJ7C 1NU1K 1LTJA 2QJPC 5CCHD 1N7SB 1FS0E 4BWNA 1RE3A 4U3FJ 3L73D 3T97B 4Z1MH 4D6TD 2QJKC 5AW0B 3H1JJ 3AEBC 4W7YA 3AE1C 1NU1E 4WVZA 2ZT9D 3L71D 4BXLA 4DCKA 3JCUH 2HYNA 3CWBJ 2A45H 1M56D 3N4XA 1SFCB 1L0LJ 3GHGC 3L73J 3V2NA 1KFMA 1HTLC 3MP7B 1JEKA 1PV3A 1T6AA 4GKGA 1QGKB 2BCCD 2WSEJ 1QVGO 1BE3G 5B66H 1BSNA 1S9KD 1P84D 3L71J 2YXQB 1H88A 2QJPB 1GL2C 1Y9BA 3D6YA 1R5SA 1USEA 1FDIA 2C9NY 2K37A 2B89A 3Q5PA 2W6BA 1JCDA 2E76D 1M1JA 2NPSA 3RK3C
chains in the Genus database with same CATH topology
2PAJA 1IFDA 3B8EB 5CCGA 3BRTB 2R5BA 1GU5A 3RK2D 1NKNA 3P8CE 3TSIA 2IFNA 2LKMA 3A3YB 1M7LA 1LT9C 2KSJA 1N73B 1FDMA 4N6JA 1J1DC 5APSA 1FZCB 1JY2O 3GHGB 4ZKUA 5BU8B 4OH8B 3E1IA 1GK6A 2CPSA 1Z56A 2JEEA 3I5CA 2YNYA 5AVVB 5KJ7A 2C0XA 1HH0A 1LWUA 1W2EA 1SQXK 3TNUB 1JMMA 1URQB 4JYCA 1SFCD 5AW6B 1CSBA 1ZV8A 1E5WA 2WSCH 1GU4A 1LTAC 1FZFA 3V2PA 2NPSD 1IFIA 1AFOA 3MIWA 4WY4A 2VRSA 4W7ZA 5CCGD 3B5NA 1KILC 2N9BA 2ZXEB 4C7RA 1GL2B 3SWFA 5AW9B 1JY2N 1SP4A 1L0NK 1SQPK 3HTKB 2XDJA 1MZ9A 4AYCA 1S9KE 1A02J 2E42A 3NFQA 5AVXB 1CI6B 1N73A 3MUDA 1JY3P 4HYTB 2HODA 3MGNA 3GHGA 2N1TC 3M06A 4M3LA 5AVTB 5BU5A 2ZFCA 3M0DC 5AVYB 1N2DC 1T8ZA 5KJ7D 3HUSC 1RE4A 1A02F 2IFMA 2HPCA 1RF1C 1IO4A 1DH3A 4LLHA 3VN0A 2I1KA 3P8MC 3M9HA 5AVRB 3P7KA 2WITA 2H43A 2YKOA 1N86A 3M9BA 2Z4EA 1URQA 4EOTA 5CJ4A 2C0WA 1DX7A 3EFGA 2WPQA 1JNMA 3V2QA 3VMYA 1RF0C 3RL0D 1JO5A 5CJ0A 1LT9B 3A7OA 1NH4A 1GD2E 4AUWA 2BASA 2KLVA 3TYYA 2FXMA 3HD7C 2XNXA 3CI9A 1YTZI 2WSFH 4WY4D 2W6AA 2OYIC 2JJLA 2FFDC 3B5ND 5CCHC 2QM7A 4IFDK 1GL2A 1HBWA 1T2KC 1FJKA 1L4AC 2OARA 5CMZA 3HTKA 1CW5A 1IJDB 1SQVK 1CI6A 2WPSA 2J58A 5APWA 1T3UA 1CZQA 1JTHA 3BASA 1XTGB 3L36A 3M9QA 3B5NB 3L35A 1SQQK 3KQGA 2FYUK 1MV8A 4Y99C 5AVZB 2WSEH 1RY3A 4N3YB 1URQD 1FOSF 1KILB 2XU6A 5CHXA 2HG5D 5APVA 2QM8A 1JUNA 2HODB 3M91A 3HE5B 1NTZK 1YYCA 1NTMK 1QL2A 2PP6A 1LT9A 4WBAA 2HPCB 2L5GB 3LW5H 5AW4B 2FYZA 1FZBA 2N1TB 4I1LA 1LTJC 1NOHA 1KQLA 2KB7P 3HUSB 1H8AA 1GK4A 3HRNA 4W80A 1HJBA 1RE3C 1RF1B 3KDPB 1GL2D 2CPBA 2IPPA 2POHA 2KOGA 2YO3A 3HE4B 2WTYA 1SVFA 1NTKK 4JYBA 5AW2B 4I6MC 2P2UA 5APUA 2Z5HA 5BVZA 4N78E 1MFZA 3P8CD 2I1JA 1GZLA 1N7LA 3RL0C 3U1AA 2XZRA 3V4WA 1J1EB 2O01H 2OYIB 2H8PD 1LTSC 2P1JA 4AQRD 1DEBA 1FOSE 1KILA 2HLOA 1LTTC 3OAKA 2OYHC 3MTUE 1FZAA 1L4AB 2WT7B 1X8YA 2MJZA 3HE5A 1KZUB 1XTCC 1JTHB 1JY2P 3BATA 1AQ5A 4O9BA 1VDFA 4ZKPA 1G2CA 2GUSA 3OA7A 3L37A 1LTBC 1ZR2A 2J59M 2N1TA 3RK3B 1OWAA 1SLQA 3H32A 3M0DA 3P32A 1FZCC 1LTGC 2E43A 1GW3A 3VTPC 1ZR4A 1EQ7A 1NO4A 1N7SC 3HUSA 1RF1A 4LGDE 3A2AA 1HGVA 1PFIA 2A45G 3CL3D 2O1KA 4I2LC 4IFMA 2R5DA 5APXA 1X9VA 1JOCA 2XKMA 1NWQA 3HE4A 3RK2C 5APTA 5AVQB 1J1DB 2Q9IA 1IK9A 3O8ZA 2C9LY 3VOPA 3KYQA 1RF0A 2R32A 2WWWA 4GIFA 3U59A 3HD7A 4JF7A 2Q5UA 4DZOA 2OYIA 2FFDA 1LTJB 1NAFA 3LIEA 1KILD 3C9IA 5CCHA 2YKPA 1GDTA 1KFNA 3N7NA 3SWYA 4DOJA 2XV5A 3IFMA 1L0LK 1T3JA 3VP8A 1SFCC 1L4AA 4RESB 2WT7A 1G1IA 1YTZT 1WT6A 1MUUA 3VMZA 5KLVK 1LTIC 1ZLLA 2N1TD 4XA4A 3BVHA 1M1JC 5AVSB 2NPSC 1FAVA 4LC1A 4KHXA 1IFJA 2Q7CA 2P67A 3LIDA 1LGHB 5CCGC 3NMDA 3V2RA 2KP8A 1G2CB 3H6PA 2OYHB 3UIAA 2FKWB 1SQBK 3KPEA 3H32B 3PP5A 1FBMA 2KYVA 1JY3O 2M8RA 1FZGA 1OXZA 3BRVB 2W27A 3HD7D 5KJ7C 3G3ZA 1NU1K 2WPRA 1LTJA 1LWUC 5CCHD 1N7SB 1WRGA 1RE3A 3U1CA 1VPCA 3M0AA 1T2KD 1G1JA 1L4AD 3RK2B 5AW0B 3V5BA 3L4FA 2IX7C 5AW5B 1NHLA 4W7YA 3V4QA 2M3BA 3HD7B 3RK3D 3VP9A 2FFDB 1IFNA 5AW7B 1HUCA 4B86A 4WY4C 1H89A 1IC2A 2WZ7A 1J2JB 3B5NC 5AVWB 3MD0A 3WMM0 5KTBA 2HYNA 2R3CA 1IFMA 1HVVA 1JY3N 2A45H 2OYHA 3EQ2A 2YMYA 3N4XA 1SFCB 1N73C 5AW3B 3GHGC 4EIJA 4IFFA 3V2NA 1GTWA 1KFMA 4XE5B 1RE4C 3II6A 2GM4A 1HTLC 4N78D 4Y99B 1M1JB 1GW4A 2NPSB 1FZCA 2A45I 1N7SA 4C7NB 1FZEA 2HFED 2GUVA 3T97A 5APQA 1ZN5A 1JCCA 1URQC 4GKGA 1FU1A 2P7JA 1FJPA 1HWTC 1NKZB 1S9KD 4GT1A 3TNUA 5AW1B 4WB4A 1QL1A 3R2PA 2YO2A 3VMXA 4C46A 2YKQA 3CLQA 1X79B 1H88A 3IR9A 3VYIA 5AW8B 1GL2C 3NTNA 2O1JA 1LWUB 1J1EC 2Z5IA 2C9NY 1HGZA 1SFCA 5AVUB 2Q3IA 3OJAB 3TK1A 2W6BA 5APYA 3RL0B 1JCDA 4HH2A 1M1JA 3A5TA 2NPSA 1N7SD 3RK3C 4C7NA 2H7HA 4WY4B 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGZ A;  1IFJ A;  1IFD A;  2CPS A;  1FDM A;  1NH4 A;  1IFI A;  2MJZ A;  2CPB A;  2C0X A;  1HH0 A;  1HGV A;  2C0W A; 
#chains in the Genus database with same CATH topology
 1IFD A;  5CCG A;  3BRT B;  3MHV A;  1YQ4 C;  2O01 J;  4YPC A;  3H1K J;  4PV1 D;  1PL5 A;  1M7L A;  2IBZ D;  2KSJ A;  4N6J A;  3H1L E;  1FZC B;  3GHG B;  2KZJ A;  3I5C A;  1K8A Q;  1HH0 A;  1SQX K;  3TNU B;  1SQB G;  4JYC A;  1SQV D;  1RH5 B;  1CSB A;  4KJM A;  1E5W A;  3PHL A;  2D2C D;  4QMA A;  3H1I D;  4PD4 D;  4OVN F;  1KIL C;  3FXD A;  1SQX E;  3FGA D;  1GL2 B;  1FDO A;  1NJI Q;  3MZW B;  1ZXG A;  1A02 J;  3AE7 C;  1NTZ D;  1S2E A;  2FBW C;  1N73 A;  3MUD A;  3L75 E;  4HYT B;  2HOD A;  2R44 A;  4M3L A;  3S1K A;  1N2D C;  1VQ6 P;  1A02 F;  2IFM A;  2HPC A;  1SQV J;  4A7P A;  4JBZ A;  1LJ2 A;  2I1K A;  4GOF A;  3P8M C;  5AVR B;  3P7K A;  2H43 A;  2P10 A;  1N86 A;  4EOT A;  2IYP A;  3V2Q A;  3VMY A;  4H0L C;  1RF0 C;  3RL0 D;  2ZVO B;  3FXE A;  1N8R Q;  1BCC E;  3Q3D A;  1K05 A;  2KLV A;  1W2B O;  2KSE A;  3HD7 C;  3AEA C;  2W6A A;  3B5N D;  1NTZ J;  2QM7 A;  1JB0 J;  2M3E A;  2KUB A;  4IL6 X;  5GTH H;  5CMZ A;  3HTK A;  3CWB E;  1X0T A;  3AEF C;  1AQT A;  2WPS A;  3GMA A;  1CZQ A;  4XFJ A;  1JTH A;  3L73 E;  3B5N B;  2FYU K;  4D6T E;  1EDL A;  3GW6 A;  4Y99 C;  2WSE H;  1URQ D;  1ZRT D;  1KIL B;  3M91 A;  4L76 A;  1KC8 Q;  1YYC A;  2OTJ P;  4WBA A;  2L5G B;  2FYZ A;  3L71 E;  4L73 A;  4I1L A;  4L75 A;  1KQL A;  5B5E H;  2BEZ F;  5H2F H;  1H8A A;  1GK4 A;  1RHZ B;  3HRN A;  2AEM A;  2IPP A;  3EFF K;  4NPD A;  1SVF A;  3CXH H;  1NTK K;  4JYB A;  2Y0C A;  3BCC G;  1AA0 A;  3P8C D;  2I1J A;  3CC7 P;  1EDI A;  3KXD A;  3L74 G;  2BCC E;  1J1E B;  2O01 H;  3SFE C;  1DEB A;  5KLI C;  3CX5 H;  1P84 E;  3A0H E;  4CPG A;  4H44 D;  1VL2 A;  1X8Y A;  2MJZ A;  3HE5 A;  1KZU B;  1SQB D;  4IL6 H;  1JY2 P;  4O9B A;  4ZKP A;  1G2C A;  2GUS A;  1ZR2 A;  2E74 C;  3CCR P;  1NU1 D;  3M0D A;  1GW3 A;  1NO4 A;  1BGY E;  5TIS H;  1RF1 A;  3A2A A;  1LNQ A;  3PTZ A;  5C39 A;  3CL3 D;  4IFM A;  3RK2 C;  5APT A;  3USS A;  1J1D B;  2YIU B;  2WVR A;  5CCH A;  1KFN A;  3ZDM A;  2IBZ E;  3RGU A;  3PLN A;  1NU1 J;  1EZV G;  1PP9 D;  2WT7 A;  3AE4 C;  1MUU A;  3BVH A;  2WSC J;  4K3A A;  3ABV C;  4KHX A;  2Q7C A;  2XND H;  2LR2 A;  1SQV E;  1Q2N A;  3NMD A;  1S5L E;  1OIP A;  3UIA A;  2E75 D;  4TT3 H;  3H1I E;  5KAF E;  1OX3 A;  4PD4 E;  3A0B E;  1VF5 C;  2FYN C;  5KLV G;  1KYO D;  1VQ7 P;  3CME P;  1S72 P;  3AE3 C;  1FZG A;  3BRV B;  1PGP A;  3G3Z A;  2WPR A;  2A06 G;  1PP9 J;  3AE5 C;  4HB1 A;  3U1C A;  1VPC A;  4HJG H;  1NTZ E;  3M0A A;  1NGM B;  4MN4 C;  1T2K D;  1L4A D;  4ASW A;  2E75 B;  3RK2 B;  3V5B A;  3AED C;  5AW5 B;  3RBZ A;  2QVA A;  5KKZ C;  2FFD B;  4B86 A;  4WY4 C;  1J2J B;  3WU2 E;  5AVW B;  5KTB A;  1K73 Q;  1IFM A;  1MKM A;  1HVV A;  1P84 I;  2OYH A;  2YMY A;  2WQY C;  5AW3 B;  4EIJ A;  3SWK A;  3TDK A;  3II6 A;  4N78 D;  1PPJ G;  4H13 D;  3L74 D;  1FZC A;  1OW8 A;  2B88 A;  4C7N B;  1KIL E;  1IZN B;  2HFE D;  2GUV A;  1SQX D;  4L74 A;  3H1L J;  2P7J A;  2H88 C;  2KNC B;  5E79 H;  3TNU A;  5AW1 B;  4WB4 A;  3R2P A;  3L75 D;  2K9J A;  2B87 A;  1VF5 B;  2FYN B;  1ZRT E;  2YKQ A;  3CLQ A;  2IZ0 A;  1X79 B;  3W67 A;  2GA1 A;  5AW8 B;  2YXR B;  3AE9 C;  2G8Y A;  2IBZ I;  2KS1 A;  1HGZ A;  3TGU D;  1M8O B;  1NAY A;  3G9R A;  5APY A;  1SQX J;  1BCC D;  5KKZ B;  1N7S D;  1DD3 A;  4WY4 B;  2H7H A;  3NXS A;  1KB9 D;  1Q82 Q;  3L75 J;  2P58 A;  3P8C E;  3A3Y B;  3G71 P;  2ZJS E;  4KT0 J;  4PD4 I;  1Q90 D;  2Q6Q A;  5APS A;  1JY2 O;  1OMI A;  2C0X A;  1LP1 B;  1LWU A;  1X22 A;  3OW2 O;  1SQB E;  4OWF A;  1BCC J;  2Q1K A;  1SFC D;  2WSC H;  2O01 N;  1KQS O;  3S9O A;  1RQV A;  2JDI H;  1S3J A;  2FYU D;  3MIW A;  1PIX A;  2IDB A;  3B5N A;  2N9B A;  4C7R A;  5AW9 B;  1WMK A;  4R4M A;  1YJ9 P;  1SQP K;  1MZ9 A;  4D6T J;  1JY3 P;  2Y0E A;  2W90 A;  1BDD A;  2N1T C;  5KJ7 D;  1RE4 A;  1IO4 A;  2AEJ A;  3VN0 A;  1PP9 E;  3O6Q B;  3H1H G;  3M9B A;  1URQ A;  1NTK D;  2M5A B;  2C0W A;  2JR8 A;  3EFG A;  2QIW A;  1L0N G;  2WPQ A;  2FYU J;  1JNM A;  3TYY A;  1YTZ I;  2JJL A;  2WMM A;  1BGY D;  4EDF A;  1PPJ D;  3F5H A;  2QJK B;  1KYO E;  1IJD B;  1D7M A;  1CI6 A;  1ZOY C;  4OGQ C;  2O3J A;  2BCC J;  5APW A;  3CCU P;  4ZMD A;  2L91 A;  1XTG B;  1NTK J;  3L36 A;  4BRY B;  1SQQ K;  5APV A;  2QM8 A;  2OQQ A;  3CCE P;  1H0T B;  3AE2 C;  1BGY J;  1NTM K;  1LT9 A;  2N1T B;  1LTJ C;  1NOH A;  2KB7 P;  1RE3 C;  3KDP B;  1GL2 D;  1U7J A;  1OVR A;  2DW3 A;  5DJT B;  3L72 D;  3AE6 C;  3BCC E;  3L70 G;  3TF5 A;  2P2U A;  5BVZ A;  4N78 E;  3L74 E;  3D6Z A;  3RL0 C;  3U1A A;  3Q1M A;  2H8P D;  4AQR D;  3WUV A;  3OAK A;  1FZA A;  4I7Z C;  3KZI E;  1YIJ P;  4OGQ B;  1Q7Y Q;  1ZW0 A;  1LTB C;  2J59 M;  3RK3 B;  1OWA A;  1SLQ A;  2E43 A;  3HUS A;  2M0B A;  1HGV A;  1PFI A;  2A45 G;  2O1K A;  4RJT A;  1SQP G;  3H1I J;  3JC2 2;  5APX A;  3TGU E;  1X9V A;  1QX8 A;  3HE4 A;  3VMA A;  3B71 A;  5AVQ B;  2Q9I A;  3C1L A;  1Q81 Q;  1KB9 E;  2R32 A;  1K04 A;  4DZO A;  2OYI A;  2FFD A;  2KZI A;  1LTJ B;  1NAF A;  3LIE A;  1KIL D;  3C9I A;  3SWY A;  1BE3 D;  2QA4 P;  1L0L K;  3AE8 C;  1L4A A;  1EC5 A;  1KYO I;  1EXI A;  1AVO A;  2SPZ A;  2K3R A;  5KLV K;  1LTI C;  1GMJ A;  1M1J C;  2NPS C;  4LC1 A;  5CCG C;  3CMA P;  3V2R A;  2ZYG A;  4H0L D;  5KLV E;  2FYU E;  2CK3 H;  4I7Z B;  3KPE A;  4PJ0 E;  3PP5 A;  1SQQ G;  1FBM A;  4WWI A;  1JY3 O;  2M8R A;  1OXZ A;  2A06 E;  1BE3 J;  3HD7 D;  1M57 D;  4RKU J;  1M90 Q;  1WRG A;  3FX0 A;  5DJU B;  2ZAE B;  2KIK A;  2N9Y B;  1NTM G;  4H0L B;  3L4F A;  2IX7 C;  2QG4 A;  1KD1 Q;  1NHL A;  1S5L X;  3V4Q A;  2AXT H;  1P84 H;  3E1R A;  3HD7 B;  3A0H H;  3VP9 A;  1YJW P;  1IFN A;  1HUC A;  1H89 A;  4GOE A;  1IC2 A;  1NTK E;  2WZ7 A;  2AXT E;  1KOR A;  5EFW B;  3EQ2 A;  5L8R J;  2LXC B;  1N73 C;  3MUD C;  4EI2 A;  1PPJ E;  2FXO A;  2GM4 A;  4Y99 B;  1M1J B;  2NPS B;  3AEC C;  1N7S A;  3FWL A;  3T97 A;  1JMB A;  1ZN5 A;  1JCC A;  2JP3 A;  3RL0 g;  1LP1 A;  3W68 A;  1HWT C;  1NKZ B;  2V7Q J;  1L2P A;  1QL1 A;  5CBO A;  4U3F G;  2YO2 A;  1RQU A;  3VMX A;  1SQB J;  1KB9 I;  4C46 A;  3LW5 J;  3F89 A;  3VYI A;  3H1J G;  3NTN A;  3QWO C;  2K9Y A;  2Z5I A;  1SQP D;  1SFC A;  3PH0 A;  5AVU B;  2Q3I A;  3OJA B;  3CD6 P;  2E74 D;  1S5L H;  3CWB G;  3K5B A;  4R4L A;  1NYH A;  2BEQ D;  3L72 E;  5KAF H;  4PD4 H;  5KLI B;  3A0B H;  1L0L G;  2PAJ A;  3B8E B;  2QRX A;  2PGD A;  3L73 G;  2R5B A;  3RK2 D;  3TSI A;  3CC4 P;  3IF4 A;  3O6Q A;  4D6T G;  1USD A;  1U57 A;  3B4S A;  4K35 A;  4UB6 E;  4HKZ H;  1KQF B;  1N73 B;  2E74 B;  3RK3 E;  4DT0 A;  4ZKU A;  4OH8 B;  1EXJ A;  3E1I A;  1GK6 A;  1Z56 A;  3PRJ A;  5AVV B;  5KJ7 A;  1ZME C;  3R4Y A;  1W2E A;  3L71 G;  4H13 C;  2Y0D A;  1KN7 A;  5AW6 B;  4NPF X;  3WU2 H;  1YHQ P;  3CCM P;  2QJY C;  1YIT P;  1LTA C;  1FZF A;  3V2P A;  1IFI A;  1AJY A;  1SQQ D;  1AFO A;  2J5U A;  2VRS A;  4W7Z A;  3WUT A;  3CC2 P;  2ZXE B;  4JQ0 D;  4ZNC A;  3SWF A;  1JY2 N;  3BCC D;  1VQ9 P;  1L0N K;  3HTK B;  1NTM D;  1VF5 D;  1FE6 A;  3GHG A;  5AVT B;  4UB8 E;  5BU5 A;  1EDK A;  2ZFC A;  3M0D C;  3H1K G;  1T8Z A;  1RF1 C;  1BE3 E;  5GTI E;  4LLH A;  3H1H E;  3M9H A;  4NPE A;  2WIT A;  1L0N E;  5CJ4 A;  3CPW O;  1KMI Z;  1DX7 A;  2RN0 A;  2HR3 A;  1JO5 A;  1KTM A;  1GD2 E;  2RMZ A;  2B9B A;  3SFD C;  2FXM A;  2XNX A;  3BCC J;  4WY4 D;  2E5T A;  3GF3 A;  1VQ5 P;  5CCH C;  2QE7 H;  1GL2 A;  3L74 J;  1VQO P;  2E5Y A;  2RH0 A;  1FJK A;  2IYO A;  1CW5 A;  3CCL P;  2QEX P;  2J58 A;  2Y9Z A;  2KK7 A;  1VQP P;  4U3F D;  2ZT9 C;  3L35 A;  3KQG A;  5CBN A;  5AVZ B;  1RY3 A;  4N3Y B;  2XU6 A;  1YJN P;  2V7Q H;  1EZV D;  4GOD A;  5KAI E;  3I56 P;  1JUN A;  1SQV G;  3HE5 B;  1QL2 A;  2PP6 A;  4ASV A;  1S4X A;  3LW5 H;  5AW4 B;  4TLF A;  2KLU A;  3TGU J;  5M1B A;  4W80 A;  1HJB A;  1RF1 B;  2W6J H;  2POH A;  3L70 E;  1ZP0 C;  1L0L D;  2WTY A;  5AW2 B;  2OTL P;  1VQK P;  2Z5H A;  1YQ3 C;  1NTZ G;  5KLV D;  3AEE C;  2A06 D;  2XZR A;  2ZVN B;  2LXB A;  4GDO A;  2UWJ E;  1FOS E;  1KIL A;  1FC2 C;  1E79 H;  2OGU A;  3MTU E;  2OYH C;  2WT7 B;  2G3A A;  1XTC C;  3E7K A;  1PGQ A;  1VDF A;  3L37 A;  3JCU E;  2E76 C;  3P32 A;  1FZC C;  1LTG C;  2IZ1 A;  1ZR4 A;  1DEE G;  2ZT9 B;  4LGD E;  1SQP E;  4Y28 J;  1QEX A;  5KLV J;  2JWD A;  2R5D A;  2XKM A;  1NWQ A;  3CXH D;  4PV1 C;  3G4S P;  1IK9 A;  3O8Z A;  2C9L Y;  3VOP A;  1RF0 A;  1KQG B;  1QVF O;  1KYO H;  4YXD C;  4DJG A;  3U59 A;  3HD7 A;  4JF7 A;  5B66 E;  3H1K D;  2MKV A;  3CX5 D;  2KXP B;  2YKP A;  4JPZ B;  3N7N A;  1PGO A;  2JWA A;  2XV5 A;  3IFM A;  1T3J A;  3VP8 A;  4RES B;  1YTZ T;  1WT6 A;  3IAO A;  1ZLL A;  2D2C C;  2N1T D;  5AVS B;  1FAV A;  1JM0 A;  3GF7 A;  1IK7 A;  2AXC A;  1VQN P;  3WUU A;  3H6P A;  2OYH B;  3D71 A;  1SQQ E;  3H32 B;  2W27 A;  2K1A A;  2E76 B;  1LWU C;  2ZYD A;  1NTM E;  1G1J A;  1Q86 Q;  4YXW H;  1OVU A;  4PV1 B;  4OGQ D;  1MFT A;  2M3B A;  3RK3 D;  1AVY A;  2K9J B;  2B87 B;  5AW7 B;  2W8Z A;  3KZI H;  1NU1 G;  1OZH A;  3IN6 A;  3B5N C;  3WMM 0;  3MD0 A;  2PRR A;  3C8V A;  2WSF J;  2R3C A;  1OVV A;  1JY3 N;  2V4H A;  5K5G B;  2KS1 B;  2FXP A;  1S1C X;  1NVO A;  1R8E A;  3L72 J;  1DD4 A;  1VQM P;  3GLM A;  4IFF A;  1M1K Q;  1GTW A;  4XE5 B;  1RE4 C;  2D2C B;  1QLE D;  1GW4 A;  2A45 I;  1FZE A;  1YI2 P;  3G6E P;  5APQ A;  1KB9 H;  1URQ C;  3EWK A;  1FU1 A;  1Y47 A;  1FJP A;  3S4R A;  1PP9 G;  4U3F E;  4GT1 A;  4U7J A;  3H1J E;  3IR9 A;  1EZV E;  2O1J A;  1LWU B;  1J1E C;  3H1H D;  2Y9Y A;  1L0N D;  1HJ0 A;  3TK1 A;  3RL0 B;  4HH2 A;  3A5T A;  1L0L E;  5GTH E;  4C7N A;  4PJ0 H;  2PFX A;  3Q5R A;  1GU5 A;  1NKN A;  1UII A;  2IFN A;  2LKM A;  2KNC A;  4H44 C;  1LT9 C;  1FDM A;  1J1D C;  3H1H J;  5BU8 B;  1OW6 A;  3H1L G;  1LT1 A;  2CPS A;  1L0N J;  2JEE A;  2YIU C;  2YNY A;  3CCQ P;  1VQ8 P;  2KI7 B;  1JMM A;  1URQ B;  2K88 A;  1TU3 F;  1ZV8 A;  1YBK A;  4EYY Q;  5B5E E;  5H2F E;  1GU4 A;  1PGJ A;  2NPS D;  3CXH E;  4WY4 A;  3JSV C;  5CCG D;  3L70 D;  1SQX G;  1SP4 A;  4AYC A;  2XDJ A;  1S9K E;  3CCJ P;  2E42 A;  3NFQ A;  5AVX B;  1CI6 B;  2FY8 A;  3MGN A;  3H1K E;  3L75 G;  3M06 A;  2RKL A;  3CX5 E;  5AVY B;  3HUS C;  2QSI A;  1Y8A A;  1U7M A;  3FWN A;  1DH3 A;  4RO0 A;  4IL6 E;  2OTK E;  2YKO A;  2Z4E A;  2E75 C;  4H44 B;  1BDC A;  1BSH A;  5TIS E;  3TGU G;  1PZQ A;  5CJ0 A;  2YMK A;  1LT9 B;  3A7O A;  1NH4 A;  4AUW A;  2BAS A;  3L70 J;  3Q5S A;  1BCC G;  3CI9 A;  2OYI C;  2WSF H;  2FFD C;  1EZV I;  2ZYA A;  2I8D A;  4IFD K;  3GG2 A;  1HBW A;  1T2K C;  1OW7 A;  1L4A C;  2OAR A;  5TJH A;  1SQV K;  1T3U A;  1W5C E;  3BAS A;  3M9Q A;  1R5L A;  4UB6 H;  3KHU A;  1MV8 A;  1FOS F;  3ITK A;  1UIX A;  2M5A A;  5CHX A;  2HG5 D;  2JKV A;  2HOD B;  1NTZ K;  1SQP J;  3Q2Y A;  2HPC B;  1FZB A;  1DIP A;  2R3S A;  2FYU G;  3HUS B;  3SSU A;  2CPB A;  2KOG A;  2WPV B;  2YO3 A;  3HE4 B;  4I6M C;  5APU A;  3PJS K;  1MFZ A;  3AEG C;  1GZL A;  1N7L A;  4BRY A;  3V4W A;  2OYI B;  3CXH I;  3H1L D;  1LTS C;  2P1J A;  2BCC G;  4UB8 H;  2NZ2 A;  2HLO A;  1LTT C;  2ITA A;  2WSS H;  1NTK G;  5GTI H;  1H0T A;  1L4A B;  1JTH B;  3BAT A;  1AQ5 A;  1OFC X;  1K9M Q;  3OA7 A;  2NRG A;  2N1T A;  3CX5 I;  3H32 A;  3I55 P;  1HF9 A;  3VTP C;  1EQ7 A;  1N7S C;  1BGY G;  4I2L C;  1SQQ J;  1KV4 A;  1JOC A;  1AV1 A;  3KYQ A;  1NTM J;  2WWW A;  4GIF A;  2H89 C;  3D70 A;  2Q5U A;  3H25 A;  4H13 B;  5E79 E;  3QH9 A;  1GDT A;  4YTP C;  4DOJ A;  2QJY B;  2IBZ G;  3CCS P;  1SFC C;  2JO1 A;  1G1I A;  2AEF A;  3VMZ A;  3CCV P;  4XA4 A;  2Q3E A;  5KAI H;  4IOI H;  1IFP A;  1IFJ A;  3H1J D;  2P67 A;  3LID A;  2W83 C;  1LGH B;  3V6I A;  2KP8 A;  1EDJ A;  1VQL P;  3L72 G;  1G2C B;  1SS1 A;  2FKW B;  1VQ4 P;  1SQB K;  3RBX A;  3H1I G;  2KYV A;  3CWB D;  2ZXX A;  2OYO A;  5KJ7 C;  1NU1 K;  1LTJ A;  2QJP C;  5CCH D;  1N7S B;  1FS0 E;  4BWN A;  1RE3 A;  4U3F J;  3L73 D;  3T97 B;  4Z1M H;  4D6T D;  2QJK C;  5AW0 B;  3H1J J;  3AEB C;  4W7Y A;  3AE1 C;  1NU1 E;  4WVZ A;  2ZT9 D;  3L71 D;  4BXL A;  4DCK A;  3JCU H;  2HYN A;  3CWB J;  2A45 H;  1M56 D;  3N4X A;  1SFC B;  1L0L J;  3GHG C;  3L73 J;  3V2N A;  1KFM A;  1HTL C;  3MP7 B;  1JEK A;  1PV3 A;  1T6A A;  4GKG A;  1QGK B;  2BCC D;  2WSE J;  1QVG O;  1BE3 G;  5B66 H;  1BSN A;  1S9K D;  1P84 D;  3L71 J;  2YXQ B;  1H88 A;  2QJP B;  1GL2 C;  1Y9B A;  3D6Y A;  1R5S A;  1USE A;  1FDI A;  2C9N Y;  2K37 A;  2B89 A;  3Q5P A;  2W6B A;  1JCD A;  2E76 D;  1M1J A;  2NPS A;  3RK3 C; 
#chains in the Genus database with same CATH homology
 2PAJ A;  1IFD A;  3B8E B;  5CCG A;  3BRT B;  2R5B A;  1GU5 A;  3RK2 D;  1NKN A;  3P8C E;  3TSI A;  2IFN A;  2LKM A;  3A3Y B;  1M7L A;  1LT9 C;  2KSJ A;  1N73 B;  1FDM A;  4N6J A;  1J1D C;  5APS A;  1FZC B;  1JY2 O;  3GHG B;  4ZKU A;  5BU8 B;  4OH8 B;  3E1I A;  1GK6 A;  2CPS A;  1Z56 A;  2JEE A;  3I5C A;  2YNY A;  5AVV B;  5KJ7 A;  2C0X A;  1HH0 A;  1LWU A;  1W2E A;  1SQX K;  3TNU B;  1JMM A;  1URQ B;  4JYC A;  1SFC D;  5AW6 B;  1CSB A;  1ZV8 A;  1E5W A;  2WSC H;  1GU4 A;  1LTA C;  1FZF A;  3V2P A;  2NPS D;  1IFI A;  1AFO A;  3MIW A;  4WY4 A;  2VRS A;  4W7Z A;  5CCG D;  3B5N A;  1KIL C;  2N9B A;  2ZXE B;  4C7R A;  1GL2 B;  3SWF A;  5AW9 B;  1JY2 N;  1SP4 A;  1L0N K;  1SQP K;  3HTK B;  2XDJ A;  1MZ9 A;  4AYC A;  1S9K E;  1A02 J;  2E42 A;  3NFQ A;  5AVX B;  1CI6 B;  1N73 A;  3MUD A;  1JY3 P;  4HYT B;  2HOD A;  3MGN A;  3GHG A;  2N1T C;  3M06 A;  4M3L A;  5AVT B;  5BU5 A;  2ZFC A;  3M0D C;  5AVY B;  1N2D C;  1T8Z A;  5KJ7 D;  3HUS C;  1RE4 A;  1A02 F;  2IFM A;  2HPC A;  1RF1 C;  1IO4 A;  1DH3 A;  4LLH A;  3VN0 A;  2I1K A;  3P8M C;  3M9H A;  5AVR B;  3P7K A;  2WIT A;  2H43 A;  2YKO A;  1N86 A;  3M9B A;  2Z4E A;  1URQ A;  4EOT A;  5CJ4 A;  2C0W A;  1DX7 A;  3EFG A;  2WPQ A;  1JNM A;  3V2Q A;  3VMY A;  1RF0 C;  3RL0 D;  1JO5 A;  5CJ0 A;  1LT9 B;  3A7O A;  1NH4 A;  1GD2 E;  4AUW A;  2BAS A;  2KLV A;  3TYY A;  2FXM A;  3HD7 C;  2XNX A;  3CI9 A;  1YTZ I;  2WSF H;  4WY4 D;  2W6A A;  2OYI C;  2JJL A;  2FFD C;  3B5N D;  5CCH C;  2QM7 A;  4IFD K;  1GL2 A;  1HBW A;  1T2K C;  1FJK A;  1L4A C;  2OAR A;  5CMZ A;  3HTK A;  1CW5 A;  1IJD B;  1SQV K;  1CI6 A;  2WPS A;  2J58 A;  5APW A;  1T3U A;  1CZQ A;  1JTH A;  3BAS A;  1XTG B;  3L36 A;  3M9Q A;  3B5N B;  3L35 A;  1SQQ K;  3KQG A;  2FYU K;  1MV8 A;  4Y99 C;  5AVZ B;  2WSE H;  1RY3 A;  4N3Y B;  1URQ D;  1FOS F;  1KIL B;  2XU6 A;  5CHX A;  2HG5 D;  5APV A;  2QM8 A;  1JUN A;  2HOD B;  3M91 A;  3HE5 B;  1NTZ K;  1YYC A;  1NTM K;  1QL2 A;  2PP6 A;  1LT9 A;  4WBA A;  2HPC B;  2L5G B;  3LW5 H;  5AW4 B;  2FYZ A;  1FZB A;  2N1T B;  4I1L A;  1LTJ C;  1NOH A;  1KQL A;  2KB7 P;  3HUS B;  1H8A A;  1GK4 A;  3HRN A;  4W80 A;  1HJB A;  1RE3 C;  1RF1 B;  3KDP B;  1GL2 D;  2CPB A;  2IPP A;  2POH A;  2KOG A;  2YO3 A;  3HE4 B;  2WTY A;  1SVF A;  1NTK K;  4JYB A;  5AW2 B;  4I6M C;  2P2U A;  5APU A;  2Z5H A;  5BVZ A;  4N78 E;  1MFZ A;  3P8C D;  2I1J A;  1GZL A;  1N7L A;  3RL0 C;  3U1A A;  2XZR A;  3V4W A;  1J1E B;  2O01 H;  2OYI B;  2H8P D;  1LTS C;  2P1J A;  4AQR D;  1DEB A;  1FOS E;  1KIL A;  2HLO A;  1LTT C;  3OAK A;  2OYH C;  3MTU E;  1FZA A;  1L4A B;  2WT7 B;  1X8Y A;  2MJZ A;  3HE5 A;  1KZU B;  1XTC C;  1JTH B;  1JY2 P;  3BAT A;  1AQ5 A;  4O9B A;  1VDF A;  4ZKP A;  1G2C A;  2GUS A;  3OA7 A;  3L37 A;  1LTB C;  1ZR2 A;  2J59 M;  2N1T A;  3RK3 B;  1OWA A;  1SLQ A;  3H32 A;  3M0D A;  3P32 A;  1FZC C;  1LTG C;  2E43 A;  1GW3 A;  3VTP C;  1ZR4 A;  1EQ7 A;  1NO4 A;  1N7S C;  3HUS A;  1RF1 A;  4LGD E;  3A2A A;  1HGV A;  1PFI A;  2A45 G;  3CL3 D;  2O1K A;  4I2L C;  4IFM A;  2R5D A;  5APX A;  1X9V A;  1JOC A;  2XKM A;  1NWQ A;  3HE4 A;  3RK2 C;  5APT A;  5AVQ B;  1J1D B;  2Q9I A;  1IK9 A;  3O8Z A;  2C9L Y;  3VOP A;  3KYQ A;  1RF0 A;  2R32 A;  2WWW A;  4GIF A;  3U59 A;  3HD7 A;  4JF7 A;  2Q5U A;  4DZO A;  2OYI A;  2FFD A;  1LTJ B;  1NAF A;  3LIE A;  1KIL D;  3C9I A;  5CCH A;  2YKP A;  1GDT A;  1KFN A;  3N7N A;  3SWY A;  4DOJ A;  2XV5 A;  3IFM A;  1L0L K;  1T3J A;  3VP8 A;  1SFC C;  1L4A A;  4RES B;  2WT7 A;  1G1I A;  1YTZ T;  1WT6 A;  1MUU A;  3VMZ A;  5KLV K;  1LTI C;  1ZLL A;  2N1T D;  4XA4 A;  3BVH A;  1M1J C;  5AVS B;  2NPS C;  1FAV A;  4LC1 A;  4KHX A;  1IFJ A;  2Q7C A;  2P67 A;  3LID A;  1LGH B;  5CCG C;  3NMD A;  3V2R A;  2KP8 A;  1G2C B;  3H6P A;  2OYH B;  3UIA A;  2FKW B;  1SQB K;  3KPE A;  3H32 B;  3PP5 A;  1FBM A;  2KYV A;  1JY3 O;  2M8R A;  1FZG A;  1OXZ A;  3BRV B;  2W27 A;  3HD7 D;  5KJ7 C;  3G3Z A;  1NU1 K;  2WPR A;  1LTJ A;  1LWU C;  5CCH D;  1N7S B;  1WRG A;  1RE3 A;  3U1C A;  1VPC A;  3M0A A;  1T2K D;  1G1J A;  1L4A D;  3RK2 B;  5AW0 B;  3V5B A;  3L4F A;  2IX7 C;  5AW5 B;  1NHL A;  4W7Y A;  3V4Q A;  2M3B A;  3HD7 B;  3RK3 D;  3VP9 A;  2FFD B;  1IFN A;  5AW7 B;  1HUC A;  4B86 A;  4WY4 C;  1H89 A;  1IC2 A;  2WZ7 A;  1J2J B;  3B5N C;  5AVW B;  3MD0 A;  3WMM 0;  5KTB A;  2HYN A;  2R3C A;  1IFM A;  1HVV A;  1JY3 N;  2A45 H;  2OYH A;  3EQ2 A;  2YMY A;  3N4X A;  1SFC B;  1N73 C;  5AW3 B;  3GHG C;  4EIJ A;  4IFF A;  3V2N A;  1GTW A;  1KFM A;  4XE5 B;  1RE4 C;  3II6 A;  2GM4 A;  1HTL C;  4N78 D;  4Y99 B;  1M1J B;  1GW4 A;  2NPS B;  1FZC A;  2A45 I;  1N7S A;  4C7N B;  1FZE A;  2HFE D;  2GUV A;  3T97 A;  5APQ A;  1ZN5 A;  1JCC A;  1URQ C;  4GKG A;  1FU1 A;  2P7J A;  1FJP A;  1HWT C;  1NKZ B;  1S9K D;  4GT1 A;  3TNU A;  5AW1 B;  4WB4 A;  1QL1 A;  3R2P A;  2YO2 A;  3VMX A;  4C46 A;  2YKQ A;  3CLQ A;  1X79 B;  1H88 A;  3IR9 A;  3VYI A;  5AW8 B;  1GL2 C;  3NTN A;  2O1J A;  1LWU B;  1J1E C;  2Z5I A;  2C9N Y;  1HGZ A;  1SFC A;  5AVU B;  2Q3I A;  3OJA B;  3TK1 A;  2W6B A;  5APY A;  3RL0 B;  1JCD A;  4HH2 A;  1M1J A;  3A5T A;  2NPS A;  1N7S D;  3RK3 C;  4C7N A;  2H7H A;  4WY4 B;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...