2MK5A

Solution structure of a protein domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
b'SNAKNYMDKGTSSSTVVKDGKTSSASTPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNHIPGVAWGVFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin
publication title Structural and Biochemical Characterization Reveals LysGH15 as an Unprecedented "EF-Hand-Like" Calcium-Binding Phage Lysin
doi rcsb
source organism Staphylococcus phage gh15
molecule tags Hydrolase
total genus 18
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08460 SH3_5 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.410 Mainly Beta Roll SH3 type barrels. Cell wall targeting domain of glycylglycine endopeptidase 2mk5A00
1R77A 2MK5A 4LXCA
chains in the Genus database with same CATH superfamily
1KQSS 3QJ6A 4MZMA 5GAN2 4EIKA 5GANh 3TSZA 1NBEB 2OTJQ 4DBHA 3M0QA 2AHJB 4PJOD 4FM4B 2QGGA 2CT3A 4OMLA 3SD4A 1WQWA 2DD4A 2L2PA 3A1PA 3CC7Q 1PM3A 1M90U 1XOVA 1TTHB 3J7AF 5GAMh 2MI6A 4OB0B 2YUQA 2ABLA 1NPPA 3SEMA 2E64A 1Y71A 1PG5B 4BI3A 4JJNK 4KRTA 1QWEA 3UT1A 2DPPB 4IUTA 1TU0B 4BD3A 1SG5A 5GAMg 2RHZA 4IUPA 1W6XA 4MDWA 2V8KA 4E7HA 3CCJQ 3JB9H 2DEUA 2P84A 2DRKA 2JT4A 2VWFA 4JDSA 2ZPBB 1QP2A 1RI0A 2X9HA 2Z0WA 2YRDA 1KD1U 2EPDA 1VA7A 2PUOB 3CCEA 2E3IA 3OYDA 1YWOA 4ANJA 2CSIA 3RDVA 2RHYA 2QEXT 3AHUA 2FHDA 3E2UA 3BW1A 3H9NA 1V76A 2CT4A 3MP1A 3UATA 3OYBA 3OS5A 1KQ2A 1C1AA 4PJOG 1IREB 2EJFA 1JJ2S 3QUIA 2DTOA 2DILA 1D0ZA 2ZPGB 4M7AC 2KBTA 2QAZA 2CP7A 2YHTA 2X4XA 1N8RR 3H0IA 1VQMQ 3RKWA 1OOTA 2GF7A 5HK3A 2E5QA 1LPLA 2O9SA 1XQHA 2DX1A 3OYNA 4KUDK 3JCMc 3G6EA 5GAN7 3HTRA 3I56Q 3EH1A 4QQDA 2YRCA 2M02A 4PJNA 4GY5A 4A63B 4C92D 2GFUA 4M78F 1AHJB 1ZA2B 2DA9A 3HRSA 1X27A 1HK9A 1GL5A 2DL4A 3S3MA 1K0SA 2YLCA 4M75C 2EGAA 5C6SA 2MPXC 3WXMB 2FYKA 1YIJT 4JS4A 5GMKh 3NPFA 4N4IA 2GGRA 2JMCA 3WVDB 3FC3A 1JXOA 1WGSA 3JCMP 3CC4Q 1W4SA 3OS2A 2XDBA 2KNBB 3SHWA 4BE0A 2XU8A 1SPKA 3JRZA 5D6XA 3JB9F 1RAFB 3QYGB 4KBMB 4A4HA 2K6DA 2MOXA 1H641 2OAWA 1JBMA 3VRZA 1YNZA 3SWNA 1VQPQ 4E47A 5FWCA 4HCZA 2K79A 2I0NA 5CIUA 4II1A 3P8HA 2K57A 3EG9A 5LJ3h 2FPFA 4A4FA 2J05A 2CZ7B 3ASKA 2HL5C 1D09B 3HRTA 4ZGJB 3VS5A 3VS4A 4XTUA 1N5ZA 3R6OA 2E5KA 1FXXA 4KGZB 3PNWC 4NS5A 3MP8A 4C0GA 1WNLA 4LNPA 5I22A 1N8RU 3CBMA 1KC8U 4M77F 4C92G 1QCFA 5LJ3g 1BIAA 1M9SA 3RKYA 4MDXA 1TOVA 2L3PA 2DKGA 3CPFA 1M3AA 3OMGA 3CEYA 1TXQA 2WSFE 4M7DF 4ZNXA 5LJ5d 3I55A 4PNOA 2A28A 2IG0A 2XK0A 1CKAA 4KGXB 3QG1A 2LVMA 3KXTA 4C8QA 4R0KA 1G3YA 2QA4T 1K76A 1K1ZA 1TUDA 2M51A 3MKDA 1Q95G 5LJ5j 8AT1B 5CKDA 3H8ZA 5CKFA 3C4SA 4MMLA 3GBQA 1MUZA 1YI2A 1VYUA 3QWYA 3MEAA 1ZX6A 2ZAEA 3PFSA 2VB6A 5KYYA 2QQBA 1M30A 1LNXA 1YHQT 2LQKA 1IB8A 4ZN3A 4NL2A 1PSFA 4OVAA 2FZCB 1D3BB 2I2LA 3LWHA 1YCYA 3LYIA 4KT0E 1RAGB 3IQLA 1VQ5A 1BB9A 3JAME 4MMKA 2F5KA 4QVDA 1Y7XA 3EG0A 3JCMg 1VQ4A 1K8AU 2F1LA 3KBGA 4ORZA 1WHJA 2FEIA 3JCMX 2EKOA 3GF5A 3OYFA 2RH2A 4AT1B 1WXTA 2CZ6B 1K73U 4RTYA 4JJCA 1IRXA 3RKXA 2NUPB 1X6BA 2YLBA 2XDPA 3CMET 1JU5C 1BI2A 3EGDA 1SSHA 3CCEQ 4J9HA 4GLMA 3G1JA 3EHRA 2K3YA 2RI2A 1Q86U 1M8VA 2GCXA 3PGGA 1GFDA 4LDWA 1TH7A 3GLXA 4EMKC 1PD1A 2EYYA 3NHNA 1WA7A 5FRNA 1A0NB 1YJWT 2KVQG 2QQ9A 2HQXA 2V8JA 1GBQA 1VQ7Q 2C0OA 4OP0A 2LX9A 3JB9J 6AT1B 1BK2A 1ZSZB 1TSFA 3V8LA 2V26A 3G6EQ 4FYXB 2MF2A 4PFPA 1BI0A 2EW3A 2KRNA 1Q7YC 1M4ZA 2DNUA 4HCBA 2KR3A 2OTLT 1QVFS 3JB9G 2CZ1B 4LDXA 4HKEA 4BACA 1NJIC 4DBFA 2DXUA 5CR2A 2EBPA 1ZBXA 1AWOA 2PVGB 1PD0A 1KK7A 1Z9ZA 4HVWA 1Z9QA 2DFUA 4EMKB 3L2UA 3S3NA 2LQWA 4M4ZA 1RABB 1JO8A 3OYGA 3SWNC 1VQ9A 1UECA 4F7UG 4JZ3A 2SRCA 1KQSP 2XG8D 2RK2A 3EFRA 1WJRA 4M75F 3HPWA 1S72T 4M77G 2Y4XA 4CI0C 2RA2A 1CSKA 1VQNA 4KUIA 4A53A 5GAN6 2OX7A 2LNVA 3NFCA 1OZ2A 4WCIA 3CPWA 1IGQA 3HFNA 4RTXA 4JJDA 1SEMA 4YTLA 2QQSA 2XIDA 2R5AA 3M53A 2O9VA 2NUZA 2DYBA 1T3LA 3M57A 2JW4A 3RMQA 1X43A 2K3XA 3CCQA 1OX8A 2RMOA 4M78C 4M78E 2ROTA 2X3XD 2AT1B 2VYTA 3G7ZA 3V7CA 1VQKT 1SRLA 3VYGA 3V7SA 4DOWA 3L2VA 4HVVA 4OB1B 3EFOB 3OYKA 3CCST 2KY9A 4A4KA 3VS1A 7AT1B 3FJ5A 5D6WA 3T9NA 2AIRB 3PVQA 1QVGP 2RQWA 3CBPA 2LCCA 2L0AA 1NM7A 3L2WA 2DZCA 2DBMA 2DL8A 1WPYA 2CH4A 2YUOA 1M1GA 2KXCA 4M7AD 1YI2Q 3VS3A 3M4YA 1K9AA 2O4XB 2HNIA 2QXFA 1I4K1 2G3RA 3QDFA 2VUBA 1JJ2P 1WDXA 3MP6A 4HVUA 3HRUA 4M78B 1WLPB 1UHCA 3DKMA 2OTJT 3VS2A 1K4US 3C0CA 1VQ5Q 2RM4A 3S3OA 3D7SB 2QEXA 2L89A 2LTOA 4Z02A 2QTXA 1VQ4Q 1Q7YR 4M77C 4M77E 2WSEE 1UHFA 2FVUA 4M75D 3ME9A 5AYFA 2GTJA 2M16A 2BZXA 1WHLA 2DJQA 2P0KA 2KYBA 1NJIR 4M7DC 4M7DE 4MZTA 2EFIA 4LDYA 2GBQA 1X01A 2PTKA 3QJYA 2RN8A 1N9RA 2O31A 1TUGB 4Z8AA 1JXMA 4F17A 5KE2A 2QDYB 3OYLA 3L42A 4J9GA 1M5Q1 2NUTA 4C0DC 3CCJT 1RACB 4V2SA 4XTVA 1KHIA 4M7AG 4HA8A 1VQ6T 2FG0A 3TEEA 2RJCA 3EGUA 5GJWB 4C5EA 3BDUA 8ATCB 1M1KU 3M56A 2VC8A 1NE8A 2LZ6B 4E2FB 1YIJA 2M0OA 2ZCFB 4M77B 2ED1A 2G6FX 1H3HA 4BI8B 4PJOA 4J9CA 2R58A 1YITT 2KI7A 2M1HA 4VUBA 5GANj 3QSUA 1M2VA 2XMFA 2KE9A 4PLLA 2MCNA 4M7DB 1ZQ1A 3UDCA 3EGXB 2DZ9A 5GAMd 2BZYA 3TCJA 3QO3A 3CCLT 3CCVT 1WX6A 5GANg 3E19A 4M75G 4HT8A 1JB0E 5FRMA 2RHIA 3P8BB 1Q82C 2P0QA 5GAMj 4LDUA 5HK0A 4HXJA 4C0DB 3I56T 2RI3A 2HCKA 1M2OA 1Q7YU 2A3LA 3CD6T 4C5IA 4HT9A 2DO3A 2OI3A 4E7ZA 1VQ9Q 1IHWA 2D0NA 3PVLA 4NL3A 1NJIU 1N6AA 2D1XA 2M0YA 2QYZA 3THKA 3G71T 4JRIA 2BE7D 4RG2A 3GIBA 4X1VA 1RADB 3QDRB 1QKWA 1VQNQ 3OS0A 2IIMA 4RTUA 3RR6A 1YJNT 4IKFA 3CCRA 1OPLA 4F04B 3VYHB 4RCBA 3OB9A 1NEGA 1BYMA 3RMSA 3DB4A 1PCXA 3MHXA 1GCPA 1OV3A 2DD5A 3G4ST 1R77A 4XQ3A 2XD0A 1AZGB 2QA4A 5GAOq 4M7AE 4XTZA 3CCQQ 1YJ9A 1YBYA 1G83A 4WTOB 1VQLA 2L3RA 2ZPFB 1ABOA 3NMZC 2HMAA 2WSCE 1T0JA 2MIOA 5D6YA 1LJOA 4B9WA 2RQRA 3F70A 3M54A 4OMFB 4PL6A 2RQTA 1YHQA 5KH6A 4E6RA 5J3BA 3OYMA 4N4GA 1D1BA 1R0CB 2YDLA 5DLQE 4C92A 1XNIA 2B8AA 2IPOB 1R8OB 5LJ5f 3HHTB 5CO7A 5FROA 4KH0B 3L2QA 1QMCA 4C8QF 2VGMA 2JUFA 2H3EB 4M75E 4XTWA 1LVKA 2E6NA 5CKBA 4CC4B 1UGVA 1YCSB 4X34A 4EMGA 2ZPHB 3BDLA 1ZHIA 1PWTA 4DA4A 1O9SA 2K9GA 4QQGA 3A98A 4M7AB 4L5GA 2QTVA 5GMKj 1AVZC 4D8DA 5KYXB 1EIFA 3JCMf 2D9TA 1YWPA 2DF6A 2CP6A 2F5TX 2X35A 1ZLMA 2FRWA 5CKHA 4A4EA 2HD0A 3NTHA 4X9DA 4X9CA 1G3SA 2E6ZA 2Y90A 1WI7A 5AT1B 2QEXQ 4XAXB 5IAYA 1VQ8T 1SRMA 3EG1A 4C5GA 2QASA 5GAOn 2ED0A 3MCAB 2CP5A 2EQJA 5EC7A 3OSSC 3RIRA 3UA6A 3A8HB 4J6XA 1NG2A 3JSCA 1AT1B 4J9BA 1GCQC 1IHVA 1NZ9A 2CP3A 1QVFP 1YJWA 4ATOA 2ZPIB 3UPUA 2EQMA 1Q82R 4OGCA 2F2XA 2QK0A 4M75B 1WXUA 5FU7C 5LJ3j 4RTZA 3OSVA 2EYZA 5J26A 3A8GB 3PT9A 4J83A 5GJVB 5L23A 3OW2P 1XJWB 3VRYA 1PRMC 3H0HA 1UEBA 2OTLA 2PVOB 2DETA 4E7JA 1J3TA 2FZKB 1G2BA 1QP3A 2KK4A 4ME7A 3L1AA 2JM9A 2JVVA 2ZPEB 3CMAA 1SHGA 2FPDA 3OYEA 1M8MA 4Y28E 2EVRA 1IXDA 2R57A 3HFOA 1YIJQ 3FB9A 1MHNA 5KYWB 2CUBA 4N0AA 5GAOr 2M9UA 3EH2A 1IO6A 1X2KA 4M78D 2EJGA 5A0DA 2HL3A 3JCMd 2YUPA 1AWJA 3DLMA 2COYA 1C0MA 2ROLA 2PZ1A 1V29B 4E7IA 5FU7B 3CXCP 2RD1A 3LW5E 1WHMA 1VQ7T 1S72A 3ZFJA 1B34A 4OMPA 2CP0A 2L3QA 2YSQA 2A7YA 2F2WA 4LUEA 5IXFA 4Z89A 3G6ET 3JCMQ 1NYFA 1Q81C 3FJPA 2EYQA 3JB9D 1LOJA 3VS6A 2A37A 1PC0A 2CSQA 4PJLA 4PK4A 4DEYA 4DOVA 3JB9I 4D8KA 2JJ9A 3FIFA 1C6VX 4TVRA 2HBPA 4RG8A 1Q82U 1D1AA 2LC4A 2EKHA 5J39A 5IT9E 3I35A 1ZUYA 3X24B 3CCMA 2DTHA 2RF0A 1VQKA 1YFNA 5KYUA 2MMPA 4F7UA 1DJ7B 1QWFA 1Y96A 3CCRQ 3CCSA 4GLKA 2LP5A 1T3SA 2RJEA 2RI5A 1VOMA 2O88A 4ZN1A 3A5ZB 1UTIA 4M77D 2RPNA 4FL6A 4KGVB 2QA4Q 4FYWB 4M78G 4KH1B 3EHQA 1YJ9Q 1VQLQ 4M7DD 2VKNA 2K7AA 4XU1A 3M58A 4O5VA 4IUQA 1MV3A 4BDYA 3OYHA 2JNGA 1UJ0A 2J6KA 4J6YA 2KYMA 1W2BP 1QVGA 1M90C 4A4GA 1YHQQ 3CC2A 4E7KA 4B9XA 2LT1A 3QKJA 4XU0A 2CH4W 1UG1A 4ZTJA 2PVDB 2K2VA 4CC2A 5M9OA 1PKSA 1TUCA 2A36A 4JLIA 2RJFA 3WVEB 1AD5A 2VGNA 1FMKA 2AZSA 5LL6S 1M3BA 3OYJA 2BIVA 2FL7A 2HAXA 4FYVB 5GMKl 2FPEA 3U23A 1JJ2A 3M0PA 1ACMB 2J7IA 2XI9A 2E70A 1QQJA 4IUVA 2HDAA 2YT6A 2RB6A 1ABQA 4JZ4A 3BY7A 2GQIA 2W10A 3E9GA 3PIPA 1V1CA 2PU9B 1KD1C 5GMKm 3UWNA 2FRYA 1GRIA 3GNGA 3UA7A 2QQRA 1YI2T 3CCUT 2JN0A 4QVCA 1RAHB 2KXDA 2LDMA 1F1BB 4RTTA 3SFMA 3TVTA 4ELZC 2MYSA 3E9FA 1YN8A 3META 4M7DG 2ATCB 2RK1A 3R6NA 1VQ6A 2C0TA 2E3HA 3LLRA 1TG0A 3QIIA 1BKBA 3OS1A 2DVJA 3QBYA 2LJ1A 4BDZA 5I2MA 1HYOA 1U1SA 5FWBA 1Y0MA 2O2OA 2X51A 4UC4A 1Q81R 1VQ4T 5GAN8 3C94A 3M0SA 4JUVA 4E7SA 4C8QE 4C8QC 4E7LA 1YITA 3VUBA 1D0YA 1UGPB 3ZBDA 3LH5A 2F2VA 1I5LA 2HEQA 3SWNB 1G3WA 2BKDN 4BE1A 2DYIA 2X4WA 2VXEA 4DQ2A 2BUDA 2OTLQ 3GNFB 3I55Q 4CC3A 2XDDA 3CCVA 3CCLA 2K4YA 1XTDA 3EG9B 2RO0A 4J9IA 1UE9A 3OYYA 1WQ7A 2E1HA 1OU9A 3VV0A 2DEQA 3CMAQ 2J6OA 1R0BG 1LCKA 1HXDA 1QVPA 1PNJA 1OX9A 1P92A 4XK8E 3HP9A 2HBWA 5GANf 3CD6A 2V1RA 2EGEA 2QI2A 3OYAA 1BIBA 4PJOF 1VQOT 5I11A 1AWWA 2QDLA 5KCOA 5I21A 1D1CA 3G71A 2X3WD 4JLGA 3OA6A 1K0XA 3GOXA 5IHNA 1OQKA 4OB2B 4C8QB 2RNAA 5GAMf 4OMOA 1QCNA 4L59A 1M90R 1YJNA 1FX7A 3CC7T 1AOJA 1WZOA 4FT2A 9ATCB 1KIKA 1WHHA 2X4JA 1X2QA 3G4SA 5KYYB 2DXBA 2QQAA 3RERA 4NOYA 1U06A 2BZ8A 1RLPC 2VVKA 2LJ3A 2EYXA 3QZ9B 3S6WA 1KG1A 3X28B 2LRQA 2LT4A 3TQ7P 3A8OB 3CQTA 1H8KA 4D6WA 5CAIA 1Q81U 2YRVA 1KC8C 4FSXA 3CCMQ 3OYCA 1VQKQ 1OEBA 5GAOm 5IXBA 1MV0B 4OGEA 4Y91A 3DLLA 1BCMA 4CC7A 3CCSQ 4J5YA 3PE0A 3BE3A 1B07A 1KD1R 5ECAA 1E7OA 1MMGA 1UGQB 2ECZA 1VUBA 1SSFA 2NWMA 2EQKA 3FDRA 5LJ5e 1ZUUA 5GANd 4N4HA 2FZGB 2A08A 1VQNT 1QLYA 1NLPC 3EGDB 2DLPA 2PUKB 4AFQC 3FRNA 1NPRA 4GBQA 5HCKA 1EZZB 1U3OA 1VYVA 3NTKA 1ZSGA 3LGFA 4J9EA 3CC2Q 3X26B 1CKBA 2EYWA 2C0IA 2OJ2A 4ZGDB 3CCQT 4L6V5 3JCMe 3JCMV 1QCOA 1VQMT 3M55A 4MZPA 2E12A 4C92F 4ZTFA 3X20B 1VQ8A 2DL5A 5GAN4 2ZGWA 4EPCA 1H92A 2WACA 3LWIA 1K8AC 4QVZA 2KT1A 1U8RA 4FCYA 2NUPA 1BCOA 5CVIA 1ARKA 3REBB 4AG2C 1W70A 2MWOA 1X6GA 1K73C 2EGCA 3E1SA 1WHGA 1HJDA 2COZA 2V8IA 2B86A 3EAEA 4Y92A 2E65A 1I1JA 2X4YA 3A8MB 3GPLA 2ZZDA 2Y4YA 2LCLA 2CREA 4EMHA 4OMQA 1QW1A 1Q86C 1D0XA 4AFUC 4XTYA 4J9FA 2CDTA 3CC4T 3FEOA 4LXCA 1QVFA 1PHTA 1QVGS 5GAN3 1VQ6Q 3I5SA 2DIQA 4FW1A 2LNHB 3OBYA 1IGUA 1GXIE 2DERA 3V8KA 4F14A 4IIMA 2FO0A 1Y07A 1ZSZA 3M0RA 1NEBA 5LJ3f 2CS7A 4LD9K 2L8DA 4JRKA 4PFOA 3QYHB 1VQPT 3VKIA 3OW2A 2DJZA 1YITQ 1QKXA 5HKCA 3VS7A 5D7UA 2DAQA 1MNDA 3CCLQ 3CCVQ 3MJXA 2A0FB 3JCMJ 1VQ7A 3SDZA 1KC8R 2K2MA 1UB4A 5HY6A 4EMKA 3LH0A 2CKKA 1K9MC 1TWBA 1WHKA 2HSPA 3VS0A 2YWWA 3O8VA 1TS9A 3CD6Q 3CPWS 1OYXA 3N5BB 3CXCA 5IN1A 2DXTA 3OBWA 3FLGA 3G71Q 4PKCC 1B3QA 2RHXA 3CMEA 4RMOA 4AFSC 5KYNA 2ESWA 2KSSA 1MMNA 5CKEA 3HKSA 1HD3A 3OY9A 2V1QA 3RUXA 4OB3B 1YJNQ 1M1FA 1MNEA 2E10A 4RKUE 3P8DA 2EWNA 4WF2A 4ESRA 3OMCA 5LJ3d 3HSBA 4DEXA 3M4GA 3G4SQ 3QWXX 3EFSA 4OF1A 1MMDA 2VV5A 3SB2A 3RESA 4FIBA 2DRMA 1SKUB 3M0UA 4JPBW 3Q1JA 3J80E 3MEWA 1JQQA 4BE2A 2K5IA 1K8AR 4XU2A 5DY9A 3EFOA 1AEYA 3QXEB 3V8JA 5IHKA 5CQYA 1PSEA 2D8HA 2SEMA 1E6GA 1WFWA 4LD6A 1K73R 2P4TA 5FLXE 4F7UF 2HZYA 2CP2A 4PJOC 4PJOE 2EAYA 2LCSA 1FWZA 3REAB 2P0PA 1VIEA 5GAOp 3I5RA 2E41A 3QZ5B 3ULRB 2DTIA 1VIFA 2KGTA 4AFZC 4F16A 3CCET 4KULA 4BB7A 1Q86R 2VASA 4BI4A 2O4XA 1HSQA 2EQIA 2KRMA 5A2QE 3LX7A 4JRQA 3PIOA 2RQUA 1W2BA 3MEUA 3CCRT 3NGPA 2JTFA 2KEAA 3MO8A 5LJ5h 2HQEA 4M78A 2RQVA 1WXBA 2K5FA 2HKQB 4C8QD 2NUTB 1MGQA 4C0FA 2J06A 1M3CA 4DBRA 3PTAA 4LE9A 3M5AA 1YJ9T 1X75C 5KE3A 5GAN5 1VQLT 4IUUA 2XICA 1OULA 4QKUA 4J8OA 4AG1C 3CCUA 1U5SA 1KFZA 1T0HA 3CBOA 4AMCA 2CZ0B 5LJ5g 1VQ8Q 3ER0A 4R56A 2AKKA 3JCMh 2LJ0A 3LGLA 3INZA 2L3SA 4PJOB 2HSEB 2IVWA 1KQSA 2D0QB 1M2VB 4QW2A 2XHCA 1K9MR 3X25B 4PFZA 2O01E 3MEVA 1X69A 2DL3A 1RL2A 2D8JA 3RBBB 1ZSZC 3KFVA 2KROA 2VXFA 1N9SA 5I2SA 3EG2A 1FYNA 1I81A 2GFAA 2KT8A 1EX4A 3VJPA 3HL8A 3H0FA 1G3TA 2MK5A 1KQ1A 4FW2A 4M77A 1UJYA 4Q5WA 1UDLA 5EG2A 1FMVA 1M1KC 2YXYA 3TREA 3PMIA 4C8QG 4BY6C 1SF9A 4M7DA 1ZA1B 1W1FA 3EGXA 2KAFA 2KQWA 3JCMb 2XKOC 2FB7A 1WYXA 4C92C 4C92E 4HCKA 4ELYC 2PQWA 4BUGA 5GANe 4J7FA 3M9QA 4OMMA 1BI3A 1VQOA 1PRLC 3VUZA 3L2RA 3ZL7C 2EJ9A 4DBQA 2AKLA 2PNIA 2W0ZA 3TSWA 2OTJA 1EFNA 3QHSA 1YP5A 3NTIA 3UF4A 3V7RA 5GAMe 1AWXA 4FT4A 1I0CA 1RAAB 1MMAA 3QPHA 4CRIA 3CC7A 2DIGA 5FU6C 1S1NA 2JZ2A 1WJQA 3EG3A 2LX7A 4FYYB 2LQNA 3I55T 5DM7R 2JM8A 4M7AF 3MPUB 3KUFA 4QQ6A 2DL7A 5CK9A 3RNJA 3CMAT 1UGRB 3H6ZA 1K9MU 4BY6B 3CMEQ 1RAIB 3H41A 2KRSA 1FMWA 5IH2A 3C12A 4C92B 1UGSB 4K11A 5A0GA 2CGHA 2EQUA 3M59A 5C0MA 2BTTA 3OW2S 2GTOA 4A54A 4PJMA 3CCJA 5KCHA 2AK5A 1JRIA 1BBZA 4LN2A 4Z88A 2MAMA 4HCCA 1KSWA 2JXBA 1KHCA 3M0TA 1YJWQ 1OPKA 1VQ5T 3J81E 1BI1A 2CUDA 2QG9B 2OAUA 4FSSA 1BU1A 5FU6B 4J6WA 2RHUA 5DLOA 4O6JA 2R5MA 3OQ5A 2DM1A 1WIEA 4R55A 4FU6A 2DK3A 1JEGA 5A0LA 4RCCA 3ZEHA 4XU3A 4IIOA 3VU3C 2NYSA 1RLQC 2JTEA 4C5HA 3CXCS 1H3ZA 4N0AC 2GQVA 2E4HA 2CYZB 1IZ6A 1RI9A 4PJJA 1E6HA 2KMTA 1VQMA 2HKNA 3CCMT 2LMJA 1I8FA 2COWA 3I56A 4LDVA 4M7AA 1VYTA 2H3JA 4J7IA 2C06A 5KYXA 4JS5A 2J6FA 1B7TA 1G5VA 1OU8A 5GMKe 3O5ZA 2NLUA 3DB3A 1M1KR 4ZGEB 2EIFA 2JOYA 2KDSA 1RUWA 2JTMA 1NYGA 2MWPA 2JS2A 1G8XA 1GFCA 3I9QA 4P5NA 2JS0A 3JCMW 1S72Q 3CCUQ 2DVEA 1M27C 2YUNA 1RAEB 3C95A 1I07A 3CC4A 1U1TA 1O75A 1WJSA 4JJBA 3AT1B 1I5OB 4C0ZA 4XTXA 2P4RA 3CC2T 4QT7A 4EDUA 4LUDA 1X6OA 3URGA 2ENMA 5L8RE 4M75A 4RTWA 4B6MA 2QGFB 4F7UE 5GAOl 4RTVA 2H8HA 3PMTA 4IURA 4J9DA 1UFFA 1ZBJA 4JRPA 5LJ3e 2DXCA 1PKTA 2RJDA 1SHFA 1VQPA 3TU4K 2HQHA 1N8RC 1AZEA 1B34B 1W2BS 1OZ3A 3OYIA 1GBRA 5IHIA 5CCAA 2DMOA 3CPWP 1VQ9T 3BFMA 2AZVA 2JMAA 1Y57A 1KJWA 3A8LB 2BE9B 5KYWA 2K3BA 2F69A 3GP8A 1UUEA 2DBKA 3L2ZA 1N27A 2L5QA 2DE0X 2LQ8A 1ZUKA 1GCQA 2D6FA 5CQXA 3JV3A 4OMNA 2K5LA 4PLIA 1OI1A 4RUGA 5GMKi 1D3BA 2GNCA 5KYUB 5FW9A 4F7UB 1VQOQ 1NLOC 1Y96B
chains in the Genus database with same CATH topology
1R77A 2MK5A 4LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R77 A;  2MK5 A;  4LXC A; 
#chains in the Genus database with same CATH topology
 1KQS S;  3QJ6 A;  4MZM A;  5GAN 2;  4EIK A;  5GAN h;  3TSZ A;  1NBE B;  2OTJ Q;  4DBH A;  3M0Q A;  2AHJ B;  4PJO D;  4FM4 B;  2QGG A;  2CT3 A;  4OML A;  3SD4 A;  1WQW A;  2DD4 A;  2L2P A;  3A1P A;  3CC7 Q;  1PM3 A;  1M90 U;  1XOV A;  1TTH B;  3J7A F;  5GAM h;  2MI6 A;  4OB0 B;  2YUQ A;  2ABL A;  1NPP A;  3SEM A;  2E64 A;  1Y71 A;  1PG5 B;  4BI3 A;  4JJN K;  4KRT A;  1QWE A;  3UT1 A;  2DPP B;  4IUT A;  1TU0 B;  4BD3 A;  1SG5 A;  5GAM g;  2RHZ A;  4IUP A;  1W6X A;  4MDW A;  2V8K A;  4E7H A;  3CCJ Q;  3JB9 H;  2DEU A;  2P84 A;  2DRK A;  2JT4 A;  2VWF A;  4JDS A;  2ZPB B;  1QP2 A;  1RI0 A;  2X9H A;  2Z0W A;  2YRD A;  1KD1 U;  2EPD A;  1VA7 A;  2PUO B;  3CCE A;  2E3I A;  3OYD A;  1YWO A;  4ANJ A;  2CSI A;  3RDV A;  2RHY A;  2QEX T;  3AHU A;  2FHD A;  3E2U A;  3BW1 A;  3H9N A;  1V76 A;  2CT4 A;  3MP1 A;  3UAT A;  3OYB A;  3OS5 A;  1KQ2 A;  1C1A A;  4PJO G;  1IRE B;  2EJF A;  1JJ2 S;  3QUI A;  2DTO A;  2DIL A;  1D0Z A;  2ZPG B;  4M7A C;  2KBT A;  2QAZ A;  2CP7 A;  2YHT A;  2X4X A;  1N8R R;  3H0I A;  1VQM Q;  3RKW A;  1OOT A;  2GF7 A;  5HK3 A;  2E5Q A;  1LPL A;  2O9S A;  1XQH A;  2DX1 A;  3OYN A;  4KUD K;  3JCM c;  3G6E A;  5GAN 7;  3HTR A;  3I56 Q;  3EH1 A;  4QQD A;  2YRC A;  2M02 A;  4PJN A;  4GY5 A;  4A63 B;  4C92 D;  2GFU A;  4M78 F;  1AHJ B;  1ZA2 B;  2DA9 A;  3HRS A;  1X27 A;  1HK9 A;  1GL5 A;  2DL4 A;  3S3M A;  1K0S A;  2YLC A;  4M75 C;  2EGA A;  5C6S A;  2MPX C;  3WXM B;  2FYK A;  1YIJ T;  4JS4 A;  5GMK h;  3NPF A;  4N4I A;  2GGR A;  2JMC A;  3WVD B;  3FC3 A;  1JXO A;  1WGS A;  3JCM P;  3CC4 Q;  1W4S A;  3OS2 A;  2XDB A;  2KNB B;  3SHW A;  4BE0 A;  2XU8 A;  1SPK A;  3JRZ A;  5D6X A;  3JB9 F;  1RAF B;  3QYG B;  4KBM B;  4A4H A;  2K6D A;  2MOX A;  1H64 1;  2OAW A;  1JBM A;  3VRZ A;  1YNZ A;  3SWN A;  1VQP Q;  4E47 A;  5FWC A;  4HCZ A;  2K79 A;  2I0N A;  5CIU A;  4II1 A;  3P8H A;  2K57 A;  3EG9 A;  5LJ3 h;  2FPF A;  4A4F A;  2J05 A;  2CZ7 B;  3ASK A;  2HL5 C;  1D09 B;  3HRT A;  4ZGJ B;  3VS5 A;  3VS4 A;  4XTU A;  1N5Z A;  3R6O A;  2E5K A;  1FXX A;  4KGZ B;  3PNW C;  4NS5 A;  3MP8 A;  4C0G A;  1WNL A;  4LNP A;  5I22 A;  1N8R U;  3CBM A;  1KC8 U;  4M77 F;  4C92 G;  1QCF A;  5LJ3 g;  1BIA A;  1M9S A;  3RKY A;  4MDX A;  1TOV A;  2L3P A;  2DKG A;  3CPF A;  1M3A A;  3OMG A;  3CEY A;  1TXQ A;  2WSF E;  4M7D F;  4ZNX A;  5LJ5 d;  3I55 A;  4PNO A;  2A28 A;  2IG0 A;  2XK0 A;  1CKA A;  4KGX B;  3QG1 A;  2LVM A;  3KXT A;  4C8Q A;  4R0K A;  1G3Y A;  2QA4 T;  1K76 A;  1K1Z A;  1TUD A;  2M51 A;  3MKD A;  1Q95 G;  5LJ5 j;  8AT1 B;  5CKD A;  3H8Z A;  5CKF A;  3C4S A;  4MML A;  3GBQ A;  1MUZ A;  1YI2 A;  1VYU A;  3QWY A;  3MEA A;  1ZX6 A;  2ZAE A;  3PFS A;  2VB6 A;  5KYY A;  2QQB A;  1M30 A;  1LNX A;  1YHQ T;  2LQK A;  1IB8 A;  4ZN3 A;  4NL2 A;  1PSF A;  4OVA A;  2FZC B;  1D3B B;  2I2L A;  3LWH A;  1YCY A;  3LYI A;  4KT0 E;  1RAG B;  3IQL A;  1VQ5 A;  1BB9 A;  3JAM E;  4MMK A;  2F5K A;  4QVD A;  1Y7X A;  3EG0 A;  3JCM g;  1VQ4 A;  1K8A U;  2F1L A;  3KBG A;  4ORZ A;  1WHJ A;  2FEI A;  3JCM X;  2EKO A;  3GF5 A;  3OYF A;  2RH2 A;  4AT1 B;  1WXT A;  2CZ6 B;  1K73 U;  4RTY A;  4JJC A;  1IRX A;  3RKX A;  2NUP B;  1X6B A;  2YLB A;  2XDP A;  3CME T;  1JU5 C;  1BI2 A;  3EGD A;  1SSH A;  3CCE Q;  4J9H A;  4GLM A;  3G1J A;  3EHR A;  2K3Y A;  2RI2 A;  1Q86 U;  1M8V A;  2GCX A;  3PGG A;  1GFD A;  4LDW A;  1TH7 A;  3GLX A;  4EMK C;  1PD1 A;  2EYY A;  3NHN A;  1WA7 A;  5FRN A;  1A0N B;  1YJW T;  2KVQ G;  2QQ9 A;  2HQX A;  2V8J A;  1GBQ A;  1VQ7 Q;  2C0O A;  4OP0 A;  2LX9 A;  3JB9 J;  6AT1 B;  1BK2 A;  1ZSZ B;  1TSF A;  3V8L A;  2V26 A;  3G6E Q;  4FYX B;  2MF2 A;  4PFP A;  1BI0 A;  2EW3 A;  2KRN A;  1Q7Y C;  1M4Z A;  2DNU A;  4HCB A;  2KR3 A;  2OTL T;  1QVF S;  3JB9 G;  2CZ1 B;  4LDX A;  4HKE A;  4BAC A;  1NJI C;  4DBF A;  2DXU A;  5CR2 A;  2EBP A;  1ZBX A;  1AWO A;  2PVG B;  1PD0 A;  1KK7 A;  1Z9Z A;  4HVW A;  1Z9Q A;  2DFU A;  4EMK B;  3L2U A;  3S3N A;  2LQW A;  4M4Z A;  1RAB B;  1JO8 A;  3OYG A;  3SWN C;  1VQ9 A;  1UEC A;  4F7U G;  4JZ3 A;  2SRC A;  1KQS P;  2XG8 D;  2RK2 A;  3EFR A;  1WJR A;  4M75 F;  3HPW A;  1S72 T;  4M77 G;  2Y4X A;  4CI0 C;  2RA2 A;  1CSK A;  1VQN A;  4KUI A;  4A53 A;  5GAN 6;  2OX7 A;  2LNV A;  3NFC A;  1OZ2 A;  4WCI A;  3CPW A;  1IGQ A;  3HFN A;  4RTX A;  4JJD A;  1SEM A;  4YTL A;  2QQS A;  2XID A;  2R5A A;  3M53 A;  2O9V A;  2NUZ A;  2DYB A;  1T3L A;  3M57 A;  2JW4 A;  3RMQ A;  1X43 A;  2K3X A;  3CCQ A;  1OX8 A;  2RMO A;  4M78 C;  4M78 E;  2ROT A;  2X3X D;  2AT1 B;  2VYT A;  3G7Z A;  3V7C A;  1VQK T;  1SRL A;  3VYG A;  3V7S A;  4DOW A;  3L2V A;  4HVV A;  4OB1 B;  3EFO B;  3OYK A;  3CCS T;  2KY9 A;  4A4K A;  3VS1 A;  7AT1 B;  3FJ5 A;  5D6W A;  3T9N A;  2AIR B;  3PVQ A;  1QVG P;  2RQW A;  3CBP A;  2LCC A;  2L0A A;  1NM7 A;  3L2W A;  2DZC A;  2DBM A;  2DL8 A;  1WPY A;  2CH4 A;  2YUO A;  1M1G A;  2KXC A;  4M7A D;  1YI2 Q;  3VS3 A;  3M4Y A;  1K9A A;  2O4X B;  2HNI A;  2QXF A;  1I4K 1;  2G3R A;  3QDF A;  2VUB A;  1JJ2 P;  1WDX A;  3MP6 A;  4HVU A;  3HRU A;  4M78 B;  1WLP B;  1UHC A;  3DKM A;  2OTJ T;  3VS2 A;  1K4U S;  3C0C A;  1VQ5 Q;  2RM4 A;  3S3O A;  3D7S B;  2QEX A;  2L89 A;  2LTO A;  4Z02 A;  2QTX A;  1VQ4 Q;  1Q7Y R;  4M77 C;  4M77 E;  2WSE E;  1UHF A;  2FVU A;  4M75 D;  3ME9 A;  5AYF A;  2GTJ A;  2M16 A;  2BZX A;  1WHL A;  2DJQ A;  2P0K A;  2KYB A;  1NJI R;  4M7D C;  4M7D E;  4MZT A;  2EFI A;  4LDY A;  2GBQ A;  1X01 A;  2PTK A;  3QJY A;  2RN8 A;  1N9R A;  2O31 A;  1TUG B;  4Z8A A;  1JXM A;  4F17 A;  5KE2 A;  2QDY B;  3OYL A;  3L42 A;  4J9G A;  1M5Q 1;  2NUT A;  4C0D C;  3CCJ T;  1RAC B;  4V2S A;  4XTV A;  1KHI A;  4M7A G;  4HA8 A;  1VQ6 T;  2FG0 A;  3TEE A;  2RJC A;  3EGU A;  5GJW B;  4C5E A;  3BDU A;  8ATC B;  1M1K U;  3M56 A;  2VC8 A;  1NE8 A;  2LZ6 B;  4E2F B;  1YIJ A;  2M0O A;  2ZCF B;  4M77 B;  2ED1 A;  2G6F X;  1H3H A;  4BI8 B;  4PJO A;  4J9C A;  2R58 A;  1YIT T;  2KI7 A;  2M1H A;  4VUB A;  5GAN j;  3QSU A;  1M2V A;  2XMF A;  2KE9 A;  4PLL A;  2MCN A;  4M7D B;  1ZQ1 A;  3UDC A;  3EGX B;  2DZ9 A;  5GAM d;  2BZY A;  3TCJ A;  3QO3 A;  3CCL T;  3CCV T;  1WX6 A;  5GAN g;  3E19 A;  4M75 G;  4HT8 A;  1JB0 E;  5FRM A;  2RHI A;  3P8B B;  1Q82 C;  2P0Q A;  5GAM j;  4LDU A;  5HK0 A;  4HXJ A;  4C0D B;  3I56 T;  2RI3 A;  2HCK A;  1M2O A;  1Q7Y U;  2A3L A;  3CD6 T;  4C5I A;  4HT9 A;  2DO3 A;  2OI3 A;  4E7Z A;  1VQ9 Q;  1IHW A;  2D0N A;  3PVL A;  4NL3 A;  1NJI U;  1N6A A;  2D1X A;  2M0Y A;  2QYZ A;  3THK A;  3G71 T;  4JRI A;  2BE7 D;  4RG2 A;  3GIB A;  4X1V A;  1RAD B;  3QDR B;  1QKW A;  1VQN Q;  3OS0 A;  2IIM A;  4RTU A;  3RR6 A;  1YJN T;  4IKF A;  3CCR A;  1OPL A;  4F04 B;  3VYH B;  4RCB A;  3OB9 A;  1NEG A;  1BYM A;  3RMS A;  3DB4 A;  1PCX A;  3MHX A;  1GCP A;  1OV3 A;  2DD5 A;  3G4S T;  1R77 A;  4XQ3 A;  2XD0 A;  1AZG B;  2QA4 A;  5GAO q;  4M7A E;  4XTZ A;  3CCQ Q;  1YJ9 A;  1YBY A;  1G83 A;  4WTO B;  1VQL A;  2L3R A;  2ZPF B;  1ABO A;  3NMZ C;  2HMA A;  2WSC E;  1T0J A;  2MIO A;  5D6Y A;  1LJO A;  4B9W A;  2RQR A;  3F70 A;  3M54 A;  4OMF B;  4PL6 A;  2RQT A;  1YHQ A;  5KH6 A;  4E6R A;  5J3B A;  3OYM A;  4N4G A;  1D1B A;  1R0C B;  2YDL A;  5DLQ E;  4C92 A;  1XNI A;  2B8A A;  2IPO B;  1R8O B;  5LJ5 f;  3HHT B;  5CO7 A;  5FRO A;  4KH0 B;  3L2Q A;  1QMC A;  4C8Q F;  2VGM A;  2JUF A;  2H3E B;  4M75 E;  4XTW A;  1LVK A;  2E6N A;  5CKB A;  4CC4 B;  1UGV A;  1YCS B;  4X34 A;  4EMG A;  2ZPH B;  3BDL A;  1ZHI A;  1PWT A;  4DA4 A;  1O9S A;  2K9G A;  4QQG A;  3A98 A;  4M7A B;  4L5G A;  2QTV A;  5GMK j;  1AVZ C;  4D8D A;  5KYX B;  1EIF A;  3JCM f;  2D9T A;  1YWP A;  2DF6 A;  2CP6 A;  2F5T X;  2X35 A;  1ZLM A;  2FRW A;  5CKH A;  4A4E A;  2HD0 A;  3NTH A;  4X9D A;  4X9C A;  1G3S A;  2E6Z A;  2Y90 A;  1WI7 A;  5AT1 B;  2QEX Q;  4XAX B;  5IAY A;  1VQ8 T;  1SRM A;  3EG1 A;  4C5G A;  2QAS A;  5GAO n;  2ED0 A;  3MCA B;  2CP5 A;  2EQJ A;  5EC7 A;  3OSS C;  3RIR A;  3UA6 A;  3A8H B;  4J6X A;  1NG2 A;  3JSC A;  1AT1 B;  4J9B A;  1GCQ C;  1IHV A;  1NZ9 A;  2CP3 A;  1QVF P;  1YJW A;  4ATO A;  2ZPI B;  3UPU A;  2EQM A;  1Q82 R;  4OGC A;  2F2X A;  2QK0 A;  4M75 B;  1WXU A;  5FU7 C;  5LJ3 j;  4RTZ A;  3OSV A;  2EYZ A;  5J26 A;  3A8G B;  3PT9 A;  4J83 A;  5GJV B;  5L23 A;  3OW2 P;  1XJW B;  3VRY A;  1PRM C;  3H0H A;  1UEB A;  2OTL A;  2PVO B;  2DET A;  4E7J A;  1J3T A;  2FZK B;  1G2B A;  1QP3 A;  2KK4 A;  4ME7 A;  3L1A A;  2JM9 A;  2JVV A;  2ZPE B;  3CMA A;  1SHG A;  2FPD A;  3OYE A;  1M8M A;  4Y28 E;  2EVR A;  1IXD A;  2R57 A;  3HFO A;  1YIJ Q;  3FB9 A;  1MHN A;  5KYW B;  2CUB A;  4N0A A;  5GAO r;  2M9U A;  3EH2 A;  1IO6 A;  1X2K A;  4M78 D;  2EJG A;  5A0D A;  2HL3 A;  3JCM d;  2YUP A;  1AWJ A;  3DLM A;  2COY A;  1C0M A;  2ROL A;  2PZ1 A;  1V29 B;  4E7I A;  5FU7 B;  3CXC P;  2RD1 A;  3LW5 E;  1WHM A;  1VQ7 T;  1S72 A;  3ZFJ A;  1B34 A;  4OMP A;  2CP0 A;  2L3Q A;  2YSQ A;  2A7Y A;  2F2W A;  4LUE A;  5IXF A;  4Z89 A;  3G6E T;  3JCM Q;  1NYF A;  1Q81 C;  3FJP A;  2EYQ A;  3JB9 D;  1LOJ A;  3VS6 A;  2A37 A;  1PC0 A;  2CSQ A;  4PJL A;  4PK4 A;  4DEY A;  4DOV A;  3JB9 I;  4D8K A;  2JJ9 A;  3FIF A;  1C6V X;  4TVR A;  2HBP A;  4RG8 A;  1Q82 U;  1D1A A;  2LC4 A;  2EKH A;  5J39 A;  5IT9 E;  3I35 A;  1ZUY A;  3X24 B;  3CCM A;  2DTH A;  2RF0 A;  1VQK A;  1YFN A;  5KYU A;  2MMP A;  4F7U A;  1DJ7 B;  1QWF A;  1Y96 A;  3CCR Q;  3CCS A;  4GLK A;  2LP5 A;  1T3S A;  2RJE A;  2RI5 A;  1VOM A;  2O88 A;  4ZN1 A;  3A5Z B;  1UTI A;  4M77 D;  2RPN A;  4FL6 A;  4KGV B;  2QA4 Q;  4FYW B;  4M78 G;  4KH1 B;  3EHQ A;  1YJ9 Q;  1VQL Q;  4M7D D;  2VKN A;  2K7A A;  4XU1 A;  3M58 A;  4O5V A;  4IUQ A;  1MV3 A;  4BDY A;  3OYH A;  2JNG A;  1UJ0 A;  2J6K A;  4J6Y A;  2KYM A;  1W2B P;  1QVG A;  1M90 C;  4A4G A;  1YHQ Q;  3CC2 A;  4E7K A;  4B9X A;  2LT1 A;  3QKJ A;  4XU0 A;  2CH4 W;  1UG1 A;  4ZTJ A;  2PVD B;  2K2V A;  4CC2 A;  5M9O A;  1PKS A;  1TUC A;  2A36 A;  4JLI A;  2RJF A;  3WVE B;  1AD5 A;  2VGN A;  1FMK A;  2AZS A;  5LL6 S;  1M3B A;  3OYJ A;  2BIV A;  2FL7 A;  2HAX A;  4FYV B;  5GMK l;  2FPE A;  3U23 A;  1JJ2 A;  3M0P A;  1ACM B;  2J7I A;  2XI9 A;  2E70 A;  1QQJ A;  4IUV A;  2HDA A;  2YT6 A;  2RB6 A;  1ABQ A;  4JZ4 A;  3BY7 A;  2GQI A;  2W10 A;  3E9G A;  3PIP A;  1V1C A;  2PU9 B;  1KD1 C;  5GMK m;  3UWN A;  2FRY A;  1GRI A;  3GNG A;  3UA7 A;  2QQR A;  1YI2 T;  3CCU T;  2JN0 A;  4QVC A;  1RAH B;  2KXD A;  2LDM A;  1F1B B;  4RTT A;  3SFM A;  3TVT A;  4ELZ C;  2MYS A;  3E9F A;  1YN8 A;  3MET A;  4M7D G;  2ATC B;  2RK1 A;  3R6N A;  1VQ6 A;  2C0T A;  2E3H A;  3LLR A;  1TG0 A;  3QII A;  1BKB A;  3OS1 A;  2DVJ A;  3QBY A;  2LJ1 A;  4BDZ A;  5I2M A;  1HYO A;  1U1S A;  5FWB A;  1Y0M A;  2O2O A;  2X51 A;  4UC4 A;  1Q81 R;  1VQ4 T;  5GAN 8;  3C94 A;  3M0S A;  4JUV A;  4E7S A;  4C8Q E;  4C8Q C;  4E7L A;  1YIT A;  3VUB A;  1D0Y A;  1UGP B;  3ZBD A;  3LH5 A;  2F2V A;  1I5L A;  2HEQ A;  3SWN B;  1G3W A;  2BKD N;  4BE1 A;  2DYI A;  2X4W A;  2VXE A;  4DQ2 A;  2BUD A;  2OTL Q;  3GNF B;  3I55 Q;  4CC3 A;  2XDD A;  3CCV A;  3CCL A;  2K4Y A;  1XTD A;  3EG9 B;  2RO0 A;  4J9I A;  1UE9 A;  3OYY A;  1WQ7 A;  2E1H A;  1OU9 A;  3VV0 A;  2DEQ A;  3CMA Q;  2J6O A;  1R0B G;  1LCK A;  1HXD A;  1QVP A;  1PNJ A;  1OX9 A;  1P92 A;  4XK8 E;  3HP9 A;  2HBW A;  5GAN f;  3CD6 A;  2V1R A;  2EGE A;  2QI2 A;  3OYA A;  1BIB A;  4PJO F;  1VQO T;  5I11 A;  1AWW A;  2QDL A;  5KCO A;  5I21 A;  1D1C A;  3G71 A;  2X3W D;  4JLG A;  3OA6 A;  1K0X A;  3GOX A;  5IHN A;  1OQK A;  4OB2 B;  4C8Q B;  2RNA A;  5GAM f;  4OMO A;  1QCN A;  4L59 A;  1M90 R;  1YJN A;  1FX7 A;  3CC7 T;  1AOJ A;  1WZO A;  4FT2 A;  9ATC B;  1KIK A;  1WHH A;  2X4J A;  1X2Q A;  3G4S A;  5KYY B;  2DXB A;  2QQA A;  3RER A;  4NOY A;  1U06 A;  2BZ8 A;  1RLP C;  2VVK A;  2LJ3 A;  2EYX A;  3QZ9 B;  3S6W A;  1KG1 A;  3X28 B;  2LRQ A;  2LT4 A;  3TQ7 P;  3A8O B;  3CQT A;  1H8K A;  4D6W A;  5CAI A;  1Q81 U;  2YRV A;  1KC8 C;  4FSX A;  3CCM Q;  3OYC A;  1VQK Q;  1OEB A;  5GAO m;  5IXB A;  1MV0 B;  4OGE A;  4Y91 A;  3DLL A;  1BCM A;  4CC7 A;  3CCS Q;  4J5Y A;  3PE0 A;  3BE3 A;  1B07 A;  1KD1 R;  5ECA A;  1E7O A;  1MMG A;  1UGQ B;  2ECZ A;  1VUB A;  1SSF A;  2NWM A;  2EQK A;  3FDR A;  5LJ5 e;  1ZUU A;  5GAN d;  4N4H A;  2FZG B;  2A08 A;  1VQN T;  1QLY A;  1NLP C;  3EGD B;  2DLP A;  2PUK B;  4AFQ C;  3FRN A;  1NPR A;  4GBQ A;  5HCK A;  1EZZ B;  1U3O A;  1VYV A;  3NTK A;  1ZSG A;  3LGF A;  4J9E A;  3CC2 Q;  3X26 B;  1CKB A;  2EYW A;  2C0I A;  2OJ2 A;  4ZGD B;  3CCQ T;  4L6V 5;  3JCM e;  3JCM V;  1QCO A;  1VQM T;  3M55 A;  4MZP A;  2E12 A;  4C92 F;  4ZTF A;  3X20 B;  1VQ8 A;  2DL5 A;  5GAN 4;  2ZGW A;  4EPC A;  1H92 A;  2WAC A;  3LWI A;  1K8A C;  4QVZ A;  2KT1 A;  1U8R A;  4FCY A;  2NUP A;  1BCO A;  5CVI A;  1ARK A;  3REB B;  4AG2 C;  1W70 A;  2MWO A;  1X6G A;  1K73 C;  2EGC A;  3E1S A;  1WHG A;  1HJD A;  2COZ A;  2V8I A;  2B86 A;  3EAE A;  4Y92 A;  2E65 A;  1I1J A;  2X4Y A;  3A8M B;  3GPL A;  2ZZD A;  2Y4Y A;  2LCL A;  2CRE A;  4EMH A;  4OMQ A;  1QW1 A;  1Q86 C;  1D0X A;  4AFU C;  4XTY A;  4J9F A;  2CDT A;  3CC4 T;  3FEO A;  4LXC A;  1QVF A;  1PHT A;  1QVG S;  5GAN 3;  1VQ6 Q;  3I5S A;  2DIQ A;  4FW1 A;  2LNH B;  3OBY A;  1IGU A;  1GXI E;  2DER A;  3V8K A;  4F14 A;  4IIM A;  2FO0 A;  1Y07 A;  1ZSZ A;  3M0R A;  1NEB A;  5LJ3 f;  2CS7 A;  4LD9 K;  2L8D A;  4JRK A;  4PFO A;  3QYH B;  1VQP T;  3VKI A;  3OW2 A;  2DJZ A;  1YIT Q;  1QKX A;  5HKC A;  3VS7 A;  5D7U A;  2DAQ A;  1MND A;  3CCL Q;  3CCV Q;  3MJX A;  2A0F B;  3JCM J;  1VQ7 A;  3SDZ A;  1KC8 R;  2K2M A;  1UB4 A;  5HY6 A;  4EMK A;  3LH0 A;  2CKK A;  1K9M C;  1TWB A;  1WHK A;  2HSP A;  3VS0 A;  2YWW A;  3O8V A;  1TS9 A;  3CD6 Q;  3CPW S;  1OYX A;  3N5B B;  3CXC A;  5IN1 A;  2DXT A;  3OBW A;  3FLG A;  3G71 Q;  4PKC C;  1B3Q A;  2RHX A;  3CME A;  4RMO A;  4AFS C;  5KYN A;  2ESW A;  2KSS A;  1MMN A;  5CKE A;  3HKS A;  1HD3 A;  3OY9 A;  2V1Q A;  3RUX A;  4OB3 B;  1YJN Q;  1M1F A;  1MNE A;  2E10 A;  4RKU E;  3P8D A;  2EWN A;  4WF2 A;  4ESR A;  3OMC A;  5LJ3 d;  3HSB A;  4DEX A;  3M4G A;  3G4S Q;  3QWX X;  3EFS A;  4OF1 A;  1MMD A;  2VV5 A;  3SB2 A;  3RES A;  4FIB A;  2DRM A;  1SKU B;  3M0U A;  4JPB W;  3Q1J A;  3J80 E;  3MEW A;  1JQQ A;  4BE2 A;  2K5I A;  1K8A R;  4XU2 A;  5DY9 A;  3EFO A;  1AEY A;  3QXE B;  3V8J A;  5IHK A;  5CQY A;  1PSE A;  2D8H A;  2SEM A;  1E6G A;  1WFW A;  4LD6 A;  1K73 R;  2P4T A;  5FLX E;  4F7U F;  2HZY A;  2CP2 A;  4PJO C;  4PJO E;  2EAY A;  2LCS A;  1FWZ A;  3REA B;  2P0P A;  1VIE A;  5GAO p;  3I5R A;  2E41 A;  3QZ5 B;  3ULR B;  2DTI A;  1VIF A;  2KGT A;  4AFZ C;  4F16 A;  3CCE T;  4KUL A;  4BB7 A;  1Q86 R;  2VAS A;  4BI4 A;  2O4X A;  1HSQ A;  2EQI A;  2KRM A;  5A2Q E;  3LX7 A;  4JRQ A;  3PIO A;  2RQU A;  1W2B A;  3MEU A;  3CCR T;  3NGP A;  2JTF A;  2KEA A;  3MO8 A;  5LJ5 h;  2HQE A;  4M78 A;  2RQV A;  1WXB A;  2K5F A;  2HKQ B;  4C8Q D;  2NUT B;  1MGQ A;  4C0F A;  2J06 A;  1M3C A;  4DBR A;  3PTA A;  4LE9 A;  3M5A A;  1YJ9 T;  1X75 C;  5KE3 A;  5GAN 5;  1VQL T;  4IUU A;  2XIC A;  1OUL A;  4QKU A;  4J8O A;  4AG1 C;  3CCU A;  1U5S A;  1KFZ A;  1T0H A;  3CBO A;  4AMC A;  2CZ0 B;  5LJ5 g;  1VQ8 Q;  3ER0 A;  4R56 A;  2AKK A;  3JCM h;  2LJ0 A;  3LGL A;  3INZ A;  2L3S A;  4PJO B;  2HSE B;  2IVW A;  1KQS A;  2D0Q B;  1M2V B;  4QW2 A;  2XHC A;  1K9M R;  3X25 B;  4PFZ A;  2O01 E;  3MEV A;  1X69 A;  2DL3 A;  1RL2 A;  2D8J A;  3RBB B;  1ZSZ C;  3KFV A;  2KRO A;  2VXF A;  1N9S A;  5I2S A;  3EG2 A;  1FYN A;  1I81 A;  2GFA A;  2KT8 A;  1EX4 A;  3VJP A;  3HL8 A;  3H0F A;  1G3T A;  2MK5 A;  1KQ1 A;  4FW2 A;  4M77 A;  1UJY A;  4Q5W A;  1UDL A;  5EG2 A;  1FMV A;  1M1K C;  2YXY A;  3TRE A;  3PMI A;  4C8Q G;  4BY6 C;  1SF9 A;  4M7D A;  1ZA1 B;  1W1F A;  3EGX A;  2KAF A;  2KQW A;  3JCM b;  2XKO C;  2FB7 A;  1WYX A;  4C92 C;  4C92 E;  4HCK A;  4ELY C;  2PQW A;  4BUG A;  5GAN e;  4J7F A;  3M9Q A;  4OMM A;  1BI3 A;  1VQO A;  1PRL C;  3VUZ A;  3L2R A;  3ZL7 C;  2EJ9 A;  4DBQ A;  2AKL A;  2PNI A;  2W0Z A;  3TSW A;  2OTJ A;  1EFN A;  3QHS A;  1YP5 A;  3NTI A;  3UF4 A;  3V7R A;  5GAM e;  1AWX A;  4FT4 A;  1I0C A;  1RAA B;  1MMA A;  3QPH A;  4CRI A;  3CC7 A;  2DIG A;  5FU6 C;  1S1N A;  2JZ2 A;  1WJQ A;  3EG3 A;  2LX7 A;  4FYY B;  2LQN A;  3I55 T;  5DM7 R;  2JM8 A;  4M7A F;  3MPU B;  3KUF A;  4QQ6 A;  2DL7 A;  5CK9 A;  3RNJ A;  3CMA T;  1UGR B;  3H6Z A;  1K9M U;  4BY6 B;  3CME Q;  1RAI B;  3H41 A;  2KRS A;  1FMW A;  5IH2 A;  3C12 A;  4C92 B;  1UGS B;  4K11 A;  5A0G A;  2CGH A;  2EQU A;  3M59 A;  5C0M A;  2BTT A;  3OW2 S;  2GTO A;  4A54 A;  4PJM A;  3CCJ A;  5KCH A;  2AK5 A;  1JRI A;  1BBZ A;  4LN2 A;  4Z88 A;  2MAM A;  4HCC A;  1KSW A;  2JXB A;  1KHC A;  3M0T A;  1YJW Q;  1OPK A;  1VQ5 T;  3J81 E;  1BI1 A;  2CUD A;  2QG9 B;  2OAU A;  4FSS A;  1BU1 A;  5FU6 B;  4J6W A;  2RHU A;  5DLO A;  4O6J A;  2R5M A;  3OQ5 A;  2DM1 A;  1WIE A;  4R55 A;  4FU6 A;  2DK3 A;  1JEG A;  5A0L A;  4RCC A;  3ZEH A;  4XU3 A;  4IIO A;  3VU3 C;  2NYS A;  1RLQ C;  2JTE A;  4C5H A;  3CXC S;  1H3Z A;  4N0A C;  2GQV A;  2E4H A;  2CYZ B;  1IZ6 A;  1RI9 A;  4PJJ A;  1E6H A;  2KMT A;  1VQM A;  2HKN A;  3CCM T;  2LMJ A;  1I8F A;  2COW A;  3I56 A;  4LDV A;  4M7A A;  1VYT A;  2H3J A;  4J7I A;  2C06 A;  5KYX A;  4JS5 A;  2J6F A;  1B7T A;  1G5V A;  1OU8 A;  5GMK e;  3O5Z A;  2NLU A;  3DB3 A;  1M1K R;  4ZGE B;  2EIF A;  2JOY A;  2KDS A;  1RUW A;  2JTM A;  1NYG A;  2MWP A;  2JS2 A;  1G8X A;  1GFC A;  3I9Q A;  4P5N A;  2JS0 A;  3JCM W;  1S72 Q;  3CCU Q;  2DVE A;  1M27 C;  2YUN A;  1RAE B;  3C95 A;  1I07 A;  3CC4 A;  1U1T A;  1O75 A;  1WJS A;  4JJB A;  3AT1 B;  1I5O B;  4C0Z A;  4XTX A;  2P4R A;  3CC2 T;  4QT7 A;  4EDU A;  4LUD A;  1X6O A;  3URG A;  2ENM A;  5L8R E;  4M75 A;  4RTW A;  4B6M A;  2QGF B;  4F7U E;  5GAO l;  4RTV A;  2H8H A;  3PMT A;  4IUR A;  4J9D A;  1UFF A;  1ZBJ A;  4JRP A;  5LJ3 e;  2DXC A;  1PKT A;  2RJD A;  1SHF A;  1VQP A;  3TU4 K;  2HQH A;  1N8R C;  1AZE A;  1B34 B;  1W2B S;  1OZ3 A;  3OYI A;  1GBR A;  5IHI A;  5CCA A;  2DMO A;  3CPW P;  1VQ9 T;  3BFM A;  2AZV A;  2JMA A;  1Y57 A;  1KJW A;  3A8L B;  2BE9 B;  5KYW A;  2K3B A;  2F69 A;  3GP8 A;  1UUE A;  2DBK A;  3L2Z A;  1N27 A;  2L5Q A;  2DE0 X;  2LQ8 A;  1ZUK A;  1GCQ A;  2D6F A;  5CQX A;  3JV3 A;  4OMN A;  2K5L A;  4PLI A;  1OI1 A;  4RUG A;  5GMK i;  1D3B A;  2GNC A;  5KYU B;  5FW9 A;  4F7U B;  1VQO Q;  1NLO C;  1Y96 B; 
#chains in the Genus database with same CATH homology
 1R77 A;  2MK5 A;  4LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...