2MK5A

Solution structure of a protein domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
SNAKNYMDKGTSSSTVVKDGKTSSASTPATRPVTGSWKKNQYGTWYKPENATFVNGNQPIVTRIGSPFLNAPVGGNLPAGATIVYDEVCIQAGHIWIGYNAYNGNRVYCPVRTCQGVPPNHIPGVAWGVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization Reveals LysGH15 as an Unprecedented "EF-Hand-Like" Calcium-Binding Phage Lysin
doi rcsb
molecule keywords Endolysin
molecule tags Hydrolase
source organism Staphylococcus phage gh15
total genus 18
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08460 SH3_5 Bacterial SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.410 Mainly Beta Roll SH3 type barrels. Cell wall targeting domain of glycylglycine endopeptidase 2mk5A00
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH superfamily
4ZNXA 4F7UE 2FVUA 1N8RR 2JXBA 3OA6A 3VRYA 1QVGA 2DJQA 3CCJA 3E1SA 1BU1A 1AWXA 2AKLA 3OYJA 1Q7YR 2OJ2A 2KT1A 2EKHA 2HMAA 1YP5A 4NS5A 5GMKl 1QMCA 3KUFA 3TU4K 2ROTA 2LQ8A 3J81E 4KRTA 1X69A 3QYGB 2O9SA 5J26A 4M7DG 2DXBA 3H0HA 5I22A 2WSCE 5GANf 2LP5A 1ZBJA 2L2PA 1ZSZA 1ZSZC 3CCRT 4N4GA 2YDLA 5GANg 4HCZA 3ZFJA 2RA2A 1I07A 1UGSB 1KHCA 5IN1A 2LQKA 2YRCA 5DY9A 2COWA 5ECAA 3NTHA 5CO7A 2EYZA 4E7JA 2E1HA 1WPYA 3NGPA 1R0CB 4EPCA 3C95A 2DXUA 1UTIA 1VQ6Q 4C8QG 1ZSGA 2RNAA 4AFQC 1Q82R 1MHNA 1ARKA 2BKDN 1RAFB 3CCLA 1S72Q 4BY6C 3JCMP 1GRIA 1MMDA 3FJ5A 3H6ZA 2D0NA 2QQBA 3HFNA 4FT2A 5IHIA 4KGVB 3JCMg 2RF0A 1IXDA 2YUQA 3VS7A 2GTOA 3O5ZA 1V29B 1VQMT 4YTLA 3CC4A 1MUZA 3P8BB 4LUEA 4HT9A 2DL4A 1OULA 1RAIB 1K73U 3BFMA 2F2XA 2K7AA 2L3RA 3L2ZA 4PFOA 5GJVB 1QKWA 3CCMQ 4M7AA 2DO3A 1G3SA 2CREA 4M7AC 1QP3A 2JOYA 3G4ST 1UGQB 1VQ5A 4X9DA 2CUBA 1U1SA 5C6SA 4KULA 2FZCB 4ANJA 2HCKA 3PE0A 3VS2A 1KD1R 5IXBA 3CCET 4JDSA 2A36A 3NMZC 1YJ9T 4OMQA 2E6ZA 1SSFA 2OI3A 1CSKA 1JU5C 2A3LA 1JBMA 1K1ZA 4OMMA 3HP9A 2ZPEB 3CC7A 4X1VA 2FZKB 4NOYA 4F17A 1YHQT 2D8HA 2LJ3A 5GAOm 2VB6A 4OB3B 4CC2A 4EMGA 1GFDA 1X6BA 5GMKe 1KFZA 3JB9F 5KYYA 1H8KA 2BE9B 3MP1A 4C5EA 1WJQA 2DIQA 2GCXA 3I35A 3DLLA 2ZPIB 3C94A 1K9MR 2LCSA 1OX8A 2CP6A 3C12A 4JLIA 1TU0B 4AG2C 5KE2A 1H3HA 3A8GB 4C5GA 3A8LB 1Q81C 3OS2A 1VQNQ 3U23A 2Y4YA 3H9NA 2DBKA 5LJ5h 4DBRA 1U3OA 5GANe 1R0BG 5GAMf 4M77E 2GGRA 1OZ3A 4K11A 2CP5A 4FW1A 3LWIA 1LCKA 2QASA 1IZ6A 1LJOA 1U1TA 1SF9A 4JJCA 3PGGA 4DEYA 4QW2A 1NLOC 2DPPB 1ZSZB 4ATOA 1HSQA 3QDFA 2RHZA 3LYIA 1T0HA 4JUVA 4RTTA 1SEMA 1N9SA 2I0NA 4B9XA 2JMAA 3EG1A 1YI2A 4HVVA 1A0NB 2QQSA 2V1RA 2FB7A 3I5SA 4QVZA 4J7IA 5KYUA 2IG0A 4TVRA 1IO6A 2F69A 4BUGA 3EH2A 2DKGA 2QQ9A 2V8KA 1UJYA 4OGCA 2DERA 3I56Q 1JEGA 1Q86U 4F7UG 1V76A 1NJIC 3M5AA 1FXXA 4KUDK 2C06A 5HK0A 1Y7XA 1K73R 4X34A 4B9WA 1M30A 4OGEA 1ZBXA 4IIMA 2L89A 1VQ6T 2YXYA 4LDYA 5D6XA 4F14A 1WJRA 1YWOA 1AT1B 1X2KA 4Z02A 5A0DA 1AHJB 1G2BA 1M1KU 4BI4A 1VQ7Q 2DTHA 3VUZA 1O9SA 3SHWA 5LJ3j 2FZGB 1KQ1A 1BBZA 4M77D 2EJ9A 4GBQA 1VQPA 1YWPA 3QJ6A 1ZLMA 1UDLA 4A53A 4GLKA 4M7AB 2JTEA 2K3XA 3RERA 2HAXA 2GQVA 2PUOB 3LGFA 1WIEA 3V8JA 1WA7A 2ZAEA 1G3YA 1RAAB 4IUTA 2OTJQ 5M9OA 3CCMT 3G71A 1UEBA 1KQ2A 1Y71A 2JTFA 2JT4A 3MEWA 2EQJA 2H3JA 1X6OA 3SB2A 3S3MA 2WSEE 3PIPA 4M78E 1VYUA 3FIFA 2EJFA 2E5QA 3JSCA 2GFAA 3E9GA 4LE9A 3ZL7C 1EFNA 2OAUA 3A8OB 3A8HB 2MAMA 4N4HA 4DOVA 2BZ8A 4ZN3A 3OYBA 5KYYB 1K9AA 2R5MA 1S72A 2QYZA 4J6WA 4QT7A 3RBBB 3CCJQ 2M16A 1AEYA 1OEBA 5LJ3d 2HL5C 5L23A 3HL8A 2ED0A 2DZ9A 2LRQA 5C0MA 1K8AR 2HNIA 3X25B 3OSVA 4JJNK 1ZUUA 3OYMA 2KYMA 1SSHA 1WQ7A 2KBTA 1RI9A 4RCBA 1QCNA 4LD6A 1SHGA 3H8ZA 4PFZA 1BK2A 1F1BB 1VQNT 1TOVA 1KSWA 1G5VA 1TSFA 3G1JA 2DD4A 1CKAA 4PJJA 4HXJA 4A4HA 3T9NA 5HK3A 3CBPA 1BB9A 1BCOA 1OI1A 3TVTA 5A2QE 1KC8U 4M75F 2AK5A 4IUUA 2FO0A 2EYQA 3L2QA 2QDLA 1PD0A 2P4TA 4M78D 1LOJA 3VV0A 3C0CA 4FM4B 2D1XA 1QCFA 2HZYA 2O4XA 5GMKh 5KYUB 2CDTA 2DVJA 2F2WA 1Y96A 4OB1B 1RAEB 1AZEA 2RQRA 1NJIU 3PMTA 1H641 4DBHA 1TXQA 3CCVQ 5EC7A 3QZ9B 4AG1C 3EGUA 1KJWA 2Y90A 3L2UA 3M4YA 4WCIA 3CC4Q 2QGFB 4KBMB 5CKEA 1BCMA 3HKSA 2A0FB 1M8VA 4QQ6A 2HDAA 3I56T 5GANh 4M7DA 1N8RU 4MZPA 4M7DC 4DBFA 2ZPHB 4M77G 1WDXA 2CZ0B 1Q7YU 1VQ5Q 1RLQC 1UE9A 5FRNA 2LNVA 2PVOB 3MKDA 2JW4A 3I55A 1AWWA 2HSEB 1SRMA 2PZ1A 4E7LA 1RL2A 2DTOA 3JCMQ 3CXCP 3S6WA 3E2UA 2RM4A 4ME7A 1VQ7T 2RQWA 4ELZC 5GAOl 2EQIA 3M59A 1T3LA 2COYA 3EFRA 4O5VA 2CP7A 1YNZA 3CC7Q 2O88A 4C8QA 1M90R 4C92F 2VV5A 4KH0B 4EMKA 3OYHA 4EMKC 4QKUA 4PK4A 3A5ZB 3SFMA 2DETA 1EZZB 2CZ1B 2CP0A 2DFUA 2BZYA 2OTJT 3QPHA 2YSQA 4EDUA 4BB7A 4PJOF 4FW2A 5CVIA 2SRCA 3JCMV 1PWTA 1BIAA 3HRSA 1YIJA 4L6V5 3M0TA 1Q82U 3CXCA 2DZCA 1M1GA 3SDZA 3DB3A 4HVUA 2DD5A 5FU7C 2DL8A 3OS1A 2EJGA 2LT1A 3OS0A 3GLXA 5D6WA 4NL2A 1QQJA 3REBB 2CKKA 1QP2A 4FT4A 1PKTA 4M4ZA 1K73C 3CCJT 5CAIA 1NM7A 2EPDA 2KGTA 4Z88A 4JZ3A 2YUOA 4MMLA 4AFUC 2CH4W 2NUPA 2KMTA 2C0OA 2KYBA 2MI6A 4FCYA 2YWWA 1YITA 2V26A 2K2MA 4A4FA 5I11A 4LXCA 4XK8E 4BE0A 3EG3A 1YI2Q 1UG1A 1KD1U 1VQLA 5GMKi 2RO0A 4M78G 1MGQA 4GLMA 3JB9D 1QVPA 2A7YA 2BZXA 2J6KA 3CBMA 3HRTA 3OS5A 4R0KA 2MCNA 4BD3A 3INZA 2HQXA 1WZOA 4AFZC 4C0FA 5FW9A 1UHFA 2K5FA 4J9GA 2MYSA 2O4XB 4RTWA 1VYTA 5IXFA 3NHNA 1E7OA 1Y96B 2LX9A 4Z8AA 4XTZA 2E3IA 1VUBA 4N0AA 4N0AC 3URGA 2WSFE 4ZTFA 3M0UA 4RUGA 3RKYA 5GAMh 3EFOA 2VXEA 2OX7A 3CCLT 2QTVA 4P5NA 5GAN3 2D8JA 2FEIA 2HKNA 1NZ9A 1K9MU 2CGHA 1K0XA 2KR3A 5DLOA 2VGNA 4D8DA 5CR2A 4FYWB 2H8HA 5LJ5j 1VQPQ 4ZN1A 2M9UA 4M7DB 5GJWB 2MF2A 1ZQ1A 1U06A 3CC4T 2E10A 4LDXA 2GF7A 3CCSQ 3ZEHA 2YLCA 2M0YA 1M2VB 3QYHB 3RUXA 4BDZA 1WFWA 3SD4A 4BI8B 1NPPA 2LQNA 1WHHA 3MCAB 3G71Q 1LPLA 2KDSA 4OP0A 1VQ5T 2COZA 5GAN7 3EFSA 3NTIA 2KRNA 2B86A 2KAFA 2V8IA 2EKOA 3CPFA 4C8QB 1KK7A 2DF6A 1WGSA 2EQMA 4EMKB 5LJ3g 2DM1A 4KGXB 1VQ9A 1WYXA 1C1AA 2ZCFB 4HT8A 1OPKA 3UT1A 4V2SA 1SG5A 2MPXC 4F7UA 2X4JA 3JCMf 1I5LA 1RACB 2RPNA 2V8JA 3EHRA 1VQOA 3CC7T 2AZVA 2LJ0A 3GP8A 4CI0C 2K5LA 3CCVA 2E3HA 3MEAA 4LDVA 3C4SA 1Q86C 2RK2A 5AT1B 1TUCA 5LJ5d 2LNHB 1Z9QA 2KXDA 1M2OA 1SPKA 2FL7A 5FU7B 3QKJA 2XU8A 4Y92A 3V7CA 5DM7R 2ZZDA 5HCKA 3CCQA 1TS9A 3LW5E 2JM8A 4HA8A 1M1KC 1Y0MA 1QLYA 3LH0A 4KUIA 1M4ZA 2DL3A 4M75E 1LVKA 3OBYA 2NUPB 2K4YA 3BY7A 2QG9B 2P4RA 2RJCA 3VS1A 3CEYA 4F16A 3ME9A 1PSEA 1GL5A 3TSWA 1NEBA 2C0TA 3D7SB 3JB9G 2Y4XA 1RAGB 1YJWA 2KRMA 4JRPA 2J7IA 5D6YA 2KVQG 4EIKA 4XU1A 1BI0A 2QK0A 2L3QA 2RQVA 3LH5A 4FU6A 1YI2T 5CCAA 3JCMX 5D7UA 5KYWA 5CIUA 2QAZA 5FRMA 5L8RE 4FYYB 3RMSA 5I2SA 1PNJA 3FC3A 1WXUA 3SWNB 3CMAA 3EFOB 2ZPFB 4E7ZA 5KYXA 2M0OA 3OBWA 1UECA 4PL6A 2MWPA 3WVDB 4MDXA 4BACA 1K8AU 4RCCA 2K3YA 3I55Q 4QVCA 1NPRA 1HYOA 4HKEA 2HEQA 2JJ9A 4JRKA 1XQHA 2FRWA 4II1A 2CYZB 4M75D 2MOXA 3OB9A 5CKFA 3KXTA 3G6EA 3BDLA 1MMAA 2LCCA 5LJ3e 2RK1A 2J6OA 4C92E 3CCUQ 1M3BA 1VQPT 2DL5A 2CP3A 2EYYA 4BE2A 1M27C 1QWFA 2CS7A 1AWOA 1KC8C 3TREA 4PJOE 2GFUA 3QHSA 4XAXB 5IAYA 2QA4Q 4D6WA 3JCMe 1GFCA 1TTHB 3G71T 1MV3A 2CUDA 1N6AA 2XDDA 1NYFA 1YIJQ 2DXCA 2PQWA 2L0AA 1VQ8A 2RJEA 4F7UB 3V8KA 1HXDA 1VIEA 4A4KA 2K6DA 3QWYA 2ZGWA 3RKWA 4EMHA 3M4GA 2MIOA 3GNFB 3UA7A 2XICA 3AT1B 2DRKA 3CXCS 4DEXA 2VYTA 4F04B 2RHXA 4A4GA 3HPWA 3OW2P 2JTMA 1AD5A 1WHJA 1OPLA 2YT6A 2AKKA 5IHNA 4M77A 1WHGA 4M77C 3JV3A 1S72T 2CZ6B 1QVFS 1K76A 3QBYA 4XTYA 1KG1A 2DRMA 2KNBB 2DBMA 4GY5A 1N8RC 2EQUA 3TEEA 1PSFA 1ZUKA 5GAN4 1Q7YC 4LDWA 4QQDA 1YITQ 3CCSA 4A4EA 4O6JA 1W6XA 2B8AA 1T0JA 1B34A 3R6OA 4Q5WA 4IUPA 3VJPA 4JRIA 3ER0A 1ZA1B 4ZGEB 2GQIA 3OYYA 4C92D 3FDRA 1VQKA 1VQLQ 3EAEA 4IURA 2HQHA 3SEMA 4RG2A 1X2QA 1QCOA 4OMOA 4PKCC 2YLBA 2L8DA 1NG2A 4LNPA 4PJOD 2RJFA 2WACA 3DKMA 4J7FA 4HCKA 1KQSS 3CC2A 1XOVA 4QQGA 3F70A 1M90U 2KROA 1U5SA 4M7AF 1W4SA 2JVVA 2QEXA 3VU3C 2W10A 1EIFA 1TUGB 3JRZA 1W2BS 5KYWB 5A0GA 1SRLA 5GANd 4MDWA 1Q82C 3M57A 3E19A 3TCJA 2DEUA 2F2VA 2NYSA 3EGXA 2X4XA 2KRSA 5DLQE 3P8HA 3QZ5B 3I5RA 1JRIA 1VIFA 5KYXB 2DLPA 2LJ1A 4E7HA 2LMJA 4X9CA 3KBGA 2L5QA 2AZSA 3I9QA 2D6FA 4FL6A 4XTVA 4PLIA 3QSUA 1GCQA 4M75G 1GCQC 2EGCA 1KIKA 2DEQA 1NBEB 1WI7A 3JB9H 2RB6A 2X3XD 2O01E 3TQ7P 3V8LA 1SHFA 2PTKA 2HBWA 4ORZA 1GXIE 4PJNA 4WF2A 1JB0E 2FYKA 2JMCA 3X26B 4M78A 3I55T 4M78C 3L2RA 2EBPA 4A54A 3TSZA 4J83A 4RTZA 1B3QA 2X3WD 4XTWA 4OF1A 3M55A 2O9VA 1KD1C 4Y28E 1VQ9Q 5LJ5g 2FPDA 1DJ7B 2NUTA 3J7AF 1X27A 1VQOQ 5CKBA 4VUBA 2OTLA 2QQAA 1UJ0A 2DE0X 5I21A 4E7SA 1D0YA 2FPEA 8AT1B 1BI2A 2A08A 2EYWA 2G3RA 5KCHA 2RJDA 1AZGB 4MZTA 3CCQQ 5GAMj 1YIJT 1WNLA 2XIDA 4M77B 1OOTA 4PFPA 1K9MC 3THKA 4AFSC 4RTUA 5I2MA 1D3BA 1M5Q1 1MNEA 1YJNA 3EHQA 2GTJA 1M2VA 2PU9B 3L1AA 2HL3A 3OYDA 2EW3A 2K5IA 3CCRQ 3CD6A 4C92G 2DJZA 3ZBDA 5FWCA 1B34B 5GAN8 2DIGA 2YRDA 1YN8A 1YCSB 4J9EA 1I5OB 1QVFP 3CCUA 2RI2A 2E5KA 3QIIA 2V1QA 1HK9A 2VC8A 3CMEA 5EG2A 1WLPB 1YJWQ 3VYHB 4PJOG 1YITT 2K79A 4JS4A 3LX7A 2NLUA 2XMFA 3UATA 2A37A 4C8QC 3JCMh 1K0SA 1QKXA 2DL7A 3DB4A 2QA4A 1ZHIA 3PVLA 1JXOA 3HRUA 1VQLT 2EWNA 2G6FX 3GIBA 1PG5B 1WX6A 3PT9A 2R58A 4R55A 5GAMd 1FMVA 4JPBW 2AHJB 3RMQA 3R6NA 5GAN5 4RMOA 2BE7D 2E12A 1UGVA 3KFVA 1VQ4A 3CMAQ 1Q81R 1D09B 1QVFA 1OYXA 4Y91A 1I0CA 3NTKA 1KQSP 3O8VA 2P84A 3EGXB 2LTOA 2DA9A 2K9GA 2BUDA 4XTUA 1Y07A 5GAOp 1NE8A 2AIRB 2CSIA 2RHIA 3M58A 2X4YA 1X01A 1X43A 4Z89A 1W2BP 2CH4A 2ECZA 5FROA 3G6EQ 2RHUA 2KSSA 3VUBA 3S3OA 5KE3A 2R57A 2NWMA 1PCXA 1XNIA 2Z0WA 4J9BA 2JNGA 5LJ5e 2XDBA 3P8DA 3BE3A 1G3TA 1UGRB 2HSPA 4ESRA 2EVRA 4JS5A 1ZX6A 1FYNA 3MEVA 3RIRA 1W1FA 4M78B 4OMNA 3VS3A 3META 1KQSA 1JQQA 3EG9A 3PNWC 2LQWA 3VS4A 3IQLA 4PJLA 8ATCB 1OV3A 2FRYA 3OYAA 1ACMB 2HKQB 2X4WA 4C0ZA 3FJPA 1VQ8Q 2NUTB 3M0SA 3V7SA 3DLMA 1W2BA 4KH1B 4LDUA 2RQUA 1M3CA 2EQKA 2P0PA 5IH2A 5J3BA 1TUDA 3H0IA 1VQ9T 3N5BB 3EGDA 3S3NA 5KYNA 3SWNA 4MZMA 1M3AA 3G7ZA 3SWNC 1I8FA 3GBQA 3ULRB 2ZPBB 3WXMB 4A63B 1VQOT 2VXFA 1H3ZA 1UHCA 2CP2A 2M02A 3MJXA 2IPOB 4ELYC 2H3EB 3CCVT 4B6MA 5CQXA 2RH2A 2YHTA 3UDCA 2QXFA 1JJ2S 4HVWA 5FLXE 2XD0A 1N27A 1JO8A 2OAWA 2DYBA 2EAYA 1D3BB 2DAQA 2KY9A 4RKUE 1K8AC 1HD3A 2EGEA 1LNXA 3CCQT 1ZUYA 2IVWA 1JXMA 3REAB 1VQKQ 4DBQA 3FB9A 4JZ4A 2P0QA 2GNCA 1WQWA 5LJ3f 4BE1A 3QDRB 4BDYA 2GBQA 4N4IA 3QUIA 3H41A 2ROLA 3VYGA 4M7AE 1VA7A 3CC2Q 3OW2S 3LGLA 4CRIA 4M7DF 2HD0A 9ATCB 1PD1A 2QEXQ 3CPWS 1YJWT 4CC3A 2F5TX 3WVEB 5GAN6 4ZTJA 2RQTA 4JJBA 5KCOA 2MWOA 2CSQA 1BKBA 4L5GA 1IRXA 4C0DB 2KXCA 2K2VA 1PM3A 1N5ZA 1QW1A 1D1BA 1IREB 2M1HA 3JCMJ 4C8QF 2RMOA 5HY6A 4RG8A 3PVQA 1WXTA 5FU6C 2D9TA 3CMAT 1TWBA 1QWEA 2RN8A 2YUPA 1SKUB 1W70A 3PMIA 4E7KA 2ED1A 3CCRA 2DXTA 1WHLA 7AT1B 1D0ZA 1G3WA 2FG0A 3A98A 1C0MA 3CBOA 3G6ET 4OB0B 3AHUA 2QDYB 3OYKA 4M7AD 2I2LA 3JCMW 3EG9B 2E4HA 4LD9K 4J6XA 3BW1A 2OTLQ 2R5AA 4E47A 3UWNA 4AMCA 2QI2A 2EFIA 4C5IA 5AYFA 1M90C 1ABOA 1OQKA 1RAHB 3RDVA 1V1CA 5KH6A 2PVGB 4LUDA 1PKSA 5GAOn 3MHXA 2L3SA 2PUKB 3EGDB 4IUVA 3MEUA 1VQ8T 2LDMA 1VQMA 1IHVA 2VVKA 5GAOq 2RD1A 2JS0A 2JN0A 3QJYA 2CZ7B 4J6YA 3X20B 4XU2A 3HHTB 3LWHA 4ZGJB 4M75A 4M75C 3EG0A 1YJNQ 1BI3A 2LZ6B 1I4K1 1C6VX 4DOWA 3G4SA 2VUBA 3CD6Q 2PVDB 1BI1A 2DTIA 3BDUA 4XU3A 3M53A 3CCEA 3M0RA 2IIMA 3CMEQ 1YBYA 1R8OB 4DA4A 1YJ9A 4PJMA 3NFCA 3V7RA 3CCST 1IGUA 3FRNA 1JJ2P 2XKOC 5J39A 2HBPA 5GAMg 1GBQA 3M54A 5IHKA 1FX7A 1VQKT 2PNIA 3OSSC 3QG1A 1YHQA 1XTDA 3NPFA 1ABQA 4CC7A 2RI3A 3M9QA 2X35A 2X51A 5GMKj 1E6GA 1R77A 1OX9A 1PRMC 1XJWB 2DX1A 3CC2T 3JAME 2RHYA 1VQ4Q 5CKHA 2M51A 2L3PA 2O2OA 4KGZB 3ASKA 2QEXT 3QWXX 3J80E 1JJ2A 1IB8A 4IIOA 4BY6B 3CPWP 5GANj 1M8MA 3PIOA 3GPLA 4C5HA 3OQ5A 4MMKA 4HCCA 4OMLA 1HJDA 1MV0B 2MMPA 4E2FB 2XI9A 4KT0E 5FU6B 4C92A 2QTXA 4C92C 3GOXA 4F7UF 2KT8A 3Q1JA 3OYEA 2VKNA 1UFFA 4FYXB 6AT1B 2BTTA 4PJOA 4PJOC 2E65A 1WHMA 1D0XA 2J05A 1K4US 3H0FA 4OVAA 2D0QB 3RNJA 4M7AG 3OW2A 2KK4A 5GMKm 1WJSA 3UPUA 2J6FA 3CPWA 2JZ2A 5A0LA 2K57A 1UUEA 3OYNA 2LC4A 2KQWA 1KHIA 3X28B 4XTXA 3RESA 4HCBA 2NUZA 3A8MB 5GAN2 4C0GA 4NL3A 2YRVA 2DVEA 1O75A 1OU9A 1IGQA 3HSBA 2OTLT 1VQ6A 1H92A 2ATCB 1G83A 2JM9A 2ESWA 3JCMb 2FPFA 2JUFA 3JB9I 3OYCA 1YCYA 2KI7A 1Q81U 2LX7A 3HTRA 4M75B 3GNGA 4QVDA 2E41A 2ABLA 3M0QA 5GAMe 1QVGS 2KEAA 2J06A 3MPUB 1P92A 4LN2A 4J5YA 1PRLC 1N9RA 3OYGA 1NLPC 2W0ZA 1UB4A 4RTVA 1YJNT 5CK9A 2QQRA 3JCMd 1M1FA 4M7DE 1TG0A 4FYVB 5LJ5f 3CCMA 4R56A 1E6HA 2X9HA 2VWFA 3CD6T 2EGAA 1TH7A 1AOJA 2P0KA 3PTAA 3CCUT 3OYIA 3CMET 1MMNA 4J9FA 3MO8A 1GBRA 1I81A 1MMGA 2VASA 2QA4T 4RTXA 1Q86R 4OMPA 3UA6A 3A1PA 1AWJA 5CKDA 2DMOA 4PLLA 4C8QE 3VS0A 4OB2B 1Q95G 3CCLQ 1PC0A 1BIBA 4E7IA 4D8KA 2XHCA 2F1LA 1VOMA 1OU8A 1VQ4T 1G8XA 1M1KR 5LL6S 3MP8A 2RI5A 2LCLA 3UF4A 2E64A 1B07A 4JJDA 1VQNA 2YUNA 4C92B 3OY9A 5LJ3h 3L2VA 3M0PA 1EX4A 3EG2A 4XU0A 1RLPC 1ZA2B 1WHKA 2AT1B 2JS2A 1BYMA 2LVMA 2DK3A 3VRZA 4PJOB 4M7DD 3L42A 3L2WA 2E6NA 4J9HA 4FIBA 1UGPB 4PNOA 3FEOA 4M77F 1J3TA 2EYXA 4DQ2A 2A28A 1OZ2A 1CKBA 1I1JA 2QGGA 4FSXA 4L59A 1NEGA 1B7TA 3VS5A 2DILA 2BIVA 4E6RA 2SEMA 3MP6A 4JLGA 1FMWA 4OMFB 1Z9ZA 4AT1B 1RI0A 1VQMQ 4IUQA 4C0DC 2DNUA 2XG8D 4C8QD 1RABB 4FSSA 1U8RA 3VKIA 2O31A 4XQ3A 3VS6A 5HKCA 1Y57A 3I56A 3RKXA 5CQYA 5GAOr 3QO3A 2EIFA 2ZPGB 3G4SQ 1FWZA 4J9CA 3JB9J 2FHDA 2MK5A 1VYVA 2DYIA 3CCEQ 3QXEB 4J9DA 1YJ9Q 3FLGA 1VQ7A 4ZGDB 4JRQA 3HFOA 1X75C 1FMKA 2C0IA 1M9SA 1KC8R 2F5KA 3LLRA 4J8OA 3CQTA 2KE9A 3RR6A 1RADB 5IT9E 1YHQQ 1GCPA 1QVGP 2ENMA 4BI3A 1NYGA 4RTYA 2E70A 3OMCA 3PFSA 2VGMA 1YFNA 3OMGA 2K3BA 1D1AA 3E9FA 2OTJA 2XDPA 3X24B 3M56A 4WTOB 2LT4A 1T3SA 1NJIR 4CC4B 1WXBA 4IKFA 2XK0A 1X6GA 1RUWA 1IHWA 3OYFA 3OYLA 1AVZC 4J9IA 2HQEA 1MNDA 1S1NA 3JCMc 4M78F 2CT4A 4UC4A 5FWBA 1D1CA 3GF5A 3EH1A 2CT3A 1PHTA
chains in the Genus database with same CATH topology
2MK5A 1R77A 4LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MK5 A;  1R77 A;  4LXC A; 
#chains in the Genus database with same CATH topology
 4ZNX A;  4F7U E;  2FVU A;  1N8R R;  2JXB A;  3OA6 A;  3VRY A;  1QVG A;  2DJQ A;  3CCJ A;  3E1S A;  1BU1 A;  1AWX A;  2AKL A;  3OYJ A;  1Q7Y R;  2OJ2 A;  2KT1 A;  2EKH A;  2HMA A;  1YP5 A;  4NS5 A;  5GMK l;  1QMC A;  3KUF A;  3TU4 K;  2ROT A;  2LQ8 A;  3J81 E;  4KRT A;  1X69 A;  3QYG B;  2O9S A;  5J26 A;  4M7D G;  2DXB A;  3H0H A;  5I22 A;  2WSC E;  5GAN f;  2LP5 A;  1ZBJ A;  2L2P A;  1ZSZ A;  1ZSZ C;  3CCR T;  4N4G A;  2YDL A;  5GAN g;  4HCZ A;  3ZFJ A;  2RA2 A;  1I07 A;  1UGS B;  1KHC A;  5IN1 A;  2LQK A;  2YRC A;  5DY9 A;  2COW A;  5ECA A;  3NTH A;  5CO7 A;  2EYZ A;  4E7J A;  2E1H A;  1WPY A;  3NGP A;  1R0C B;  4EPC A;  3C95 A;  2DXU A;  1UTI A;  1VQ6 Q;  4C8Q G;  1ZSG A;  2RNA A;  4AFQ C;  1Q82 R;  1MHN A;  1ARK A;  2BKD N;  1RAF B;  3CCL A;  1S72 Q;  4BY6 C;  3JCM P;  1GRI A;  1MMD A;  3FJ5 A;  3H6Z A;  2D0N A;  2QQB A;  3HFN A;  4FT2 A;  5IHI A;  4KGV B;  3JCM g;  2RF0 A;  1IXD A;  2YUQ A;  3VS7 A;  2GTO A;  3O5Z A;  1V29 B;  1VQM T;  4YTL A;  3CC4 A;  1MUZ A;  3P8B B;  4LUE A;  4HT9 A;  2DL4 A;  1OUL A;  1RAI B;  1K73 U;  3BFM A;  2F2X A;  2K7A A;  2L3R A;  3L2Z A;  4PFO A;  5GJV B;  1QKW A;  3CCM Q;  4M7A A;  2DO3 A;  1G3S A;  2CRE A;  4M7A C;  1QP3 A;  2JOY A;  3G4S T;  1UGQ B;  1VQ5 A;  4X9D A;  2CUB A;  1U1S A;  5C6S A;  4KUL A;  2FZC B;  4ANJ A;  2HCK A;  3PE0 A;  3VS2 A;  1KD1 R;  5IXB A;  3CCE T;  4JDS A;  2A36 A;  3NMZ C;  1YJ9 T;  4OMQ A;  2E6Z A;  1SSF A;  2OI3 A;  1CSK A;  1JU5 C;  2A3L A;  1JBM A;  1K1Z A;  4OMM A;  3HP9 A;  2ZPE B;  3CC7 A;  4X1V A;  2FZK B;  4NOY A;  4F17 A;  1YHQ T;  2D8H A;  2LJ3 A;  5GAO m;  2VB6 A;  4OB3 B;  4CC2 A;  4EMG A;  1GFD A;  1X6B A;  5GMK e;  1KFZ A;  3JB9 F;  5KYY A;  1H8K A;  2BE9 B;  3MP1 A;  4C5E A;  1WJQ A;  2DIQ A;  2GCX A;  3I35 A;  3DLL A;  2ZPI B;  3C94 A;  1K9M R;  2LCS A;  1OX8 A;  2CP6 A;  3C12 A;  4JLI A;  1TU0 B;  4AG2 C;  5KE2 A;  1H3H A;  3A8G B;  4C5G A;  3A8L B;  1Q81 C;  3OS2 A;  1VQN Q;  3U23 A;  2Y4Y A;  3H9N A;  2DBK A;  5LJ5 h;  4DBR A;  1U3O A;  5GAN e;  1R0B G;  5GAM f;  4M77 E;  2GGR A;  1OZ3 A;  4K11 A;  2CP5 A;  4FW1 A;  3LWI A;  1LCK A;  2QAS A;  1IZ6 A;  1LJO A;  1U1T A;  1SF9 A;  4JJC A;  3PGG A;  4DEY A;  4QW2 A;  1NLO C;  2DPP B;  1ZSZ B;  4ATO A;  1HSQ A;  3QDF A;  2RHZ A;  3LYI A;  1T0H A;  4JUV A;  4RTT A;  1SEM A;  1N9S A;  2I0N A;  4B9X A;  2JMA A;  3EG1 A;  1YI2 A;  4HVV A;  1A0N B;  2QQS A;  2V1R A;  2FB7 A;  3I5S A;  4QVZ A;  4J7I A;  5KYU A;  2IG0 A;  4TVR A;  1IO6 A;  2F69 A;  4BUG A;  3EH2 A;  2DKG A;  2QQ9 A;  2V8K A;  1UJY A;  4OGC A;  2DER A;  3I56 Q;  1JEG A;  1Q86 U;  4F7U G;  1V76 A;  1NJI C;  3M5A A;  1FXX A;  4KUD K;  2C06 A;  5HK0 A;  1Y7X A;  1K73 R;  4X34 A;  4B9W A;  1M30 A;  4OGE A;  1ZBX A;  4IIM A;  2L89 A;  1VQ6 T;  2YXY A;  4LDY A;  5D6X A;  4F14 A;  1WJR A;  1YWO A;  1AT1 B;  1X2K A;  4Z02 A;  5A0D A;  1AHJ B;  1G2B A;  1M1K U;  4BI4 A;  1VQ7 Q;  2DTH A;  3VUZ A;  1O9S A;  3SHW A;  5LJ3 j;  2FZG B;  1KQ1 A;  1BBZ A;  4M77 D;  2EJ9 A;  4GBQ A;  1VQP A;  1YWP A;  3QJ6 A;  1ZLM A;  1UDL A;  4A53 A;  4GLK A;  4M7A B;  2JTE A;  2K3X A;  3RER A;  2HAX A;  2GQV A;  2PUO B;  3LGF A;  1WIE A;  3V8J A;  1WA7 A;  2ZAE A;  1G3Y A;  1RAA B;  4IUT A;  2OTJ Q;  5M9O A;  3CCM T;  3G71 A;  1UEB A;  1KQ2 A;  1Y71 A;  2JTF A;  2JT4 A;  3MEW A;  2EQJ A;  2H3J A;  1X6O A;  3SB2 A;  3S3M A;  2WSE E;  3PIP A;  4M78 E;  1VYU A;  3FIF A;  2EJF A;  2E5Q A;  3JSC A;  2GFA A;  3E9G A;  4LE9 A;  3ZL7 C;  1EFN A;  2OAU A;  3A8O B;  3A8H B;  2MAM A;  4N4H A;  4DOV A;  2BZ8 A;  4ZN3 A;  3OYB A;  5KYY B;  1K9A A;  2R5M A;  1S72 A;  2QYZ A;  4J6W A;  4QT7 A;  3RBB B;  3CCJ Q;  2M16 A;  1AEY A;  1OEB A;  5LJ3 d;  2HL5 C;  5L23 A;  3HL8 A;  2ED0 A;  2DZ9 A;  2LRQ A;  5C0M A;  1K8A R;  2HNI A;  3X25 B;  3OSV A;  4JJN K;  1ZUU A;  3OYM A;  2KYM A;  1SSH A;  1WQ7 A;  2KBT A;  1RI9 A;  4RCB A;  1QCN A;  4LD6 A;  1SHG A;  3H8Z A;  4PFZ A;  1BK2 A;  1F1B B;  1VQN T;  1TOV A;  1KSW A;  1G5V A;  1TSF A;  3G1J A;  2DD4 A;  1CKA A;  4PJJ A;  4HXJ A;  4A4H A;  3T9N A;  5HK3 A;  3CBP A;  1BB9 A;  1BCO A;  1OI1 A;  3TVT A;  5A2Q E;  1KC8 U;  4M75 F;  2AK5 A;  4IUU A;  2FO0 A;  2EYQ A;  3L2Q A;  2QDL A;  1PD0 A;  2P4T A;  4M78 D;  1LOJ A;  3VV0 A;  3C0C A;  4FM4 B;  2D1X A;  1QCF A;  2HZY A;  2O4X A;  5GMK h;  5KYU B;  2CDT A;  2DVJ A;  2F2W A;  1Y96 A;  4OB1 B;  1RAE B;  1AZE A;  2RQR A;  1NJI U;  3PMT A;  1H64 1;  4DBH A;  1TXQ A;  3CCV Q;  5EC7 A;  3QZ9 B;  4AG1 C;  3EGU A;  1KJW A;  2Y90 A;  3L2U A;  3M4Y A;  4WCI A;  3CC4 Q;  2QGF B;  4KBM B;  5CKE A;  1BCM A;  3HKS A;  2A0F B;  1M8V A;  4QQ6 A;  2HDA A;  3I56 T;  5GAN h;  4M7D A;  1N8R U;  4MZP A;  4M7D C;  4DBF A;  2ZPH B;  4M77 G;  1WDX A;  2CZ0 B;  1Q7Y U;  1VQ5 Q;  1RLQ C;  1UE9 A;  5FRN A;  2LNV A;  2PVO B;  3MKD A;  2JW4 A;  3I55 A;  1AWW A;  2HSE B;  1SRM A;  2PZ1 A;  4E7L A;  1RL2 A;  2DTO A;  3JCM Q;  3CXC P;  3S6W A;  3E2U A;  2RM4 A;  4ME7 A;  1VQ7 T;  2RQW A;  4ELZ C;  5GAO l;  2EQI A;  3M59 A;  1T3L A;  2COY A;  3EFR A;  4O5V A;  2CP7 A;  1YNZ A;  3CC7 Q;  2O88 A;  4C8Q A;  1M90 R;  4C92 F;  2VV5 A;  4KH0 B;  4EMK A;  3OYH A;  4EMK C;  4QKU A;  4PK4 A;  3A5Z B;  3SFM A;  2DET A;  1EZZ B;  2CZ1 B;  2CP0 A;  2DFU A;  2BZY A;  2OTJ T;  3QPH A;  2YSQ A;  4EDU A;  4BB7 A;  4PJO F;  4FW2 A;  5CVI A;  2SRC A;  3JCM V;  1PWT A;  1BIA A;  3HRS A;  1YIJ A;  4L6V 5;  3M0T A;  1Q82 U;  3CXC A;  2DZC A;  1M1G A;  3SDZ A;  3DB3 A;  4HVU A;  2DD5 A;  5FU7 C;  2DL8 A;  3OS1 A;  2EJG A;  2LT1 A;  3OS0 A;  3GLX A;  5D6W A;  4NL2 A;  1QQJ A;  3REB B;  2CKK A;  1QP2 A;  4FT4 A;  1PKT A;  4M4Z A;  1K73 C;  3CCJ T;  5CAI A;  1NM7 A;  2EPD A;  2KGT A;  4Z88 A;  4JZ3 A;  2YUO A;  4MML A;  4AFU C;  2CH4 W;  2NUP A;  2KMT A;  2C0O A;  2KYB A;  2MI6 A;  4FCY A;  2YWW A;  1YIT A;  2V26 A;  2K2M A;  4A4F A;  5I11 A;  4LXC A;  4XK8 E;  4BE0 A;  3EG3 A;  1YI2 Q;  1UG1 A;  1KD1 U;  1VQL A;  5GMK i;  2RO0 A;  4M78 G;  1MGQ A;  4GLM A;  3JB9 D;  1QVP A;  2A7Y A;  2BZX A;  2J6K A;  3CBM A;  3HRT A;  3OS5 A;  4R0K A;  2MCN A;  4BD3 A;  3INZ A;  2HQX A;  1WZO A;  4AFZ C;  4C0F A;  5FW9 A;  1UHF A;  2K5F A;  4J9G A;  2MYS A;  2O4X B;  4RTW A;  1VYT A;  5IXF A;  3NHN A;  1E7O A;  1Y96 B;  2LX9 A;  4Z8A A;  4XTZ A;  2E3I A;  1VUB A;  4N0A A;  4N0A C;  3URG A;  2WSF E;  4ZTF A;  3M0U A;  4RUG A;  3RKY A;  5GAM h;  3EFO A;  2VXE A;  2OX7 A;  3CCL T;  2QTV A;  4P5N A;  5GAN 3;  2D8J A;  2FEI A;  2HKN A;  1NZ9 A;  1K9M U;  2CGH A;  1K0X A;  2KR3 A;  5DLO A;  2VGN A;  4D8D A;  5CR2 A;  4FYW B;  2H8H A;  5LJ5 j;  1VQP Q;  4ZN1 A;  2M9U A;  4M7D B;  5GJW B;  2MF2 A;  1ZQ1 A;  1U06 A;  3CC4 T;  2E10 A;  4LDX A;  2GF7 A;  3CCS Q;  3ZEH A;  2YLC A;  2M0Y A;  1M2V B;  3QYH B;  3RUX A;  4BDZ A;  1WFW A;  3SD4 A;  4BI8 B;  1NPP A;  2LQN A;  1WHH A;  3MCA B;  3G71 Q;  1LPL A;  2KDS A;  4OP0 A;  1VQ5 T;  2COZ A;  5GAN 7;  3EFS A;  3NTI A;  2KRN A;  2B86 A;  2KAF A;  2V8I A;  2EKO A;  3CPF A;  4C8Q B;  1KK7 A;  2DF6 A;  1WGS A;  2EQM A;  4EMK B;  5LJ3 g;  2DM1 A;  4KGX B;  1VQ9 A;  1WYX A;  1C1A A;  2ZCF B;  4HT8 A;  1OPK A;  3UT1 A;  4V2S A;  1SG5 A;  2MPX C;  4F7U A;  2X4J A;  3JCM f;  1I5L A;  1RAC B;  2RPN A;  2V8J A;  3EHR A;  1VQO A;  3CC7 T;  2AZV A;  2LJ0 A;  3GP8 A;  4CI0 C;  2K5L A;  3CCV A;  2E3H A;  3MEA A;  4LDV A;  3C4S A;  1Q86 C;  2RK2 A;  5AT1 B;  1TUC A;  5LJ5 d;  2LNH B;  1Z9Q A;  2KXD A;  1M2O A;  1SPK A;  2FL7 A;  5FU7 B;  3QKJ A;  2XU8 A;  4Y92 A;  3V7C A;  5DM7 R;  2ZZD A;  5HCK A;  3CCQ A;  1TS9 A;  3LW5 E;  2JM8 A;  4HA8 A;  1M1K C;  1Y0M A;  1QLY A;  3LH0 A;  4KUI A;  1M4Z A;  2DL3 A;  4M75 E;  1LVK A;  3OBY A;  2NUP B;  2K4Y A;  3BY7 A;  2QG9 B;  2P4R A;  2RJC A;  3VS1 A;  3CEY A;  4F16 A;  3ME9 A;  1PSE A;  1GL5 A;  3TSW A;  1NEB A;  2C0T A;  3D7S B;  3JB9 G;  2Y4X A;  1RAG B;  1YJW A;  2KRM A;  4JRP A;  2J7I A;  5D6Y A;  2KVQ G;  4EIK A;  4XU1 A;  1BI0 A;  2QK0 A;  2L3Q A;  2RQV A;  3LH5 A;  4FU6 A;  1YI2 T;  5CCA A;  3JCM X;  5D7U A;  5KYW A;  5CIU A;  2QAZ A;  5FRM A;  5L8R E;  4FYY B;  3RMS A;  5I2S A;  1PNJ A;  3FC3 A;  1WXU A;  3SWN B;  3CMA A;  3EFO B;  2ZPF B;  4E7Z A;  5KYX A;  2M0O A;  3OBW A;  1UEC A;  4PL6 A;  2MWP A;  3WVD B;  4MDX A;  4BAC A;  1K8A U;  4RCC A;  2K3Y A;  3I55 Q;  4QVC A;  1NPR A;  1HYO A;  4HKE A;  2HEQ A;  2JJ9 A;  4JRK A;  1XQH A;  2FRW A;  4II1 A;  2CYZ B;  4M75 D;  2MOX A;  3OB9 A;  5CKF A;  3KXT A;  3G6E A;  3BDL A;  1MMA A;  2LCC A;  5LJ3 e;  2RK1 A;  2J6O A;  4C92 E;  3CCU Q;  1M3B A;  1VQP T;  2DL5 A;  2CP3 A;  2EYY A;  4BE2 A;  1M27 C;  1QWF A;  2CS7 A;  1AWO A;  1KC8 C;  3TRE A;  4PJO E;  2GFU A;  3QHS A;  4XAX B;  5IAY A;  2QA4 Q;  4D6W A;  3JCM e;  1GFC A;  1TTH B;  3G71 T;  1MV3 A;  2CUD A;  1N6A A;  2XDD A;  1NYF A;  1YIJ Q;  2DXC A;  2PQW A;  2L0A A;  1VQ8 A;  2RJE A;  4F7U B;  3V8K A;  1HXD A;  1VIE A;  4A4K A;  2K6D A;  3QWY A;  2ZGW A;  3RKW A;  4EMH A;  3M4G A;  2MIO A;  3GNF B;  3UA7 A;  2XIC A;  3AT1 B;  2DRK A;  3CXC S;  4DEX A;  2VYT A;  4F04 B;  2RHX A;  4A4G A;  3HPW A;  3OW2 P;  2JTM A;  1AD5 A;  1WHJ A;  1OPL A;  2YT6 A;  2AKK A;  5IHN A;  4M77 A;  1WHG A;  4M77 C;  3JV3 A;  1S72 T;  2CZ6 B;  1QVF S;  1K76 A;  3QBY A;  4XTY A;  1KG1 A;  2DRM A;  2KNB B;  2DBM A;  4GY5 A;  1N8R C;  2EQU A;  3TEE A;  1PSF A;  1ZUK A;  5GAN 4;  1Q7Y C;  4LDW A;  4QQD A;  1YIT Q;  3CCS A;  4A4E A;  4O6J A;  1W6X A;  2B8A A;  1T0J A;  1B34 A;  3R6O A;  4Q5W A;  4IUP A;  3VJP A;  4JRI A;  3ER0 A;  1ZA1 B;  4ZGE B;  2GQI A;  3OYY A;  4C92 D;  3FDR A;  1VQK A;  1VQL Q;  3EAE A;  4IUR A;  2HQH A;  3SEM A;  4RG2 A;  1X2Q A;  1QCO A;  4OMO A;  4PKC C;  2YLB A;  2L8D A;  1NG2 A;  4LNP A;  4PJO D;  2RJF A;  2WAC A;  3DKM A;  4J7F A;  4HCK A;  1KQS S;  3CC2 A;  1XOV A;  4QQG A;  3F70 A;  1M90 U;  2KRO A;  1U5S A;  4M7A F;  1W4S A;  2JVV A;  2QEX A;  3VU3 C;  2W10 A;  1EIF A;  1TUG B;  3JRZ A;  1W2B S;  5KYW B;  5A0G A;  1SRL A;  5GAN d;  4MDW A;  1Q82 C;  3M57 A;  3E19 A;  3TCJ A;  2DEU A;  2F2V A;  2NYS A;  3EGX A;  2X4X A;  2KRS A;  5DLQ E;  3P8H A;  3QZ5 B;  3I5R A;  1JRI A;  1VIF A;  5KYX B;  2DLP A;  2LJ1 A;  4E7H A;  2LMJ A;  4X9C A;  3KBG A;  2L5Q A;  2AZS A;  3I9Q A;  2D6F A;  4FL6 A;  4XTV A;  4PLI A;  3QSU A;  1GCQ A;  4M75 G;  1GCQ C;  2EGC A;  1KIK A;  2DEQ A;  1NBE B;  1WI7 A;  3JB9 H;  2RB6 A;  2X3X D;  2O01 E;  3TQ7 P;  3V8L A;  1SHF A;  2PTK A;  2HBW A;  4ORZ A;  1GXI E;  4PJN A;  4WF2 A;  1JB0 E;  2FYK A;  2JMC A;  3X26 B;  4M78 A;  3I55 T;  4M78 C;  3L2R A;  2EBP A;  4A54 A;  3TSZ A;  4J83 A;  4RTZ A;  1B3Q A;  2X3W D;  4XTW A;  4OF1 A;  3M55 A;  2O9V A;  1KD1 C;  4Y28 E;  1VQ9 Q;  5LJ5 g;  2FPD A;  1DJ7 B;  2NUT A;  3J7A F;  1X27 A;  1VQO Q;  5CKB A;  4VUB A;  2OTL A;  2QQA A;  1UJ0 A;  2DE0 X;  5I21 A;  4E7S A;  1D0Y A;  2FPE A;  8AT1 B;  1BI2 A;  2A08 A;  2EYW A;  2G3R A;  5KCH A;  2RJD A;  1AZG B;  4MZT A;  3CCQ Q;  5GAM j;  1YIJ T;  1WNL A;  2XID A;  4M77 B;  1OOT A;  4PFP A;  1K9M C;  3THK A;  4AFS C;  4RTU A;  5I2M A;  1D3B A;  1M5Q 1;  1MNE A;  1YJN A;  3EHQ A;  2GTJ A;  1M2V A;  2PU9 B;  3L1A A;  2HL3 A;  3OYD A;  2EW3 A;  2K5I A;  3CCR Q;  3CD6 A;  4C92 G;  2DJZ A;  3ZBD A;  5FWC A;  1B34 B;  5GAN 8;  2DIG A;  2YRD A;  1YN8 A;  1YCS B;  4J9E A;  1I5O B;  1QVF P;  3CCU A;  2RI2 A;  2E5K A;  3QII A;  2V1Q A;  1HK9 A;  2VC8 A;  3CME A;  5EG2 A;  1WLP B;  1YJW Q;  3VYH B;  4PJO G;  1YIT T;  2K79 A;  4JS4 A;  3LX7 A;  2NLU A;  2XMF A;  3UAT A;  2A37 A;  4C8Q C;  3JCM h;  1K0S A;  1QKX A;  2DL7 A;  3DB4 A;  2QA4 A;  1ZHI A;  3PVL A;  1JXO A;  3HRU A;  1VQL T;  2EWN A;  2G6F X;  3GIB A;  1PG5 B;  1WX6 A;  3PT9 A;  2R58 A;  4R55 A;  5GAM d;  1FMV A;  4JPB W;  2AHJ B;  3RMQ A;  3R6N A;  5GAN 5;  4RMO A;  2BE7 D;  2E12 A;  1UGV A;  3KFV A;  1VQ4 A;  3CMA Q;  1Q81 R;  1D09 B;  1QVF A;  1OYX A;  4Y91 A;  1I0C A;  3NTK A;  1KQS P;  3O8V A;  2P84 A;  3EGX B;  2LTO A;  2DA9 A;  2K9G A;  2BUD A;  4XTU A;  1Y07 A;  5GAO p;  1NE8 A;  2AIR B;  2CSI A;  2RHI A;  3M58 A;  2X4Y A;  1X01 A;  1X43 A;  4Z89 A;  1W2B P;  2CH4 A;  2ECZ A;  5FRO A;  3G6E Q;  2RHU A;  2KSS A;  3VUB A;  3S3O A;  5KE3 A;  2R57 A;  2NWM A;  1PCX A;  1XNI A;  2Z0W A;  4J9B A;  2JNG A;  5LJ5 e;  2XDB A;  3P8D A;  3BE3 A;  1G3T A;  1UGR B;  2HSP A;  4ESR A;  2EVR A;  4JS5 A;  1ZX6 A;  1FYN A;  3MEV A;  3RIR A;  1W1F A;  4M78 B;  4OMN A;  3VS3 A;  3MET A;  1KQS A;  1JQQ A;  3EG9 A;  3PNW C;  2LQW A;  3VS4 A;  3IQL A;  4PJL A;  8ATC B;  1OV3 A;  2FRY A;  3OYA A;  1ACM B;  2HKQ B;  2X4W A;  4C0Z A;  3FJP A;  1VQ8 Q;  2NUT B;  3M0S A;  3V7S A;  3DLM A;  1W2B A;  4KH1 B;  4LDU A;  2RQU A;  1M3C A;  2EQK A;  2P0P A;  5IH2 A;  5J3B A;  1TUD A;  3H0I A;  1VQ9 T;  3N5B B;  3EGD A;  3S3N A;  5KYN A;  3SWN A;  4MZM A;  1M3A A;  3G7Z A;  3SWN C;  1I8F A;  3GBQ A;  3ULR B;  2ZPB B;  3WXM B;  4A63 B;  1VQO T;  2VXF A;  1H3Z A;  1UHC A;  2CP2 A;  2M02 A;  3MJX A;  2IPO B;  4ELY C;  2H3E B;  3CCV T;  4B6M A;  5CQX A;  2RH2 A;  2YHT A;  3UDC A;  2QXF A;  1JJ2 S;  4HVW A;  5FLX E;  2XD0 A;  1N27 A;  1JO8 A;  2OAW A;  2DYB A;  2EAY A;  1D3B B;  2DAQ A;  2KY9 A;  4RKU E;  1K8A C;  1HD3 A;  2EGE A;  1LNX A;  3CCQ T;  1ZUY A;  2IVW A;  1JXM A;  3REA B;  1VQK Q;  4DBQ A;  3FB9 A;  4JZ4 A;  2P0Q A;  2GNC A;  1WQW A;  5LJ3 f;  4BE1 A;  3QDR B;  4BDY A;  2GBQ A;  4N4I A;  3QUI A;  3H41 A;  2ROL A;  3VYG A;  4M7A E;  1VA7 A;  3CC2 Q;  3OW2 S;  3LGL A;  4CRI A;  4M7D F;  2HD0 A;  9ATC B;  1PD1 A;  2QEX Q;  3CPW S;  1YJW T;  4CC3 A;  2F5T X;  3WVE B;  5GAN 6;  4ZTJ A;  2RQT A;  4JJB A;  5KCO A;  2MWO A;  2CSQ A;  1BKB A;  4L5G A;  1IRX A;  4C0D B;  2KXC A;  2K2V A;  1PM3 A;  1N5Z A;  1QW1 A;  1D1B A;  1IRE B;  2M1H A;  3JCM J;  4C8Q F;  2RMO A;  5HY6 A;  4RG8 A;  3PVQ A;  1WXT A;  5FU6 C;  2D9T A;  3CMA T;  1TWB A;  1QWE A;  2RN8 A;  2YUP A;  1SKU B;  1W70 A;  3PMI A;  4E7K A;  2ED1 A;  3CCR A;  2DXT A;  1WHL A;  7AT1 B;  1D0Z A;  1G3W A;  2FG0 A;  3A98 A;  1C0M A;  3CBO A;  3G6E T;  4OB0 B;  3AHU A;  2QDY B;  3OYK A;  4M7A D;  2I2L A;  3JCM W;  3EG9 B;  2E4H A;  4LD9 K;  4J6X A;  3BW1 A;  2OTL Q;  2R5A A;  4E47 A;  3UWN A;  4AMC A;  2QI2 A;  2EFI A;  4C5I A;  5AYF A;  1M90 C;  1ABO A;  1OQK A;  1RAH B;  3RDV A;  1V1C A;  5KH6 A;  2PVG B;  4LUD A;  1PKS A;  5GAO n;  3MHX A;  2L3S A;  2PUK B;  3EGD B;  4IUV A;  3MEU A;  1VQ8 T;  2LDM A;  1VQM A;  1IHV A;  2VVK A;  5GAO q;  2RD1 A;  2JS0 A;  2JN0 A;  3QJY A;  2CZ7 B;  4J6Y A;  3X20 B;  4XU2 A;  3HHT B;  3LWH A;  4ZGJ B;  4M75 A;  4M75 C;  3EG0 A;  1YJN Q;  1BI3 A;  2LZ6 B;  1I4K 1;  1C6V X;  4DOW A;  3G4S A;  2VUB A;  3CD6 Q;  2PVD B;  1BI1 A;  2DTI A;  3BDU A;  4XU3 A;  3M53 A;  3CCE A;  3M0R A;  2IIM A;  3CME Q;  1YBY A;  1R8O B;  4DA4 A;  1YJ9 A;  4PJM A;  3NFC A;  3V7R A;  3CCS T;  1IGU A;  3FRN A;  1JJ2 P;  2XKO C;  5J39 A;  2HBP A;  5GAM g;  1GBQ A;  3M54 A;  5IHK A;  1FX7 A;  1VQK T;  2PNI A;  3OSS C;  3QG1 A;  1YHQ A;  1XTD A;  3NPF A;  1ABQ A;  4CC7 A;  2RI3 A;  3M9Q A;  2X35 A;  2X51 A;  5GMK j;  1E6G A;  1R77 A;  1OX9 A;  1PRM C;  1XJW B;  2DX1 A;  3CC2 T;  3JAM E;  2RHY A;  1VQ4 Q;  5CKH A;  2M51 A;  2L3P A;  2O2O A;  4KGZ B;  3ASK A;  2QEX T;  3QWX X;  3J80 E;  1JJ2 A;  1IB8 A;  4IIO A;  4BY6 B;  3CPW P;  5GAN j;  1M8M A;  3PIO A;  3GPL A;  4C5H A;  3OQ5 A;  4MMK A;  4HCC A;  4OML A;  1HJD A;  1MV0 B;  2MMP A;  4E2F B;  2XI9 A;  4KT0 E;  5FU6 B;  4C92 A;  2QTX A;  4C92 C;  3GOX A;  4F7U F;  2KT8 A;  3Q1J A;  3OYE A;  2VKN A;  1UFF A;  4FYX B;  6AT1 B;  2BTT A;  4PJO A;  4PJO C;  2E65 A;  1WHM A;  1D0X A;  2J05 A;  1K4U S;  3H0F A;  4OVA A;  2D0Q B;  3RNJ A;  4M7A G;  3OW2 A;  2KK4 A;  5GMK m;  1WJS A;  3UPU A;  2J6F A;  3CPW A;  2JZ2 A;  5A0L A;  2K57 A;  1UUE A;  3OYN A;  2LC4 A;  2KQW A;  1KHI A;  3X28 B;  4XTX A;  3RES A;  4HCB A;  2NUZ A;  3A8M B;  5GAN 2;  4C0G A;  4NL3 A;  2YRV A;  2DVE A;  1O75 A;  1OU9 A;  1IGQ A;  3HSB A;  2OTL T;  1VQ6 A;  1H92 A;  2ATC B;  1G83 A;  2JM9 A;  2ESW A;  3JCM b;  2FPF A;  2JUF A;  3JB9 I;  3OYC A;  1YCY A;  2KI7 A;  1Q81 U;  2LX7 A;  3HTR A;  4M75 B;  3GNG A;  4QVD A;  2E41 A;  2ABL A;  3M0Q A;  5GAM e;  1QVG S;  2KEA A;  2J06 A;  3MPU B;  1P92 A;  4LN2 A;  4J5Y A;  1PRL C;  1N9R A;  3OYG A;  1NLP C;  2W0Z A;  1UB4 A;  4RTV A;  1YJN T;  5CK9 A;  2QQR A;  3JCM d;  1M1F A;  4M7D E;  1TG0 A;  4FYV B;  5LJ5 f;  3CCM A;  4R56 A;  1E6H A;  2X9H A;  2VWF A;  3CD6 T;  2EGA A;  1TH7 A;  1AOJ A;  2P0K A;  3PTA A;  3CCU T;  3OYI A;  3CME T;  1MMN A;  4J9F A;  3MO8 A;  1GBR A;  1I81 A;  1MMG A;  2VAS A;  2QA4 T;  4RTX A;  1Q86 R;  4OMP A;  3UA6 A;  3A1P A;  1AWJ A;  5CKD A;  2DMO A;  4PLL A;  4C8Q E;  3VS0 A;  4OB2 B;  1Q95 G;  3CCL Q;  1PC0 A;  1BIB A;  4E7I A;  4D8K A;  2XHC A;  2F1L A;  1VOM A;  1OU8 A;  1VQ4 T;  1G8X A;  1M1K R;  5LL6 S;  3MP8 A;  2RI5 A;  2LCL A;  3UF4 A;  2E64 A;  1B07 A;  4JJD A;  1VQN A;  2YUN A;  4C92 B;  3OY9 A;  5LJ3 h;  3L2V A;  3M0P A;  1EX4 A;  3EG2 A;  4XU0 A;  1RLP C;  1ZA2 B;  1WHK A;  2AT1 B;  2JS2 A;  1BYM A;  2LVM A;  2DK3 A;  3VRZ A;  4PJO B;  4M7D D;  3L42 A;  3L2W A;  2E6N A;  4J9H A;  4FIB A;  1UGP B;  4PNO A;  3FEO A;  4M77 F;  1J3T A;  2EYX A;  4DQ2 A;  2A28 A;  1OZ2 A;  1CKB A;  1I1J A;  2QGG A;  4FSX A;  4L59 A;  1NEG A;  1B7T A;  3VS5 A;  2DIL A;  2BIV A;  4E6R A;  2SEM A;  3MP6 A;  4JLG A;  1FMW A;  4OMF B;  1Z9Z A;  4AT1 B;  1RI0 A;  1VQM Q;  4IUQ A;  4C0D C;  2DNU A;  2XG8 D;  4C8Q D;  1RAB B;  4FSS A;  1U8R A;  3VKI A;  2O31 A;  4XQ3 A;  3VS6 A;  5HKC A;  1Y57 A;  3I56 A;  3RKX A;  5CQY A;  5GAO r;  3QO3 A;  2EIF A;  2ZPG B;  3G4S Q;  1FWZ A;  4J9C A;  3JB9 J;  2FHD A;  2MK5 A;  1VYV A;  2DYI A;  3CCE Q;  3QXE B;  4J9D A;  1YJ9 Q;  3FLG A;  1VQ7 A;  4ZGD B;  4JRQ A;  3HFO A;  1X75 C;  1FMK A;  2C0I A;  1M9S A;  1KC8 R;  2F5K A;  3LLR A;  4J8O A;  3CQT A;  2KE9 A;  3RR6 A;  1RAD B;  5IT9 E;  1YHQ Q;  1GCP A;  1QVG P;  2ENM A;  4BI3 A;  1NYG A;  4RTY A;  2E70 A;  3OMC A;  3PFS A;  2VGM A;  1YFN A;  3OMG A;  2K3B A;  1D1A A;  3E9F A;  2OTJ A;  2XDP A;  3X24 B;  3M56 A;  4WTO B;  2LT4 A;  1T3S A;  1NJI R;  4CC4 B;  1WXB A;  4IKF A;  2XK0 A;  1X6G A;  1RUW A;  1IHW A;  3OYF A;  3OYL A;  1AVZ C;  4J9I A;  2HQE A;  1MND A;  1S1N A;  3JCM c;  4M78 F;  2CT4 A;  4UC4 A;  5FWB A;  1D1C A;  3GF5 A;  3EH1 A;  2CT3 A;  1PHT A; 
#chains in the Genus database with same CATH homology
 2MK5 A;  1R77 A;  4LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...