2MKCA

Cooperative structure of the heterotrimeric pre-mrna retention and splicing complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
118
structure length
118
Chain Sequence
GAMGNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKYYEAVKEELDRDIVSKNNAEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative structure of the heterotrimeric pre-mRNA retention and splicing complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Splicing
molecule keywords U2 snRNP component IST3
total genus 32
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkcA00
2MMYA 1U2FA 2MB0B 2LA4A 2DO4A 2RRBA 5HO4A 1VQOS 2DH8A 2AYEA 1VQ5S 2DGVA 2FPHX 1VC5A 4PRFA 2KFYA 1VQ7S 1FJEB 2DGTA 1FJ7A 3MXHP 2MZJA 4Y0FA 3G9CA 2KHCA 3S7RA 1VQ6S 5CYJA 3US5A 1AUDA 2QFJA 1F9FA 4C7QA 1VBZA 1Q7YT 1VBXA 3IWNC 2MSSA 4C0OC 1Q81T 1U1LA 2DH9A 3CCJS 2DHAA 2OTJS 2M9KA 1SXLA 1VQPS 2MKKA 3Q2SC 1FHTA 3B4DA 1DHMA 2CQ3A 2DIVA 3NS6A 2BZ2A 1WG5A 5HL7Q 3B4MA 1SJRA 1WG1A 3G8SA 3RW6A 3THTA 3FEYB 3THPA 3CCSS 2YWKA 3BEGB 1WHXA 2EK6A 2OJ3A 2F9JA 4CH0S 1WELA 1FXLA 2M8DB 4ED5A 1H2TZ 1WEYA 2U1AA 3Q2TC 3UCUP 4YB1P 2DNGA 2X1AA 4PR6A 2G0CA 3CCUS 1N8RT 1U1QA 1A7GE 4P6QA 1NJIT 3CMES 2CQIA 2FC9A 5LXYA 2DO0A 3NS5A 1YJNS 4ZKAA 1SJ4P 1KOOA 3TYTA 3VF0B 3VALA 4CIOA 2ADBA 2XSFA 3CF5Q 3ZZYA 2CQ0A 4M5DB 1HA1A 1X4GA 5LSLA 4IUFA 5MLCV 2CPEA 4YOEA 3U1MA 2MQNA 2AYBA 3PIOQ 2LQ5A 4F26A 1X0FA 2KT5A 2E5HA 3CCES 3CXCR 2MQQA 3BS9A 1JMTA 2KXFA 4FXWA 4WFNQ 2ERRA 1R8PA 5CA5A 1YWXA 1VBYA 3DLLQ 3MUVP 5LJ5Y 1CVJA 1VQ9S 2MY8A 2RVJA 2LXIA 5JVGQ 2XNQA 4CQ1A 3MD3A 2JRSA 2DGUA 3BO2A 1DZ5A 2MY7A 2MJUA 3J7ZT 3CCRS 2I38A 3NNCA 3SXLA 4F25A 1U1RA 2MKJA 5IM0B 3IRWP 2MYFA 1K9MT 5FJ4A 5GAGU 2OSQA 2EVZA 2FY1A 3CCVS 1UFWA 2L08A 3CULA 5GADU 1NO8A 1WI8A 3VAJA 5DM6Q 2HGLA 1HD1A 4IOAQ 5GAEU 3CUNA 3H2VE 2M70A 1WTBA 3LQVA 2XNRA 2KH9A 1ZZFA 3UCZP 3TP2A 1FNXH 2DNZA 4W92B 1SJFA 1WI6A 3UCGA 2LKZA 5D77A 4YUDA 2M7SA 2DNNA 3CC7S 3VAHA 1M5KC 4UY8T 1U1KA 2DHGA 2MQPA 3P6YC 1YJWS 2KXNB 3I55S 2X1FA 5EN1A 2MJNA 1KD1T 3EGZA 1YIJS 1X4BA 2HGNA 2LYVA 1X4EA 3G96A 4LJMA 2WBRA 1WF0A 2KVIA 2CPZA 1U1OA 2M2BA 1WHVA 2J0QD 2ADCA 3G4SS 5GMKa 1VQ8S 3VAMA 2KRBA 2DGSA 4TU8A 1O0PA 1K73T 3S8SA 2CPYA 3LPYA 3MOJB 5LJ3Y 2QA4S 3UD4P 1S79A 2X1GA 5DM7Q 1BY9A 2MXYA 4WFAQ 1A9NB 2N3LA 2CQ2A 3TO8A 3CCQS 2DNHA 4Y00A 1WHYA 3MUMP 2RQ4A 2G4BA 2MZRA 2MGZA 2HZCA 2DGWA 2RNEA 4IO9Q 1D9AA 1JJ4A 2MPUA 4RU2A 1VQKS 1X5OA 2YTCA 1HL6A 1JJ2R 1W2BR 2E5IA 3OW2R 2N7CA 2YH0A 1URNA 3ZZZA 2XS2A 3VAIA 3MUTP 2D9OA 1U6BA 2CPXA 2MQLA 2E44A 2A3JA 2CPDA 3D2WA 2BOPA 4QU7A 2K8GA 1X4HA 2X1BA 2DISA 2QEXS 2J0SD 1QVFR 2MQMA 3CCLS 2LCWA 1FT8A 4U67Q 3VAKA 1NU4A 3J7YU 4LMZA 2OTLS 1H6KX 2M52A 4LIRA 3CPWR 4TLQA 2VOPA 2K3KA 1VC0A 1DBDA 1ZH5A 1Q86T 2CJKA 2DNOA 2XS5A 2G1DA 1U1MA 1KC8T 2MHNA 1YITS 1P27B 2PEHA 1WHWA 3CC2S 2XB2D 5IFMA 1H2UX 3S01A 1U1NA 2OIHA 1N52B 1U6FA 2MZ1A 3CC4S 3CTRA 2AYMA 3SDEA 5JVHQ 2RUGA 4F02A 3P49B 4BS2A 2DNMA 2DGQA 3SDEB 1ZZNA 1FJCA 1WEXA 3BO4A 3CD6S 3PIPQ 3UWTA 3EX7B 4C4WA 2JVOA 1X4DA 4J5OA 1VQ4S 4ERDA 1PO6A 2MGZB 1WF1A 2KRRA 2LXUA 4WCEQ 1WG4A 2CQPA 1VC6A 2LEBA 5DETA 5CXTA 2HGMA 5LXRA 2LECA 1M5PC 3VAGA 3SMZA 4WFBQ 1X5SA 3L3CA 1R8HA 2J8AA 2VOOA 2NZ4A 1KQSR 2NLWA 1JJHA 3S6EA 4UQTA 1VQLS 3NMRA 1M1KT 2FHOB 1X4AA 2DHSA 2MQOA 1M5VC 2DNKA 2J76E 1M5OC 1WF2A 2FC8A 4QQBA 2MKSA 3G8TA 2DB1A 1X5TA 2KXHA 2CQ1A 2ZJPQ 2XS7A 2CPHA 2CQCA 1KOHA 2DNPA 2L41A 2RT3A 3JB9k 5D78A 2M4MA 3H2UB 2M88A 5DDQC 1X5PA 2D9PA 3BO3A 2RRAA 4QU6A 3NNAA 2DITA 2U2FA 2E5JA 1WEZA 2CQGA 2Q79A 2KU7A 1X4CA 3P3DA 4WF9Q 4QPTA 3P5TL 2MKIA 2KG0A 3R1LA 1YHQS 5DDOC 2KYXA 2VONA 3MDFA 3UD3P 2OSRA 2LEAA 2DNQA 2KI2A 2AD9A 1RKJA 1SJ3P 1M90T 4FXVA 4A8XA 5GAHU 2DGOA 2MSTA 1WWHA 2V94A 4EGLA 2SXLA 1OWXA 1L3KA 2MKCA 1YJ9S 3R27A 2DK2A 2GO9A 2YH1A 3CMAS 2O3DA 1P1TA 3R1HA 2JVRA 1Q82T 4PKDB 5IQQA 2HVZA 2JWNA 2RU3A 1D8ZA 4WIIA 2L9WA 2UP1A 4CH1A 2PE8A 5DDRC 3HHNB 1FO1A 2LA6A 2N82B 2CPFA 4WKRA 2CPJA 2DNYA 1IQTA 5H1SV 4IOCQ 1SJQA 1X4FA 1N54B 5BJRA 1UAWA 2ZJRQ 2RS2A 5ITHA 2JX2A 3DXBA 3HI9A 4W90B 2DNLA 3U1LA 2DH7A 2KN4A 3VAFA 1YI2S 3K0JA 1XN9A 2CPIA 2MZQA 2DNRA 1RK8A 3UE2A 1OPIA 2LMIA 1N88A 1K8AT 2F3JA 2MZTA 1VQNS 2E5GA 2YKAA 2N3OA 1UP1A 4V19X 2M8HA 2VODA 1YTYA 2DHXA 1PGZA 2M0GB 2B0GA 4Z2XA 2AYGA 3RW7A 2KM8B 4TU9A 1S72S 1B7FA 1UW4A 4OZ1A 3G71S 3NNHA 2KG1A 2CQHA 2RS8A 2KM8C 5LSOA 2F9DA 3I56S 3V4MA 2RQCA 3MD1A 2ZJQQ 3CCMS 2I2YA 2CQDA 2CQ4A 4TU7A 3ULHA 1VQMS 2MZSA 1G2EA 1H2VZ 1QVGR 5IM0A 5GVQA 5DDPC 2CQBA 1HD0A 2DGXA 4OZ0A 2MKHA 2GHPA 3MURP 3G6ES 2D3OR 3FEXB 1OO0B 1U1PA 3N9UC 3MI7X 2EK1A 1DRZA 2HYIB 2DIUA 1QM9A 1OIAA 3EGNA
chains in the Genus database with same CATH superfamily
1U2FA 3DXSX 3ZFVA 4DG1B 1RHKB 1Q8BA 2RRBA 4WPAA 4BBYA 4YQWA 4DFKA 2DR8A 3TW0A 1F5BA 3H40A 1S12A 2MLXA 1YJVA 2Y1JA 3HVTB 1VQ5S 1IVZA 1RWVB 3CJ3A 2VG6B 2FHMA 3DGPB 3GFHA 2DT9A 4LREA 5HVHA 4ENOA 1SUQA 2AJ2A 1X60A 1FJEB 1Q82T 2HFZA 3GQCA 4LUBA 3PHTA 4I69A 1QUPA 5F0WA 5A2QU 1EIYB 1AXQA 2GIRA 2ZEJA 5C2CA 4LT6A 4KSEB 4J9PA 1SVDA 1Q7YT 1RTZA 3F56A 5LSRA 1VBXA 3IWNC 3L7PA 1NEEA 1NM2A 1X8DA 4X64F 4KB7A 4TVAB 3AB2B 3LP1B 2AJ0A 3AJ2A 1PBAA 2JLEA 1F5AA 3AXKA 5BR8J 2DHAA 1T3OA 2LQ8A 2M9KA 4YN3B 1U6ZA 5B0EA 3IGVA 3PFOA 3UD5A 5J1PA 4F4WA 1N48A 3VQSA 1OYDA 1XBWA 1FFWB 4ED4A 3M8RA 3T6BA 1F1BB 1PIEA 1S4FA 5KTQA 1P9QC 1TP7A 1OJ4A 3HVAA 3UO0A 4DV0J 4PUOB 1WG1A 1VMBA 2B6AA 3CJRA 4K2JA 3FEYB 2A2DA 2B9WA 3IGNA 3MMAA 3JQMA 3R97A 2XWXA 3ZZOA 4EO6A 1O51A 2AU0A 1MNEA 1HNWJ 2OJ3A 2F9JA 3QT5A 1NDPA 4F04B 1WELA 4K5SA 4DV4J 2OPSA 2M8DB 1H2TZ 2EC2A 3DC2A 3BKTA 2COLA 4QWCA 2HFOA 4CLYA 2JZ5A 2ZE2B 4YB1P 3AJ1A 2OD6A 3QO9B 1OSDA 2CZ4A 2KHDA 3DRSB 3NCPA 4B02A 3UN3A 2XC9A 2X1AA 3HXMA 4DV7F 4LFCJ 4L76A 3WC2A 3PX4A 3BB5A 1RZMA 4WFXA 1A7GE 2Z0GA 4NLOA 5BYQA 3EJMA 2FC9A 4M5NA 3HFVA 1LFWA 2YKNA 3CIMA 4PG6A 4CYUB 5LXYA 4X4RA 4M95A 4JI8F 1RCXB 1OS5A 1RWKB 1KOOA 3FZ2A 4JV0A 4DMZA 2B4UA 2GW8A 3KDNA 4E8UA 1PYOB 4IKAA 2VFVA 4U95A 3JAMU 4CIOA 1ZA1B 1X9SA 3UQSA 2GQCA 4CLTA 4YR0A 3RYLA 4HLBA 3G6XA 4WIQA 3RBZA 2PDAA 2FZKB 2HZVA 2HNZB 2E7VA 1XIQA 5HVGA 1UPMB 1SC3B 4QWEA 3RRHA 2J6TA 4R0JA 1T05A 1CSJA 3W64A 5AXMA 1VRTA 3BBCA 4HVZA 2B3TB 4MYTA 2FIUA 1FWPA 3QZ8A 3GFXA 2MQNA 4Y2CA 3BR9A 5G0RB 1ELOA 1LNQA 1LWFB 3FRZA 2EFNA 2LQ5A 2UU9F 1X0FA 4F3OA 5HANA 4DFPA 1OY9A 2XYHB 4A48A 1PKUA 5C42B 3D67A 2CJXB 1KR4A 2NS1B 4USUA 1FXRA 3D3BJ 2NXEA 2UUWA 1CJKA 3DOKB 1YBUA 3MUVP 4WTYA 5U47A 3HHLD 3TA0A 2OGUA 2OUGA 1N34J 2MY8A 2ZNZA 5I4MA 3POTA 1V6HA 4I64A 3MD3A 2JRSA 2CFXA 4OZ2A 1LXJA 2BRKA 2ZC4A 3MM9B 3KK3A 1ZAXA 2FJBB 5AT1B 2EFVA 2V68A 2ZVSA 1NPRA 3DRYA 3SXLA 3NNCA 3L7OA 1U1RA 2HMIA 3R5CA 3HM9A 1XNRJ 5KFJA 4IH7A 2XHCA 3L7UA 1K9MT 1T94A 4CDIA 1BQNA 5BR8F 3BJYA 4O3RA 1RAAB 1FDBA 2ZOMA 3LGNA 4NYOA 3BYPA 5G0RA 3UNGC 2AEMA 2BVZA 1WI8A 1RBLA 2ZBCA 5GADU 5KG2A 4MMOA 4EYHB 4LF6F 2RSQA 5JJBA 2ZOGA 1BQXA 2C3UA 5GAEU 3H2VE 2RIJA 4B3MF 2M70A 2XM3A 3WHIA 5EGYA 1HBMB 1HWJA 1M0SA 2HLUA 1IWAA 1K47A 4OX9J 4NLPA 3W2VA 1CJKB 4CLWA 1R6VA 3H5XA 1IKWB 1FNXH 1NHKL 2CWKA 2RUSA 3G6YA 3BN7A 3CJ4A 2BE7D 2CVEA 1WI6A 1E6VA 3MWBA 5DO2A 1SUQB 4Q44A 1J27A 2APOA 2IJFA 1HNZJ 4KV8B 5IT9Y 4YUDA 3KK3B 2M7SA 3SSQA 2DNNA 1K1SA 3KJNB 2ZH1A 1DLOB 3LP0A 1ZM2A 2AGPA 4IG0A 2GZOA 4CRJA 2ZUGA 1M5KC 3E8OA 3ZTPA 3CD0A 4DUYF 4YY3J 1IR2A 2XMUA 1S6PA 3D1HA 2BE2A 1ZAVA 2ZDPA 4KE5A 4QR1A 5BYSA 4C8KA 4FXDA 3DI6A 4XPCA 5EN1A 1P6TA 1TKXB 4DFMA 5B09A 2UUCJ 1YIJS 2XLKA 4MFBA 3B6BA 3TAMB 1X4BA 2QJ3A 3AXMA 5D0GA 3QWPA 2DCLA 4LJMA 5ADZA 3G96A 3NOGA 2DYAA 3M8ZA 3Q8QB 3BGRB 1EKRA 1WF0A 2KVIA 4NLXA 3IN5A 2CPZA 1YSJA 4ANEA 2HAIA 4G1IA 4USTA 3G86A 5ETNA 2K1RA 4OZNA 2I0XA 1HNWF 1NJZA 4RW7B 4ZPVR 4JYAJ 5GMKa 1C0TA 2YKPA 1FA0A 4L75A 5HN0A 3VAMA 3R1HA 3R5GA 2AW0A 3BSNA 3KLIA 5F41A 4KGMA 1UWAA 3ZXWA 2J9DE 3S8SA 4Y2IA 1FJGJ 3DDKA 3MOJB 3Q22A 1AUSL 1GTEA 3IAM9 3RB0A 1BLUA 3M9OB 4RW6B 3ZZRA 1YK9A 2B4OA 1IR1A 2BMBA 3NLCA 3OVSA 4JI5J 1BY9A 2L9DA 4Z7CA 4J9QA 2E7XA 5KG6A 4Y2MA 1A9NB 3QZ7A 1U26A 4EU0A 3TO8A 4R8UB 2HVIA 1H38A 4HDGA 1SB6A 1RAFB 4Y00A 3UN2A 1WHYA 5AXNA 5I3PA 2MZRA 3QRRA 1RP5A 2DGWA 3R7SB 1OQ3A 5L1IA 1RT6A 2EI5A 2MPUA 2D41A 2RE1A 2VASA 3CCWA 2I5JA 3GJTB 2BJ3A 2HHQA 2ZM6J 3M6XA 4X84A 2KYZA 4AD6A 4ILLA 1X5OA 1GXLA 5IC6B 3TA1A 2IM1A 3MR5A 1W2BR 1JJ2R 3NGKA 1CULB 3FKBA 3OFHA 2N7CA 4EBDA 2A10A 2CNNB 1HQUB 3NGUA 2OPRB 4IR1A 1TMJA 1P8GA 3RBEA 2OLWA 4M5IA 1ZM9A 2D9OA 3HULA 1TAUA 1YVFA 1ZAWA 2RAQA 4PYAA 1U6BA 4QW8A 4NWBA 2MQLA 4U8YA 4Y2KA 2E44A 1JNZB 1D09B 3I4PA 2IRYA 4AQYJ 5E2QA 4EWTA 4LF8J 1PAEX 1UEKA 2WW8A 3EDQB 1ZETA 2R8IA 2GVDB 3HKZD 1LWCB 2R3VA 4PG5A 1RT5B 2X1BA 1EARA 2QIFA 2DISA 2ATLA 1TVRA 2QEXS 2R8KA 1FK9B 3CCLS 2J0SD 2VQFJ 3H5SA 4NX9A 4K4ZA 1X9WA 2VBYA 4WJBA 1YBAA 3QAEA 4MKVA 4ZPDA 1YLXA 4OYZA 2RHSB 4ZLNA 4LMZA 3Q8PB 2W4DA 1U7LA 1E6YB 1Y00A 2VDIA 3POTB 4KH0B 4RWXA 4TLRA 1HNIA 3RRKA 2M52A 1VQNS 5M2UA 1U2RA 4OZLA 1OYEA 1HQ2A 1DBDA 4DL0C 1Q86T 4NCAA 1JXLA 4LRCA 4F3QA 5HJXA 2PIIA 3BR8A 3LW5C 3ZTQA 2XS5A 1KP6A 4LF6J 1YITS 1R6YA 3D66A 2Y1IA 3SCJE 2BUNA 1NCLA 3C19A 3R9LA 3NRBA 3M6WA 4OJ1A 4ZPTR 4MFBB 3TAMA 5F3ZA 5C24B 3VWSA 4B9TA 4HHHA 1RT1B 1SIZA 5DG7A 1JLBB 2NPIA 2AEFA 3KJVA 2XB2D 4CT9A 4ES2A 3UPFA 4K2XA 4MT1A 2ASLA 4WZQA 4KQZA 1LEOA 1ZM3A 3DRPB 5GMEA 4C98A 2OFHX 3HJVA 3OJSA 3OTCA 4Q8FA 5KFNA 4F02A 3D9BA 3P49B 1MROB 1UJ5A 1UVNA 2Z2LA 2V8DA 5LM7E 3M2VA 3BO4A 2V5HG 1X31C 2F5GA 1DTTA 3UWTA 3EX7B 4J9MA 3M2UA 2R7WA 2IDEA 5H9EK 1TELA 4FYYB 1K0TA 3BSCA 1CQMA 4USMA 1U45A 3C2PA 3P5BP 3TJ8A 2CG8A 3DOLB 4J5OA 1WORA 1REVA 1PO6A 2V9WA 4ERDA 1WF1A 5F8JA 2YKMA 2XWYA 3TRGA 3DLEB 1NK0A 4I2QB 1HWUA 4RW8A 4A8SA 2CQPA 3O3LA 3OR2A 1VC6A 2UU9J 4F4KA 4HTIA 2MDAA 4RUHA 5DETA 2LECA 4AXIA 2QMXA 2BJ1A 1RISA 1X5SA 4FDFA 1R8HA 5HROA 3HFZB 2AF6A 2DRAA 1U8SA 4OI3A 1NSQA 1G3OA 5KFTA 5HMYA 3SI8A 2JEIA 2NLWA 4ZPBA 5I42B 1CJVA 2P9EA 4B08A 4IQMA 2VUGA 3ZTOA 3K5LA 2CDQA 3BPSP 2OEMA 1M1KT 1X4AA 2DHSA 1CJTB 2X7IA 1I1GA 2DNKA 1KQFB 4QBUA 3FCVA 2CZ9A 7AT1B 4KC5A 3UR3C 2WONA 5EWEA 2FC8A 4DQQA 1RT5A 2IYIA 4NMLA 1S1TA 5HBMB 5A76A 3QRPA 1U24A 3LO3A 2ZH6A 2W8KA 3M2UB 1RADB 2WRMA 4NEYA 3DHXA 3MR2A 1MMLA 1HFEL 4AYBD 3MAQA 1NUEA 4LF7J 3MEGA 5CQGA 3HK2A 2DPIA 4JI1J 4LF9F 1NSKL 4OZJA 3DLKA 4FF4A 4HI1A 1U25A 4NL5A 3OTDA 2FHKA 1HPZB 3C16B 5C7PA 3V6HA 1Y10A 3LOUA 3JB9k 5D78A 4UOGA 5AJ3F 3D1QA 1I94J 3CIZA 3DRRB 1VI7A 1NPKA 2R4FA 3QAUA 3RG6A 1W2IA 2RB7A 4FZVA 5DDQC 4C8ZA 1HNIB 5B0DA 2DITA 4DI6A 4N41A 3EPIA 4L73A 2CQGA 1Y5LB 3V2UC 5I3UB 2Q66A 3GJSB 3W2WB 2KTQA 4ECTA 1HMVB 3JTOA 3PEHA 4QPTA 2MKIA 3MM6B 4KH1B 3DCAA 5DDOC 2VONA 5L9NA 3MDFA 4AE5A 3DMJB 1PILA 2QGFB 3OTBA 1EZZB 2IY5B 1RXOB 3KLEB 2DNQA 3VVUA 1S1XA 5ETMA 1SJ3P 2ZDOA 1T03A 4ECRA 5F9NA 1RLCL 1X0PA 1FVSA 5GAHU 4DZ6A 4K0KF 3X1LB 3M8PA 2VJUA 1KSPA 2JDJA 2V8PA 1L3KA 2MKCA 3R27A 1JWWA 3GYNA 3HP6A 1P1TA 3I0SB 1VLYA 2JVRA 3MPVA 3PFEA 2W7PA 4EEYA 4PKDB 3ENAA 3GJQB 5KFHA 3CCTA 5GAGI 1HNXF 1VJWA 4KKOA 4IFVB 4ZA1A 5HQMA 2RU3A 3KK1B 4K4XA 2FJEB 1KBRA 4WIIA 2BJ7A 4B3OB 1Q8IA 2OAUA 3V4IB 1MLAA 4Y2AA 1GMVA 1RBOB 2PE8A 2VBZA 3A8IA 3C3LA 3CJ0A 4R5PB 4R0EA 3RTVA 5DDRC 2OPSB 1PJ6A 2QC3A 3CNQP 3FMBA 3IXQA 3IWXA 1FO1A 2LA6A 4CO4A 2DXDA 1GK8A 1S59A 2CYYA 2LLZA 2O5DA 2JHEA 1DQAA 1FRMA 2V67A 2V63A 4CWBA 4A8KA 1N36F 3VGSA 3DMJA 4K59A 5H1SV 4IOCQ 1OY6A 5K14A 1UJ6A 2N7YA 3K58A 2AGOA 2MEWA 1X4FA 2Q1LA 1V5VA 2GV1A 4HL9A 3E51A 3H5UA 2RS2A 2VG5A 3UNYA 4DN0A 1KQGB 1H73A 2HHHJ 4JI3F 3VGTA 2PD1A 2EBEA 2YWGA 5E3CA 3TJAA 3N6LA 2WB1D 3PYGA 2GVZA 2HQFA 3CDBA 4HR2A 3U1LA 2FVQA 2BW2A 1GMWA 3TA2A 5HATA 1YI2S 1JXEA 3IFEA 4B9MA 3GLJA 3R2DJ 2MZQA 2YQ3A 2DNRA 3CW2C 5T41A 2ZM6F 3L9ZA 1B99A 1N88A 2LMIA 4WP3A 1DAXA 5IQ6A 3MR6A 1FWLA 4F2RA 3PDNA 1QTNB 4V19X 4ETZA 3BSAA 4N76A 2VODA 1NHUA 3Q83A 1PGZA 3PR5B 2AYGA 2K06A 4O23A 3L4BC 1LW0B 3D4JA 1J5OA 4LF7F 3WQPA 1RAIB 3CJ5A 2P2CB 3SEOA 3OSPA 4H4KA 1KN6A 1UW4A 3UVJB 1GNKA 3G71S 2DD8S 4ZCLA 3RR7A 3NNHA 2HQCA 4A8FA 2NQPA 2W2PP 4K4UA 3M30A 5J1EB 3KMSA 3D0IE 2VZ9A 1REGX 3H2LA 5LSOA 1IKYB 4CNZA 1I5OB 4RUBA 3V4MA 2ZBRA 4PQAA 5HP1B 3OT9A 4DV5F 1FEHA 2LVWA 3GCXP 3K5MA 4B9UA 2H4YB 2PT0A 4BWJA 1L5UA 4B3TJ 1S1WA 4PEOA 1C1CA 1PC4A 3BGOP 3PRDA 3RBDA 4PWDB 3TVYA 5A8RA 1VHFA 3R5DA 3FRYA 3GONA 5D4OA 3DLJA 2CQBA 1HD0A 5DDPC 2N4CA 2AQ4A 2ZH8A 5HMWA 1CC8A 4UUWA 2QLWA 1SI9A 1DTQA 1HBUA 1U1PA 3EVOA 4DQRA 3FSXA 3GV8B 3M8PB 4ZP9A 1SBRA 4I0WA 4URSA 4WK1A 4KGZB 2JFDA 2OH2A 2IBOA 2C2MB 1EQMA 2EFGA 3HT0A 3MEGB 3KLFA 3H25A 2DEJA 1HARA 3KWMA 2MMYA 4TY9A 1HBMA 1JNRB 1WC1A 2HHTA 2HNZA 2JLFA 4J7CA 3DFEA 4NLTA 3KK1A 4FYWB 4LSNB 1EQ0A 4Y28C 1KWMA 2FPHX 5K20B 4M5LA 1IBMF 4Y6IA 1F2HA 4NLSA 2NUHA 4XDCA 3MXHP 2ATCB 5DQIA 1OY8A 1WC5A 4DV1J 2NXNA 2KHCA 4J9UE 3S7RA 3DLGB 1NK5A 4DR4F 5CYJA 3GB0A 3US5A 1H7XA 3IBWA 1FFGB 1ZPWX 2WZ1A 3ET6A 3ICLA 4DUYJ 1F9FA 2RILA 1V3SA 1AUDA 4IDKB 2QSWA 1RKIA 4OI4A 2XY7A 1KQKA 1F0XA 4KPYA 1SH3A 1MMDA 2KKHA 2WOMB 3DOKA 4KO0A 4OX9F 2E5LF 4Q8EA 5KFOA 3CD5A 2EC0A 4DFJA 1RHUB 4ZP7A 3GG1A 1DTQB 5A6WA 3OTOJ 3CCJS 3EZOA 4ED6A 4DF4A 1U1LA 2RF2A 1SXLA 3KLEA 1RAGB 4LF5J 2IAJB 4CP5A 3OPKA 4DR1J 4O3QA 3TQEA 2R7SA 3AOCA 3BQ1A 1ZPVA 2OHDA 2GQ2A 3QFWA 1YG0A 4ED2A 1FFSB 2CQ3A 4DG1A 3SYZA 2OFGX 4OI0A 1RAOA 3B4MA 2Y3YA 4DPOA 5KG5A 4DV2J 1KHWA 1N6QA 4NRUA 3I6PA 2D3O1 2KFNA 1QAXA 4KKOB 4U96A 1U8WA 4KHPJ 1RYSA 3PR4A 3CDWA 4ZP8A 1ITPA 1LKZA 4UZBA 2KJVA 1GAOA 1HHSA 3FVYA 4MJKA 1SJ1A 2KT2A 4U7UK 4X4PA 3GMGA 2ASDA 3KMQA 3J7Z5 3CSKA 1T9VA 4IO1A 3OUYB 4DHVA 5IT9U 2ZKUA 4E2FB 2CXEA 5B0CA 5J2NA 2U1AA 4NXMF 3Q2TC 3MTJA 3UCUP 5GAEI 5HI7A 3HZGA 3KFWX 1JLGB 4PR6A 2G0CA 4GKJF 3IG1B 1YGYA 1B7YB 4EUVA 3CCUS 2XZWA 3NWGA 2XI3A 3OLBA 1N8RT 1NJIT 2UXCF 2CQIA 4P2MA 4X66J 3MZIA 3M32B 2D3UA 3MEEA 4CO2A 1YJNS 3ENWA 3D6TB 3U1NA 2JEFA 1S1WB 3TYTA 3VF0B 3VALA 5KFSA 2GS8A 1IBKJ 3AY0A 3HHEA 3MPDA 5E3RA 2FUG9 2W7OA 1S6PB 5ETOA 5A0YB 3IS9A 3D6HB 1ULRA 2H3EB 4CLUA 4FF2A 5L38A 3PW0A 1FTRA 2HNDB 3TARA 1RT1A 5LSLA 3FQKA 4ZVPB 1SL1A 1TFYA 2QT7A 4IQXA 1MG7A 4ZHRA 1JLQA 3BDPA 1IWGA 3U1MA 1HKAA 2OPPA 3AD7C 4FYXB 3RUBL 1FE0A 3ZZPA 4DCJB 3H20A 4MIAA 4F26A 2ZHOA 2AIRB 2KT5A 3KTQA 3KNGA 2JC1A 2E5HA 3MMBA 3CXCR 4ILMA 9ATCB 2O67A 3BGUA 4WFNQ 3ELHA 1R8PA 3DLHA 4KIAA 3J80U 2Y9HA 2CNLB 3HO1A 2WK4A 4MH8A 4NLRA 1FDAA 1RU1A 4RW7A 4B9LA 1SV5B 3IC1A 4JI0J 3HT3A 3OL8A 5ETRA 1GH8A 1SIWB 5LJ5Y 3GCWP 3HDSA 1HR0J 1VQ9S 1CVJA 1Z4UA 2R42A 3NKYA 4WXOA 1OSCA 2LFVA 4YP3A 5B08A 1SQGA 3I31A 3UR0A 4QWAA 1FD2A 3BGFA 4J91A 2AKWB 4DV7J 4LFCF 2G1HA 2WVDA 2DY1A 2MY7A 4M5MA 1VR6A 5D15A 4O3OA 4C3LA 1ZTTA 2I38A 5CCMA 4CT8A 1FRIA 5DJBA 3KG0A 5IS2A 2MKJA 3C15A 1F3VA 4QCLA 4Q5VA 4NA1A 2BDPA 1IBLJ 2NXUA 4ZVUB 1CS4A 4OZ3A 1AA1B 4HH1A 4DBQA 3OTOF 4EYIB 1UFWA 3IBCB 4BDPA 3CGIA 1HI0P 1XEZA 3MAAA 4ZIVA 5KFBA 2HGLA 1HD1A 3PW4A 3G87A 3EMTA 2C2OB 1G4CA 2GIFA 3D0GE 1U47A 4B9SA 2HVHA 3LQVA 2ROEA 2XLJA 4OIXA 3DLBA 3KKFA 1E6VB 3AB4B 2B6AB 3RJMB 3N0VA 5L46A 3R5AA 2HQ3A 3ZTRA 4WFZA 3IMQJ 4CNYA 4CM2A 4DL5A 1SJFA 4LF4J 3RB6A 2B56A 4ANCA 4QWDA 5KOWA 5CABA 2IVMA 2QL5B 2HBRB 3LPEA 3SSRA 2CIMA 5D77A 3ZTSA 4H4KC 4WBFA 1FNMA 1VQSA 1EETB 4LSZB 5D0RA 3W5ZA 1FKPA 2VQEJ 3N28A 3VAHA 4M5HA 4XPEA 3T5LA 1B0PA 2HS3A 4UY8T 2P6TA 2WOMA 4KO0B 2MQPA 1LFPA 1RWPB 1Y4ZB 1YJWS 3DM2B 1GX5A 2PI4A 4ZJLA 2YX4A 3PW7A 3UI3A 3WIVA 4UOHA 3S1TA 2X1FA 2IHR1 1EX8A 2QA1A 3P96A 4ZOSA 2UUCF 3ETMA 1FF2A 3BM7A 3MM7A 1HBOB 2POKA 2LYVA 1HHQA 2RMLA 3W65A 3HD2A 4DU8A 4PG4A 1CJTA 3FUYA 2WBRA 1QE1B 1SC4B 3GE9A 3IS9B 3VR1A 3OSNA 1N36J 3QT8A 3NY0A 3I5AA 1DY3A 5IV3A 1NNDA 2B5JB 4ZK7M 3H8YA 2IJRA 2FLOA 3EGWB 4DR7F 1Q5YA 1G6BA 5HBMA 5HAOA 3K17A 4DR1F 1TMMA 1NK4A 1FTCA 4PXCA 5E7OB 2IM0A 2X51A 3ITHB 3JQJA 4ZVEA 2OD4A 3JSMB 2BOAA 2DGSA 4TU8A 3NGDA 1U49A 1ZYQA 4ZLPA 2XSJA 3LPYA 1KVKA 1P1LA 5KT4A 1YQHA 2W2MP 3PRBA 4X62J 5HLFA 2CG4A 2QA4S 4IG0B 5A6PA 1HQEA 2HPUA 2O1PA 2BV3A 3CDAA 3F73A 4PPDA 4WU2A 3MMCA 1S10A 3OD2A 4WFAQ 1H98A 1N5TA 2AZ3A 3C14B 4F4YA 2N3LA 1JIHA 4NE9C 1S99A 3QT6A 1J5EJ 1TAQA 3NAIA 1C1BB 4OV1A 2HHVA 2RQ4A 2G4BA 4NI2A 1SL2A 2EKNA 4ZIWA 2RNEA 1Q53A 4KBIA 1HYSB 1TL5A 3D1OA 4EZ6A 4LQ3A 1Q95G 4WE1B 4JOUA 2UVRA 1IKVB 3FZBA 5C25B 4TQSA 3W9JA 1AB8A 4ZPAA 1KLNA 2C3PA 2J7WA 2WBMA 2YTCA 3AT1B 3DI6B 2NPFA 1SKWA 4B9VA 2B9XA 2LP4A 2YH0A 3LUYA 5D0EA 4J90A 3QQCD 3ZZZA 1Z2ZA 5CH7B 2FY8A 5BXIA 5GAHI 2VKZG 2WAQD 3MUTP 4IH5A 4RL1A 4A47A 4KTQA 2CPXA 4RX6A 4RKUC 5T7LA 5EWFA 1XR7A 3D2WA 1S9EA 4G1PA 2ILZA 4GVBA 3GR1A 2BOPA 4ZPWR 2K8GA 1UZHA 2VG6A 3FJ2A 3JTNA 4ECXA 4OQJA 1KTVA 2DEIA 5KFWA 3KHLA 2GIQA 3SFGA 4J9NA 1QVFR 2MQMA 3TZXA 3K8VA 3W66A 2Y8WA 4N5SA 2LCWA 3P4UB 2HQGA 4KGKA 3TVZA 2ZHBA 2R7TA 4TYBA 1QUVA 3ILLA 1RTHA 1RT7B 3V4IA 4I6WA 2BEFA 2R2RA 3CJKB 5FDLB 3FCWA 5H9EJ 5LL6d 4ZVTB 1H6KX 5DQGA 3MM5A 3VHQA 3CB4A 2DTJA 2K3KA 2K7KA 4C8YA 1RGVA 1ZH5A 3M30B 3LA0A 5J1EA 4IFYA 1ACMB 1RWUA 2G1DA 1U1MA 4IH6A 2XMTA 1CULA 4Y34A 3NCRA 2CKWA 4TNOA 3E2EA 4C2MA 4L6V3 4C3KA 1TKZA 4F0HA 1P27B 3TZYA 1NK7A 3Q24A 2BM0A 3RRGA 1RTDA 3EDRB 1MN7A 4YR3A 1TV6B 4DPWA 3BPDA 2L9NA 3VZIA 4JYAF 2O66A 4O44A 1DURA 2HK2A 5IFMA 5L39A 2C3MA 1RWOB 3AAWB 3VCDA 1U1NA 4PUOA 1N52B 1U0HB 2A0FB 2ABYA 1U6FA 2QL9B 3EGVA 1FJGF 5KG4A 3Q89A 2MZ1A 3AD8C 2I9SA 3B54A 2YX1A 3FFIB 5JVHQ 2F4FA 5ETSA 4K4SA 4BS2A 3HD1A 4MK7A 5C5JA 5M2RA 2ZD1A 4DSEA 1VIXA 3SDEB 1XK8A 4X4OA 1FJCA 1WEXA 4WK3A 4I67A 3DKDA 2GMJA 2N4DA 3OXLA 1FE4A 1DJ0A 2XMKA 3T6JA 4C4WA 2Y0SD 4BCAA 1XWLA 5AE3A 3T5KA 4DV6F 3RAMA 4F0MA 1NDKA 4DR3F 2B7BB 1VQ4S 4CCHA 2QLFB 2CNKB 3KUGA 3OR2B 4NI2B 1BGXT 4XTTA 3UDVA 1F9EB 1EETA 5KFZA 4I7FA 1TR0A 3MMCB 5AE1A 2KRRA 5FIIA 1Z1ZA 1X7VA 3I96A 4KRWA 4OI1A 4CYUA 1M5SA 3FCHA 3GWCA 3MGJA 1NSPA 2VIHA 2LEBA 4EMDA 2ROPA 4DX5A 3H4DA 1T8EA 3FEZA 1PAUB 1UA1A 3H98A 1WDDA 2D69A 3ET6B 2X3DA 3RB3A 1KQSR 4O44B 1UPPA 2ZC3A 3AFGA 3S6EA 3OJUA 2V4QA 5B0GA 2W2OP 2A6MA 4P73A 1I3OB 2MQOA 1HNZF 1T11A 1BWVA 3LGMA 3GPAA 5E0OA 2ASJA 4F3MA 1M5VC 1MN9A 2V8VA 1EP4B 2J76E 2CJ9A 3O6QA 1JLAB 5K14B 1M5OC 2HWTA 2WSFC 4FN5A 4CI0B 3OHBA 1S1VA 1T9UA 2DB1A 2ZKTA 4FPRA 3T1YJ 4LFBF 2V4JB 5AXKA 1PCAA 2Q6BA 2PFFB 2HFVA 2FZCB 1EHWA 1PC5A 2YVSA 3N6MA 5DGBA 4RUAA 2UXCJ 1BXNA 3PYEA 2YPYA 3DLKB 2ZWPA 4LBIA 5IT4A 2W2QP 1IKXB 1N0VC 2LDYA 2A1BA 3FDSA 2CUYA 3HLUA 3DHWC 2BXJA 4NXMJ 1G7CB 1KOHA 2W1BA 4OX7A 5CYMA 2B8QA 4RO0A 4DSFA 1TKTA 2QLBB 1C4AA 4RBTA 2WCXA 3SFUA 3H2UB 3R7BB 3VVTA 2WSEC 1X5PA 3GIIA 1S1UB 4JP8A 2BACA 4RW8B 2HW3A 3FSIA 2E5JA 5J2NB 5AJ3J 2KT3A 1R43A 2Z2YB 2Q79A 3CMQA 2KU7A 3MF5A 2ZH4A 1Y7PA 4BWMA 3LF0A 1FDNA 4CLPA 1K0VA 1X4CA 4PG8A 4ZVFA 2R7RA 2KZZA 1JB0C 2AJFE 2IM2A 2VFTA 3Q8VA 1EP4A 4LFAF 1R8BA 2W25A 3ISZA 3P5TL 1Y0HA 4PZVA 3BF4A 4RPFA 5ETQA 1RTDB 5IZHA 3TAQA 1IBCB 4NZ6A 2B4VA 2GJIA 2PA8D 1KVJA 2DJWA 5D3GB 1R0CB 2KI2A 2E1CA 1T9WA 3MECA 4P74A 1M90T 4FXVA 5J2QA 3THVA 3KK2B 1IJFB 2CDRB 5E3PA 4MK9A 5HJYA 1NZ8A 1WWHA 2V94A 1DQ9A 3MCOA 4EGLA 1QLNA 2WTFA 1HW9A 2VPWB 2J9EA 2WB4A 2CJQA 4K4YA 4DCPB 4RW4B 2HVEA 1AZSA 5IWAF 1JLEB 5ETVA 2PI5A 4YB6A 4LFBJ 1WSRA 4C8LA 1WDTA 2D7SA 2UUTA 3PYDA 4U7UD 2AX0A 3E01B 2Q3PA 1YRUA 4ZLLA 3DOLA 2L9WA 1IBMJ 2UP1A 4D3GA 4EZ9A 2FHJD 1TUGB 2GHWA 2V4RA 4LVOP 2FDNA 2G2YA 3TEGA 1R3NA 4J9VA 4KYZA 1XTZA 2HRYA 2BX6A 2IIHA 2KO1A 4Q2LA 5JMNA 3J7AN 2CPFA 4WKRA 2GA7A 2HRUA 2CPJA 3VV2B 2DNYA 4OLPA 4H4MA 4MTPA 1IQTA 1TL1B 3EVWA 4C8OA 8RUCA 2V0NA 4V19J 3GTYX 1RA6A 2H5IB 3C66A 1T9TA 3DLGA 4JI4J 4YR2A 5J2QB 4FKXA 2ZJRQ 3SBMA 3D6FB 1OQ6A 3HI9A 3M05A 3JAMY 4DWIA 3QRQA 1R8CA 4EFAC 3RR8A 3QIDA 2YKQA 2KN4A 3VAFA 2ZOFA 4FNHA 3K0JA 1S1XB 3A12A 1WC3A 3BH6B 4JI7F 3FBBA 2CPIA 2XEXA 2FB0A 2HNDA 2B9EA 3KLIB 4UOFA 4GC7A 1RK8A 2HFUA 6AT1B 4H4OA 5GADI 2GAHC 1LWXA 1TKTB 2MZTA 2QN6B 2ZZTA 1Y3JA 4RJVA 3QYYA 1K44A 3MAAB 4ZHRB 4DL6A 2IA0A 1J5OB 2CAJA 1MSWD 1RWNB 1N0UA 1UP1A 1GT8A 2K1RB 4PXBA 4IYQA 4LR9A 2NSBA 4B17A 5A8KB 4DR5F 1UTAA 3W61A 1BC6A 2Z57B 1RQ0A 2NYIA 1KHVA 2YNIA 1Q78A 1C0TB 2LDIA 4I7FB 5DZ7A 4TU9A 3QT7A 4U6PA 3DU5A 1YJ7A 2Q43A 3CD7A 3EUNA 1TK5A 4B3SF 2GGPB 1IKYA 4KGXB 2YNHB 3HZEA 4B3SJ 2QYCA 1Y11A 3PRVA 1D8YA 3C6UA 4HEA9 1QSYA 1YJUA 2F9DA 4XIUA 3I56S 1DQ8A 4ECUA 2RQCA 4DDFA 1NB7A 2NREA 2AWZA 4E0DA 1C1CB 4GRSA 3NL0A 5D4LA 2NXJA 1M1HA 4AT1B 2I2YA 1I51B 4TYAA 5F8IA 4QR0A 4ZJOA 4R8UA 3ULHA 2FLLA 2MZSA 1G2EA 1Y5NB 1YRXA 2QG9B 2F4VJ 1H2VZ 2F8MA 2R9LA 3M2RA 4CLFA 3D54A 3K89A 4NCGA 2NXCA 1JLCA 2KDOA 4FF3A 4DV1F 3CEDA 1AZSB 2D3OR 1RAEB 5IXUA 3N9UC 8ATCB 2EK1A 2D74B 1IXKA 4HDHA 1QAJA 1CQNA 2J9DA 2RDIA 4DV3J 3QNWB 4BC7A 4F4AA 1OIAA 2HLTA 3QGIA 4RW4A 1LWEA 3W63A 2DBBA 2W8LA 1FKAF 2LA4A 2MB0B 1XMBA 5HO4A 1IN0A 2YNHA 3BQ2A 4N56A 1MWQA 4AFFA 3J80Y 1XR6A 3ZNJ1 1RYRA 2FJAB 4OYMA 2QLXA 4QZVB 2FGOA 5KFXA 2XCPA 4OI6A 4B3RJ 3MFHA 1LWCA 3AD9C 2UVWA 4F8RA 4JV1A 3MR3A 3FBFA 5L9XA 2MZJA 2BKOA 3HVTA 4ICLB 4S0MA 3SIPB 1TU0B 3UVJA 1YJTA 3G9CA 1URRA 4OZ5A 1RBAA 2DXEA 4RW9A 2CA9A 3A8EA 1SH0A 2GJFA 2OP5A 4LBHA 2QFJA 1SKSA 2KFZA 5CZXA 4FPIA 4PWDA 4NPOA 4J9LA 3GP9A 1N5YA 3EWGA 4NCGB 1EKSA 4DQSA 3LWMA 1IM6A 5DS7A 1O8BA 2HNYB 3KHRA 3L09A 2OTJS 1GMWD 1QTMA 3O2IA 2Y8YA 2RKIB 2EFOA 4QWBA 3UW1A 4I2PA 2FVCA 4F2SA 2E9RX 5ETPA 3IBFB 4JI5F 4ALZA 5J2MA 3M2VB 2OMOA 1DHMA 1ZS6A 1JKHA 3MOZA 4LF1A 4IR9A 2VPZB 2DIVA 2J0WA 3BYRA 3SCLE 2BZ2A 1AT1B 1NPPA 2HVDA 3HHLB 3QFHA 1HHTP 3MEDA 1SJRA 3NWRA 3CDEA 1LQ9A 3RW6A 4LR8A 4M5JA 1TK0A 3ITHA 1UCNA 2KL8A 4FP9A 3ZO7A 1XMOJ 2VFRA 3KXDA 2VFUA 2YWKA 1LW0A 3BEGB 1NKBA 1WHXA 4P7VA 3BKUA 2MTLA 2CRLA 2OPQB 4RNHA 3W8GA 2JLGA 4K7QA 3ILJA 5LMUJ 1HQEB 5DLFA 1O6XA 2AHOB 2IMOA 3IAS9 2YQ0A 3JTPA 1VYAA 1BUXA 4NLUA 3PACA 1KS2A 4OYAA 1D1UA 2DNGA 3C14A 1CJVB 1FRHA 1SCJB 3M1VA 3J81U 5CYQB 3A3OB 2HHWA 3DLEA 2AEJA 2F8HA 2ZE2A 1QY7A 3MM5B 1U1QA 1L3UA 3HSGA 3CMES 2HWIA 3H59A 2C3OA 4KHRA 4M63A 4USHA 3NS5A 4F4ZA 4DR6F 2NZ4A 1RACB 3ENQA 4ZKAA 4MIWA 2J7UA 3MCSA 4P9SA 1QAYA 2BR0A 1VRQC 2BANA 5LMNJ 1SJ4P 2Y0BB 3I82A 4HTJA 1XQIA 1HWLA 2YKOA 4ILRA 4OYIA 1JKHB 1YKWA 5E3AA 5KT5A 4ED3A 1TKZB 2IRXA 2FLPA 1FX2A 3MPWA 3BBBA 3NCQA 3JSMA 3HFKA 3IWLA 2NR0A 2FGCA 1RAHB 4ITSA 1UFKA 4IG3B 1HBUB 4DL4A 4IUFA 5AE2A 5L8RC 4C8NA 5F9LA 2VC1A 2JNJA 5F8LA 3HSDA 3IR6B 2H5JB 1UMJA 1YX2A 2IJNA 3W9IA 4C3MA 4YOEA 4O3SA 5ETKA 2QLJB 5D4NA 1T05B 2ZHAA 4X62F 1VCTA 4ATNA 1TKDA 1B4SA 2F7VA 2UV8A 1TUVA 2MQQA 1HNVB 3BS9A 3CCES 1LWFA 2Z2MA 2FHJA 3N5FA 4FXWA 4C48A 3FBCA 5CZVA 5CA5A 3H4BA 2ERRA 1WOSA 2VICA 3DLLQ 2I6WA 3MAHA 2QRRA 1WKJA 2LQ9A 3PKMA 2FJDB 1UVKA 2VC0A 3MTKA 3W62A 2XYGB 3Q86A 3W9HA 1NBEB 3N4WA 2LXIA 2XNQA 5HK4A 4I2QA 2DR9A 2PFDA 2DGUA 3VZHA 4GKKJ 2C1EB 1NSAA 2JFKA 3GIKA 1DZ5A 4FYDA 3QSIA 2E7WA 5KFFA 2MJUA 2W24A 3J7ZT 3CCRS 3A8JA 3TI0A 2ACYA 4IFYB 2UVVA 2OELA 5E5NA 4ZITA 3JYTA 5J2MB 3R7NB 2C42A 4F36A 2RH3A 4NRTA 3IRWP 2MYFA 1H3DA 3P45B 4DXLA 4IRCA 3PY8A 3U27A 2J0XA 2FVPA 2RKIA 5FJ4A 4OFZA 1HMVA 1TV6A 2GO8A 2OSQA 5GAGU 4KHPF 3WC0A 2EVZA 3CCVS 4JV5J 2BBEA 5J2PB 3QSYB 3CULA 1BWEA 1M1GA 1U4BA 5KFMA 3JSYA 2UZAA 4P10A 5DM6Q 2HHUA 4O3NA 4IOAQ 3CUNA 4LRFA 1U48A 3J7A1 1S1TB 3HHLA 4ID5B 3TUJC 1WTBA 4JI1F 3DYAA 3G82A 2QTWA 1NDLA 1ZZFA 2OPPB 3BREA 3CWJA 3Q23A 2DNZA 4W92B 2ZZMA 4YS2A 2XQCA 3HJFA 2V2VA 4UOCA 3UCGA 5C42A 3AOAA 2H1YA 3Q8YA 3KHGA 2ILYA 5CYMB 2VJVA 3K8WA 4IFVA 1GXTA 4ZCKA 5EDWA 4U8VA 3CC7S 2BE2B 2PN6A 3HSZA 2JL9A 3M1VB 3DRRA 3HX9A 3EVMA 4OJHA 1NH8A 3CE8A 2DHGA 3CO9A 3R8YA 3V5RA 1N5YB 1D0EA 3SQGB 1CS4B 2C2NA 3MM8A 3M32A 2HFNA 2YQ1A 1BQMA 1QSLA 2OEJA 4WYWA 2MJNA 4P2FA 1RHMB 3ADAC 4RNMA 1HBNB 5KT2A 3NG8A 1RHRB 2K2PA 4FYVB 3CJQA 4OYPA 1R27B 1WKKA 1BQNB 1WHVA 2A6OA 2IVFB 2EKYA 3RBXA 1EB0A 4LSLB 2V50A 1S1VB 4Y3CA 2J0QD 1VISA 2ADCA 2B8PA 3EYZA 3HKWA 4WP8A 3G4SS 2VG7B 1XMQJ 1VQ8S 4IRDA 1MU2B 3LAKA 1GTHA 4QOTA 4YFUA 1RT2A 1KEKA 2GMHA 3M6VA 5LJ3Y 5K5MA 2UV8G 3UD4P 2ROGA 4Z37A 1CJUA 4ELTA 2AMCB 1S79A 2X1GA 4AL6A 4QPXA 2LU1A 3K5NA 5DM7Q 2D3ZA 2UXBJ 3WZ0A 3DM2A 3DN9A 2BJ8A 2V8GA 3JYTB 5KFPA 4OHZA 1QDUB 2CQ2A 2ZBPA 3W5XA 2VH7A 2D1CA 2F8EX 2VKRA 3KYLA 4ZJQA 1FX4A 3MUMP 4DQPA 3D6MB 2MGZA 2HZCA 1TL4A 4OYWA 1SQFA 3MCNA 3PX0A 2RQMA 1D9AA 1JJ4A 3IM8A 2UUAJ 2R7QA 2EG2A 5C24A 2PEBA 1VQKS 4DSJA 1F9HA 3T1AA 4DR7J 2E1RA 5G4DA 4NOHA 4NYZA 3OW2R 1R31A 4DLGA 4PWWA 2XS2A 1KFSA 3RGIA 1M5HA 3NXZA 2R7XA 1RA7A 4DUZJ 2GMLA 3FGVA 2ZUAA 2CPDA 3MR7A 1ZM4A 4QU7A 2Z58B 2DRDA 3DOMA 2MLZA 4FVMA 4CO0A 1X4HA 3PEJA 1RU2A 2F4VF 4ED1A 2MLYA 3OHAA 2V34A 2E1AA 4H54A 4DV3F 1VBKA 2EEYA 2V4JA 5KFAA 1FT8A 4U67Q 3IM9A 4DX7A 1E6YA 3M8WA 4USIA 1SQEA 5K8OA 3J7YU 1NJYA 5DLGA 1S77D 2QA4G 2XMAA 3ILIA 2HKEA 2Y1RI 4OLOA 3G6VA 3E3XA 3RB4A 2BQRA 2R2UA 5L1KA 4OHXA 2YKNB 4LIRA 3CPWR 1VC0A 1BHNA 1Q5VA 1SPBP 4K8RA 2CJKA 4B3MJ 2DNOA 9RUBA 1KC8T 3CVKA 2DCUB 2GAGC 2MHNA 1WC6A 1BQMB 3NAHA 1J5EF 2I1RA 4URQU 3G2XA 5HP1A 1VK8A 3LP2A 5DZ6A 3VGVA 1NMEB 4WE1A 1PYTA 2PEHA 4G65A 4JBCA 4O0IA 4DL3A 3D7SB 1HBOA 3V81B 2BJ9A 4I6AA 1HI1A 2QZ8A 3W60A 3CC2S 3QJLA 1NAQA 1MU2A 2XULA 1S9EB 1H2UX 1F3FA 1UETA 2P9GA 5KG0A 1FWKA 2OIHA 3MHYA 1W7WA 2J6UA 3OL9A 3QJJA 4PAAA 1CG2A 3PCOB 1RHJB 2AYMA 4LSLA 4OHVA 2UVUA 4ZCMA 2DGQA 1KTQA 1NZAA 4MKBA 5KFGA 2AJ4A 3LTOA 4P75A 4ZN1A 3PKYA 3CJ8A 2VPXB 5K8PA 2XY6A 1ZZNA 3OVBA 3PIPQ 1Z2LA 1REVB 1YJRA 2C3YA 3ISND 3KK2A 4JI4F 2JVOA 4CZCA 4WFYA 2CADA 3AQPA 3D0HE 4HHUA 3T1HJ 3C46A 1X4DA 2IDLA 1JLGA 2XMJA 2KZMA 1DTTB 3NEKA 2MGZB 2P5VA 4JV2A 1U09A 4L74A 1LW2A 4AQYF 5KFUA 1U0SA 4LSNA 4DL7A 3ZC4A 4JI3J 4ECSA 1D9FA 2QE5A 3GIRA 3TX0A 4K5RA 3I9V9 5KFCA 1Y3KA 1RUSA 1FCAA 3JSBA 4NLWA 2HGMA 2F63A 4RWWA 3E01A 3C6UB 3HHLC 3NP5A 7FDRA 5ETTA 5HVFA 3BZQA 4KGVB 4TXSA 2J8AA 4WFBQ 3M9NB 2VBXA 4A8OA 4GO7X 1N34F 2DRBA 4LF4F 2VOOA 1T7PA 4W4MA 1UKUA 1JJHA 3KJFB 4YHHJ 2G2ZA 4P71A 4N47A 4ES3A 2FVSA 4USWA 2UXDJ 4KAIA 4EO8A 4CLZA 4F50A 1JLAA 2EBGA 2R7OA 3H90A 4LIWA 3TJ9A 5DQHA 3NMRA 3J81j 5I42A 4EI2A 4DS4A 1QD1A 1KKHA 3KG4A 2A2CA 1VRTB 4CTAB 2AZ1A 2ZD1B 4QQBA 1YBTA 4DN9A 3OLAA 2XY5A 4Q0BB 3EXYA 2W4PA 3KJQB 1NRKA 3UDLA 2F65A 1N33J 1X5TA 3QATA 5T7LB 4G6VB 2KXHA 4OYXA 3N01A 3QGGA 3H5YA 1IKWA 2CQ1A 2JSXA 1IUJA 2J7KA 3NS7B 3FMWA 2E29A 4QIFA 2E9TA 1KDNA 2ZJPQ 1KRPA 3OV7A 4FKYA 3N5BA 1HLWA 2I8EA 5KFQA 1HPZA 3C16A 3A3NB 3PM9A 4NYPA 5F8MA 3KLGA 1LOUA 2CQCA 1Q8KA 1RT3A 2CVIA 2PGCA 4OJ3A 1VS3A 2GHVC 3RU0A 2L41A 1XMQF 1S1UA 3B78A 2RT3A 4DOZA 2HURA 3U7JA 3MMBB 2IVYA 3GJRB 2M88A 2G9OA 2D9PA 3BO3A 4QU6A 2BJDA 1Q0NA 4DZDA 3KLVA 2BKNA 3KOAA 3TUZC 2DPJA 1W26A 1V3ZA 1VDHA 2YX7A 3I87A 4OYOA 2QSFA 5JXSA 3TZWA 4A8YA 3UFCX 1SKRA 2HMIB 1RTIA 2EWHA 1N5QA 4HACA 3KLHB 3GYXB 3P3DA 2EW9A 4MKAA 1RJJA 4V1Ak 1YHQS 2V6AA 3W1YC 2HS0A 3A1YG 3BGRA 2B51A 3R6GB 3HCXA 3LALA 5D4PA 5SZTA 3ZZ0A 1T03B 5IOLA 4JI0F 2AJ1A 3IRXB 2LEAA 3NMAA 4DV5J 2ALYB 4EBCA 3PV8A 3HVWA 1KONA 2DGOA 1RCOB 2MSTA 3EM1A 3I0SA 3NBPA 4I68A 1S6QB 4CLSA 4ZN3A 3HPOA 3L3CA 1YJ9S 4FF1A 4YMEA 2Z30B 1NK8A 1S49A 2DK2A 2GO9A 2IC3B 4RUCA 4K4WA 3CMAS 2G0JA 3RZAA 3DRXA 4X4SA 1AW0A 1T9XA 3T9ZA 2HVZA 2W7AA 2ZBIA 2Z56B 1HWKA 1D8ZA 5DGAA 2FLNA 5H9FK 2YNFB 5KFYA 1CEZA 4MYUA 2CWXA 5E33A 4M5GA 1TL3B 4ZVOB 5C2GA 4XK8C 3D68A 1FDDA 3OXFA 3EXCX 2BKPA 4QIGA 2XG8A 1VHIA 1KLMA 4KJIA 2QX0A 4PQUA 5I3QA 1TL1A 2N82B 5B0AA 3D28A 3DDNA 2C2RA 3IR7B 3GZ7A 4ECWA 2PSZA 4X66F 3TWZA 1N32F 1UZDA 2ZWOA 3T3FA 2R8JA 1ROFA 2ZBQA 3OL7A 4UY85 4NXNJ 3R6LB 2K3IA 1SJQA 1T95A 4M8LA 5BJRA 4Q0BA 5HQ8A 1KVIA 1UAWA 2CNOB 5CD4H 2NSCA 3V6JA 3V81A 2ZH7A 3O1LA 1A6LA 2WVBA 1JK9B 2B5JA 3FNNA 4XDDA 2M3DA 2V2ZA 4DV2F 4WXWA 1UA0A 2HBZB 3BGLA 3TAPA 1LV5A 4W90B 5KFRA 1V3RA 3SV4A 3RAQA 2QMWA 3HSJA 1C0UB 5LMUF 2BQ3A 1YDLA 1XERA 5CXTA 5D3GA 4CLLA 1XN9A 3MM7B 4IG3A 1XR5A 3GFYA 3R5BA 1YZ7A 1WOOA 2RQKA 2F3JA 4DSKA 4K4VA 4IOBA 1K1QA 3ONQA 2L3MA 2FJVA 2B4PA 4ID8A 4RW6A 2YKAA 3JQKA 2N3OA 4LVNP 2M8HA 4JUZA 4ED8A 1GFWB 3F41A 3GSIA 2DHXA 4YB7A 4HYKA 1YTYA 1VLOA 2B0GA 4Z2XA 4GKKF 2FZGB 2V69A 2QYGA 1N56A 1NJWA 1N5VA 2YWEA 4ETXA 4LR7A 2E5LJ 4PQUB 1B7FA 4L3KA 3T19A 4PABA 2H54B 1R8AA 1VOMA 2KG1A 2RS8A 2VDHA 4G1QB 4DR5J 3QO9A 3PJWA 5A8WB 4DR4J 3V6KA 2JOQA 1RDRA 3HVRA 3MD1A 3G8QA 4PCQA 1TQLA 2HHXA 2ZJQQ 2OPQA 1SL0A 2CQDA 4CLKA 2OMLA 4DPTA 3TQ1A 2OPRA 3M6UA 3R5JB 1VQMS 1LK7A 4ZMMA 5LMNF 2ALZA 1D9DA 1VK3A 2HWHA 3K5OA 4C97A 4AUKA 3KNAA 4C0BA 4ZVHA 4I1TA 4TN2A 2QL7B 4Q43A 2XZDB 2DVIA 2DGXA 2GFFA 4KPCA 5KT6A 2I5JB 3BDEA 1B70B 3X3UA 3FEXB 4GVBB 2HZAA 2HYIB 1RHQB 2DIUA 1QM9A 1AFIA 2P6SA 4H4OB 3K57A 4RU2A 3OVAA 3T5HA 2X3GA 5EUHA 1TL7B 2DHHA 1RT7A 2DO4A 1BMQB 2JC0A 2VD3A 3BQ0A 1RWMB 2HIYA 3SZ2A 4LRBA 1VQOS 4FS1A 2DH8A 2AYEA 4ELUA 2DGVA 1Q79A 4FBTA 2XYPB 1FESA 1VC5A 4ZS6A 4PRFA 3OBIA 2BJEA 2KFYA 1VQ7S 2DGTA 1FJ7A 4DX6A 2JEGA 3DRSA 4Y0FA 2R2SA 2CJAA 4J37A 3DGPA 2IRUA 1VQ6S 1UVMA 5CHCB 4C8MA 1FERA 2UUAF 3U02A 4QR2A 2KJWA 1PJ7A 2W4CA 4USVA 4C7QA 5J1NA 3WDOA 1IQZA 1VBZA 1HNXJ 3JSRA 3N6NA 3A13A 4P2XA 2XZTB 2MSSA 1C0UA 3FC9A 3MM8B 2V2QA 4MIBA 4C0OC 3PW5A 1Q81T 3CT9A 2DH9A 5HMXA 3A3PB 5K8MA 1XC9A 7FD1A 3PO5A 1VQPS 1S48A 3VGUA 4CH7A 4B9NA 2HBYB 2MKKA 3IO1A 3Q2SC 3QMQA 4PYDA 1JLCB 1HW8A 1RTJA 1FHTA 3I0RB 3B4DA 4Q2MA 1N4LA 5DG8A 1N6QB 1SC1B 5F8GA 3TUIC 3MEDB 5KFKA 4NCBA 1VFJA 1WG5A 3NS6A 3HMJG 5HL7Q 3KJVB 4C0HA 2KB2A 4CO1A 3H0PA 2HFSA 4RZRA 1UVIA 2H5EA 3DNCA 2J6SA 3G8SA 5FLXU 4MAKA 4NLDA 2C2ZB 3W2VB 2YKMB 3THTA 4AXJA 3TEHB 5A8WA 4XO0A 1RAJA 3ILOA 1S76D 3THPA 1UWBA 3B82A 5DG9A 3NGTA 3CCSS 4ECVA 1HWIA 1TL3A 4FVCA 5KT3A 2EK6A 4HH0A 4BLGA 3MMAB 4CH0S 4QYZJ 2IA6A 2GX8A 3TOQA 1N32J 1FXLA 2W2NP 4ED5A 4WWSA 1WEYA 2VPYB 5CYQA 2XLIA 1Q8LA 1S6UA 4TQRA 1ZTWA 3OUYA 1RTHB 2BA9A 3FQLA 2VV5A 2QMUB 4ICLA 1MW7A 4TKTA 5HQLA 2XO6A 4EBEA 2UUBF 3TUPA 2LQJA 2OKQA 4LF2A 1B0VA 2W01A 3FK4A 2HQIA 2QO3A 2AX1A 2YXLA 4P6QA 5THWA 1QAIA 3M8SA 4ECZA 2DO0A 1S7IA 1PG5B 3IG1A 4AL5A 2L48A 1R0BG 2R7VA 3DGVA 3QWUA 4LF5F 1PYSB 1A0OB 3N79A 4NMXA 2XMVA 2LEPA 2HNYA 1BD6A 2XSFA 3CF5Q 1VRUA 3ZZYA 4PXDA 3C6TB 5H9FJ 2CQ0A 3QBCA 3M7VA 4USJC 4M5DB 4WTOB 1TL7A 1HA1A 3ZZUA 1X4GA 1ZBTA 1UEUA 1S9FA 2HEKA 5K9FA 3KHHA 1IKXA 2VHGA 2HSEB 2VA2A 1WOPA 5MLCV 2CPEA 2UXDF 4A46A 2JEJA 3T1YF 2B7CB 1U2CA 2IM3A 4M5KA 2R8HA 2AYBA 2HK3A 1NHVA 2HIQA 3H7HB 4GVLA 4U7CA 3PIOQ 3GIMA 4B3OA 2H9ZA 1B3TA 1FVQA 3J7YI 1JMTA 2KXFA 1YWXA 4KV8A 4OX8A 1RWXB 2G2OA 3T9NA 1VBYA 3PX6A 3BV8A 4F0KA 1U02A 4AL7A 1XJWB 4JI2F 2XGPA 1RT2B 4OV6A 4HKQA 1S97A 4ES1A 2RVJA 5JVGQ 4DS5A 3GSDA 4CQ1A 1IBLF 1SH2A 2PMZD 1RSCA 5IV4A 3BO2A 1CJUB 4N8NA 3BBFA 3OR1B 4ANDA 3Q8UA 3EZ5A 2YWWA 3AHPA 5EX3A 3W3SA 4CO5A 3MM9A 4N77A 1ZOTA 4DU7A 3MEEB 2PA3A 5F3TA 5IC4B 4F25A 5IM0B 4IRKA 4QYZK 4YB5A 2J9CA 5D8HB 2DXFA 1KNZA 2EXUA 3NOCA 2FY1A 4OYBA 2ZH5A 2L08A 1TKXA 3L95X 5A0YA 1NO8A 1S6OA 3UDCA 3VAJA 3M4XA 3W8PA 1HNVA 2IPOB 3TR5A 1NK9A 4X4VA 2WVCA 1WC0A 4X64J 1GQEA 1IBKF 5CCLA 2XNRA 2KH9A 4P72A 4DX8H 1TFWA 2H65B 3UCZP 3GV5B 3EPGA 1F6TA 3FBEA 2BABA 3TP2A 4RU9A 3CJTA 4DPXA 5HMZA 2QFIA 2OI2A 4ER8A 2LKZA 3V6DB 4K50A 4QJVA 4KY3A 3DOMB 3LAMA 2F1FA 4GKJJ 1LXNA 3CO0P 1MWYA 3SQGA 4YHHF 3MCMA 3R3TA 3R2CJ 1X9MA 3AA9A 5F8NA 1UFLA 1U1KA 3P6YC 2PC6A 1V5IB 3LP0B 4UUXA 2B9YA 2KXNB 3I55S 3A4TA 4OJGA 3OFGA 4M5DA 5A8RB 5CAAA 1RT4A 5AXLA 2ZH9A 3Q0AA 1AYEA 3QLHA 4LRAA 1QSSA 1AROP 2H48B 5KG1A 5J2PA 1L3TA 1PSDA 1KD1T 3EZUA 3T5JA 1FRLA 3EGZA 1FI4A 1F60B 4TY8B 5F8HA 2W9CB 1HQUA 2UUBJ 2HGNA 2E66A 2AJQA 1S4EA 2LU2A 1X4EA 1RT6B 5KFIA 3WBZA 4NEZA 3ZNUA 1NKEA 3WX8A 1I6JA 4DEZA 1JXVA 2EPIA 2M2BA 3BKFA 2G0IA 3DYAB 3G82B 4L72B 1U1OA 3IRXA 4KR0B 3TVKA 3VTIA 2AGQA 1XNQF 4DV6J 4DR3J 3QGPA 1FEEA 1N33F 1YRTA 5RUBA 1S0VA 1CPZA 2BYCA 2KRBA 3F0NA 4ZDNA 1TVRB 1O0PA 5B7WA 3RAXA 5HLFB 1K73T 1RLDA 2FJWA 2XMMA 2CPYA 2XHWA 5BYRA 1WKLA 1Y9OA 2EG1A 6FD1A 4RR5A 1WTFA 3TNVA 4Q45A 2ZH2A 1WJ9A 1Y5IB 4B3TF 1UVLA 1S9GB 2ZZNA 2MXYA 1N5SA 2XBPA 2PO4A 3D3CJ 1TUWA 4R25A 2HRTA 4UTGA 3HHKA 1JJCB 3BH7B 4GMKA 3PXGa 4PG7A 1QJHA 1NLKL 3ETOA 3QLHB 1IR0A 1FKPB 2DNHA 4YDDB 3CCQS 3TANA 2VB6A 1HYSA 3M2RB 3C8YA 3LP1A 2FQQB 4NZ7A 1LW2B 4IO9Q 2HS4A 4YDXA 4RNFA 1APSA 3OFFA 4HACB 3KLHA 1G1XA 3TX8A 5SUHA 1IM4A 2WW4A 4PWUA 4RBVA 4J9RA 1O5JA 4JI8J 1S5ZA 1HL6A 3ENVA 5LT5A 2E5IA 3LWLA 1T3NA 4JI7J 4PXEA 5KFEA 1URNA 1UVJA 4CM0A 4DCOB 2HG4A 2WONB 1UJ4A 4NASA 3O5TB 2V9KA 4C6AA 3VAIA 4A8QA 2H4WB 4KFBB 3PO4A 4OL8A 1W25A 2AV5A 2R7UA 2XTJP 3UDEA 2MHEA 2YWFA 3FSYA 3PVXA 4QIVA 2A3JA 4NA2A 1TTHB 3KG1A 4QIWD 3AH6A 4ZVSB 4FS2A 4DF8A 3V6DA 3NGRA 5KFDA 5K8NA 3TZZA 3AQOA 2VA3A 1DLOA 3CJSA 2WVEA 3W5YA 3ISNC 1WD6A 1CC7A 3M8QA 2HQDA 1B0TA 1MMNA 3VAKA 1LWEB 2AP6A 1NU4A 4HT7A 4NA3A 2EFQA 4F67A 2ACMA 2YNFA 3I4HX 2CZVC 2LXFA 1PBUA 3I5BA 5EX0A 4DPUA 2RDJA 4O0NA 5JUMA 2OTLS 5L1LA 1FNOA 2GJ2A 4UZCA 1P9YA 1Q16B 2WSCC 5HROB 4W98A 2UXBF 4F7VA 4TLQA 3CJKA 1S57A 2XI2A 5MAOA 2W9CA 2IMWP 2VOPA 3HHDA 3OR1A 1ICEB 4G1QA 1DFDA 2YNGA 4UW2A 1GMUA 1RT4B 2W9BB 4RW9B 2DR7A 1VGYA 1FD8A 1NK6A 2RU9A 3CDUA 1FXDA 3SSSA 1WHWA 3KUHA 4TY8A 1IKVA 4ZPCA 5C25A 4A8WA 1RTIB 3MPYA 5E3QA 4ZLJA 1NKCA 2P9CA 2XGQA 1VJQA 3GIJA 4J9SA 2QV6A 3GU0A 4DLEA 3GYGA 3S01A 3GV7B 2ZNYA 2DR6A 2IFXA 3MMJA 5M2PA 1JLBA 2H51B 3M9MB 3CC4S 1XNRF 3CTRA 2IAJA 3SDEA 4FBUA 2RUGA 2V2KA 4LQ9A 4I2PB 4C9DA 3BN4A 4HI2A 2VU5A 4P2SA 2DNMA 3EICA 4X4QA 2ZH3A 5KOXA 5A2QY 3P8BB 4BHQA 3CD6S 1WACA 5HSPA 1MROA 4N8OA 4NXNF 3O44A 2AT1B 4X65F 2DKOB 4ZP6A 1TK8A 3PZPA 1XNQJ 1S0OA 4QYRA 2ASYA 2R2TA 2K7JA 3AODA 5B0FA 3KUEA 4LFAJ 1Q1KA 4C11A 1S9GA 2C2KB 4X4TA 4R5PA 2LXUA 4WCEQ 2YBVA 1WG4A 3JS9A 2BW7A 4LF9J 2HHSA 3IA0A 4GO5X 5ETLA 5FDLA 2W9BA 2ADBA 1FKOA 2QA2A 2CJYB 5LXRA 4L3NA 3K59A 2HHHF 4N7TA 1M5PC 2BANB 3PTWA 3W2WA 3SMZA 1GX6A 3VAGA 4OHYA 3NGSA 1NXIA 1JX4A 4YY3F 1FRJA 2MQ8A 1L3SA 4M94A 3GR0A 4PPZA 3I5CA 2ZITA 4KFBA 4UQTA 5KAKA 4MK8A 4Z7YA 1RWWB 3DU6A 1CBKA 1TZ0A 1R0AA 2VG5B 1VQLS 4XAKA 2FHOB 2OEKA 4J9KA 1B64A 2ZFHA 1HI8A 3SV3A 1LK5A 1JLQB 2GVZB 8AT1B 2GVDA 1WF2A 3MM6A 2NCKL 3WX4A 5CD4A 4K0KJ 2HHPA 2MKSA 4WYLA 3G8TA 1GEHA 4DQIA 4JB8B 1U0HA 1SKUB 2Q6CA 1RTJB 3OTEA 4DR2F 3MPUB 1JLFA 2DY9A 3AOBA 4WP9A 1H0HB 3OXGA 2MKYA 1RT3B 2JH3A 4K4TA 4WZMA 1WSVA 2NUUG 2VBWA 1SV5A 4HHJA 1BE4A 1UEVA 1KFDA 1V9OA 3WIUA 4DPYA 2CPHA 2BRLA 3A8KA 3CJ2A 4U9RA 2XS7A 3GG0A 3M8QB 3OL6A 2EFPA 4JV5F 1HIYA 2DNPA 3QIPB 5KFVA 3LH2S 1PJ5A 2YNGB 5LOQA 3Q8SB 3QPIA 3Q8RB 2M4MA 3T1HF 2DR5A 1OMSA 2M5YA 2VF3A 1GXUA 1YZ6A 3QGHA 4ECYA 2RRAA 2E1MC 2GQQA 4ECQA 4NLQA 4USKA 3GILA 3NNAA 1NH7A 2R8GA 2U2FA 2FD2A 1WEZA 2HBQB 3JXOA 4H4MB 3C15B 4OHWA 2WHOA 1R0AB 5KG7A 4KHMA 4O4GB 5F0UA 1H74A 2LQBA 1JQGA 2YPZA 2Z8QA 4O4RA 2B43A 4UQGA 4WF9Q 3R1LA 3LP2B 4CTAA 2KG0A 2CJBA 2KYXA 3W7BA 1H72C 1QE1A 2O01C 4LRDA 1VIOA 3MECB 4OX6A 3UD3P 2GNKA 4NLVA 2OSRA 1T02A 3VQTA 4RNNA 4NLGA 2ZVIA 4JI2J 2AD9A 1RKJA 1EAYC 2E1PA 4I6YA 1I94F 3C6TA 4A8XA 5KG3A 4P7TA 2VQEF 4DL2A 3I0RA 2P8IA 3B8HA 1ZA2B 3PNIA 3AA8A 3I9ZA 2SXLA 1OWXA 2RDDA 3IP0A 4J9OA 4DR6J 5FD1A 2YH1A 2O3DA 4NLYA 2Y1LB 3QIPA 4QIEA 4DR2J 3BSOA 5L1JA 3HF5A 4QW9A 1FK9A 2BM1A 4OI2A 5IQQA 1WNEA 2YNIB 2JWNA 1JLEA 3PW2A 5IWAJ 3KLGB 1SC6A 1FRKA 1UWBB 4D3HA 4ZVRB 1NDCA 4ELVA 1NB2A 3GFZA 4CO3A 1KLMB 4CH1A 4X4NA 4DSLA 1R89A 3I32A 1C1BA 1VQYA 5D0HA 2G13A 1S0NA 4B3RF 1C2PA 3HHNB 1RE1B 3EE3A 1Q4RA 2Z4PA 3K2YA 4RLEA 2FJXA 2FTRA 2NYHA 3J81Y 4DV4F 2XMWA 3UN5A 4NZ0A 4A4JA 3K5PA 4WU3A 1EJ7L 4ZVQB 4ZCIA 1RB0A 1WC4A 3AJDA 2V8HA 4EK2A 1WUUA 4OMFG 5B0BA 2W9AA 5D6GA 3SQOP 2C2EA 2GC8A 1XMOF 1NJXA 1N54B 1RABB 2C22A 4I4BA 1F2GA 5KT7A 3O8WA 3PHEA 1J2VA 5A8KA 5ITHA 4DSIA 1DARA 2JX2A 3DXBA 1FRXA 1MWZA 4HT5A 3NBPB 2VFSA 1H7WA 1C4CA 1UL3A 2BE9B 2DNLA 1F5CA 2C2DA 2DH7A 3PJ9A 4DJBA 2BQUA 4X65J 2A18A 3PYFA 3IR5B 5GMDA 2RJZA 4F4XA 2JJ4D 1HR0F 1S0MA 3MFIA 3UE2A 1OPIA 2IYGA 2XSJB 2YWHA 3KLFB 1K8AT 3H42A 4RBUA 3F44A 4DV0F 1S6QA 2VL1A 3OQ2A 5FLXY 1CLFA 2PMHA 3K7RA 4X4UA 2E5GA 4ZVGA 2XCAA 4ID5A 4UT4A 2J8SA 1T0TV 4A8MP 4MKYA 2M0GB 1R7IA 4LBPA 3RW7A 2GGPA 4Y65A 2XO7A 1AFJA 2KM8B 5I3UA 2IBKA 2VG7A 1S72S 4C11B 3SCIE 5EWGA 2C28A 4BC9A 2F40A 2RD5C 4OZ1A 4WKYA 6FDRA 4E98A 2GCFA 4P52A 2KVQE 2CQHA 3MEKA 4Q7AA 1FKOB 4RNOA 2E9ZA 3LANA 2KM8C 2HAFA 4ED7A 2RRNA 1Q7LB 4UF4A 5T14A 3PJXA 2FVRA 3SCKE 3M8YA 2NZCA 3D5MA 1S7HA 4O3PA 4GC6A 3DDIA 3CCMS 3PG9A 2CQ4A 2J5AA 2YY3A 2PMWA 4O4GA 4URGA 5IT0A 2OO4A 4TU7A 4ED0A 4X2BA 3LGHA 5E41A 1UW9A 2RF2B 4KT0C 4IDKA 1RI7A 4M1KA 1QVGR 3OFEA 3QJPA 4LF8F 5IM0A 5GVQA 3DRPA 5EHHA 3CCZA 4FNIA 4OZ0A 2MKHA 3KDOA 5DRKA 4DUTA 1L3VA 2GHPA 3MURP 3G6ES 1HBNA 3FFIA 4DUZF 4G3IA 1OO0B 4YEAA 1OPZA 3MI7X 2Z2ZA 2WVFA 5KFLA 1JLFB 1T9YA 1DRZA 4I56A 2VQFF 3T41A 3ZZTA 1VRUB 2RHQB 4JI6J 2IC3A 4JI6F 3EGNA 1IJEB 1D3WA 2FYXA
chains in the Genus database with same CATH topology
1U2FA 3DXSX 3ZFVA 4DG1B 1Q8BA 2RRBA 4BBYA 4YQWA 4DFKA 2DR8A 3TW0A 1F5BA 3H40A 2Y1JA 1YJVA 3HVTB 1VQ5S 3CJ3A 2VG6B 2FHMA 3GFHA 2DT9A 1FJEB 1SUQA 1Q82T 2HFZA 3GQCA 4LUBA 4I69A 5F0WA 1QUPA 1AXQA 2GIRA 4LT6A 4KSEB 4J9PA 1Q7YT 3F56A 5LSRA 1VBXA 3IWNC 3L7PA 1NEEA 1X8DA 4X64F 4KB7A 3AB2B 3LP1B 2AJ0A 3AJ2A 2JLEA 1F5AA 2DHAA 1T3OA 2M9KA 1U6ZA 5B0EA 3IGVA 3PFOA 5J1PA 4F4WA 1N48A 3VQSA 1XBWA 3M8RA 3T6BA 1S4FA 5KTQA 1P9QC 1TP7A 3HVAA 4PUOB 1WG1A 1VMBA 2B6AA 3FEYB 2A2DA 2B9WA 3IGNA 3MMAA 2XWXA 3ZZOA 4EO6A 1O51A 2AU0A 1MNEA 2OJ3A 2F9JA 1WELA 4K5SA 2OPSA 2M8DB 1H2TZ 3DC2A 2COLA 4QWCA 2HFOA 2JZ5A 2ZE2B 4YB1P 3AJ1A 2OD6A 3QO9B 1OSDA 2CZ4A 2KHDA 3DRSB 3NCPA 4B02A 2XC9A 2X1AA 3HXMA 4DV7F 3WC2A 3PX4A 3BB5A 4WFXA 1A7GE 2Z0GA 4NLOA 5BYQA 2FC9A 4PG6A 1LFWA 2YKNA 3CIMA 5LXYA 4X4RA 4M95A 4JI8F 4JV0A 1OS5A 4DMZA 1KOOA 3FZ2A 5A8KB 2B4UA 2GW8A 4E8UA 4B3TF 4IKAA 2VFVA 4CIOA 1X9SA 3UQSA 2GQCA 4YR0A 3RYLA 4HLBA 3G6XA 2PDAA 2HNZB 4QWEA 2J6TA 3RRHA 4R0JA 1T05A 1CSJA 5AXMA 1VRTA 4HVZA 2B3TB 4MYTA 2FIUA 3QZ8A 4OL8A 3GFXA 2MQNA 4Y2CA 3BR9A 5G0RB 1ELOA 3FRZA 1LWFB 2EFNA 2LQ5A 2UU9F 1X0FA 4F3OA 4DFPA 4A48A 5C42B 2NS1B 1KR4A 1FXRA 2UUWA 3DOKB 3MUVP 4WTYA 5U47A 3HHLD 3TA0A 2MY8A 2ZNZA 5I4MA 3POTA 1V6HA 4I64A 3MD3A 2JRSA 2CFXA 1LXJA 2BRKA 2ZC4A 3MM9B 3KK3A 1ZAXA 2FJBB 2EFVA 2ZVSA 3DRYA 3SXLA 3NNCA 3L7OA 1U1RA 2HMIA 3R5CA 3HM9A 4IH7A 1K9MT 1T94A 3BJYA 1BQNA 5BR8F 4O3RA 1FDBA 2ZOMA 3LGNA 4NYOA 5G0RA 3UNGC 5GADU 2BVZA 2ZBCA 1WI8A 3MFHA 3JSMB 5KG2A 4MMOA 4EYHB 4LF6F 2RSQA 5JJBA 2ZOGA 1BQXA 2C3UA 5GAEU 3H2VE 2RIJA 4B3MF 2M70A 5EGYA 1HBMB 1HWJA 1M0SA 2HLUA 4NLPA 3W2VA 3H5XA 1IKWB 1FNXH 3G6YA 3BN7A 3CJ4A 2CVEA 1WI6A 1E6VA 3MWBA 5DO2A 1SUQB 4Q44A 2APOA 2IJFA 4KV8B 5IT9Y 4YUDA 3KK3B 2M7SA 3SSQA 2DNNA 1K1SA 2ZH1A 1DLOB 3LP0A 1ZM2A 2AGPA 4IG0A 1M5KC 2ZUGA 3E8OA 3CD0A 4DUYF 2XMUA 1S6PA 3D1HA 2BE2A 1ZAVA 2ZDPA 4KE5A 4QR1A 5BYSA 4C8KA 4FXDA 3DI6A 4XPCA 5EN1A 1P6TA 1TKXB 4DFMA 5B09A 2XLKA 1YIJS 4MFBA 3TAMB 1X4BA 3QWPA 2DCLA 4LJMA 5ADZA 3G96A 3Q8QB 3IN5A 3BGRB 1WF0A 2KVIA 4NLXA 2CPZA 1YSJA 2HAIA 4G1IA 3G86A 2K1RA 4OZNA 2I0XA 1HNWF 1NJZA 4RW7B 4ZPVR 5GMKa 1C0TA 2YKPA 1FA0A 5HN0A 3R1HA 3VAMA 2AW0A 3BSNA 3KLIA 5F41A 4KGMA 3S8SA 2J9DE 4Y2IA 3MOJB 3DDKA 3Q22A 3IAM9 1GTEA 3RB0A 1BLUA 3M9OB 4RW6B 3ZZRA 2B4OA 2AJQA 3NLCA 3OVSA 1BY9A 2L9DA 4J9QA 2E7XA 5KG6A 4Y2MA 1A9NB 3QZ7A 1U26A 4EU0A 3TO8A 4R8UB 2HVIA 1H38A 4HDGA 1SB6A 4Y00A 5AXNA 1WHYA 5I3PA 2MZRA 1RP5A 2DGWA 1OQ3A 5L1IA 1RT6A 2EI5A 2MPUA 2D41A 2RE1A 2VASA 3CCWA 2I5JA 2HHQA 3M6XA 4X84A 2KYZA 1X5OA 1GXLA 3TA1A 3MR5A 2IM1A 1W2BR 1JJ2R 3NGKA 3OFHA 2N7CA 4EBDA 2A10A 1HQUB 4IR1A 2OPRB 1P8GA 3RBEA 2OLWA 1ZM9A 2D9OA 1TAUA 1YVFA 1ZAWA 1U6BA 4QW8A 4NWBA 2MQLA 4Y2KA 2E44A 1JNZB 3I4PA 2IRYA 5E2QA 4EWTA 2WW8A 1ZETA 2R8IA 3HKZD 1LWCB 4PG5A 1RT5B 2X1BA 2QIFA 2DISA 2ATLA 1TVRA 2QEXS 2R8KA 1FK9B 3CCLS 2J0SD 3H5SA 4NX9A 4K4ZA 1X9WA 2VBYA 4WJBA 1YBAA 3QAEA 4ZPDA 4LMZA 3Q8PB 2W4DA 1U7LA 1E6YB 1Y00A 3POTB 4RWXA 4TLRA 1HNIA 3RRKA 2M52A 5M2UA 1U2RA 4OZLA 1DBDA 4DL0C 1Q86T 4NCAA 1JXLA 4F3QA 2XS5A 2PIIA 3BR8A 3LW5C 1YITS 1R6YA 2Y1IA 3SCJE 2BUNA 3NRBA 3M6WA 4OJ1A 4ZPTR 4MFBB 3TAMA 5F3ZA 5C24B 3VWSA 4B9TA 1RT1B 1SIZA 5DG7A 1JLBB 2NPIA 3KJVA 2XB2D 4CT9A 4ES2A 3UPFA 4K2XA 2ASLA 4WZQA 4KQZA 1ZM3A 3DRPB 4C98A 2OFHX 3OJSA 3OTCA 4Q8FA 5KFNA 4F02A 3P49B 1MROB 1UJ5A 1UVNA 2Z2LA 2V8DA 3BO4A 3M2VA 2V5HG 4J9MA 3UWTA 1DTTA 3EX7B 3M2UA 2R7WA 1K0TA 3BSCA 1CQMA 1U45A 3C2PA 4J5OA 3DOLB 4ERDA 1PO6A 1REVA 5F8JA 2V9WA 1WF1A 2YKMA 2XWYA 3TRGA 3DLEB 1NK0A 4I2QB 1HWUA 4RW8A 4A8SA 2CQPA 3O3LA 3OR2A 1VC6A 4F4KA 4HTIA 2MDAA 4RUHA 5DETA 2LECA 4AXIA 2QMXA 1RISA 1X5SA 5HROA 1R8HA 2AF6A 2DRAA 1U8SA 4OI3A 5KFTA 1G3OA 2JEIA 5HMYA 3SI8A 2NZ4A 2NLWA 4ZPBA 5I42B 4B08A 2P9EA 3K5LA 4IQMA 2VUGA 2CDQA 1M1KT 1X4AA 2DHSA 1I1GA 2DNKA 1KQFB 4QBUA 1S0MA 4KC5A 3UR3C 2WONA 5EWEA 2FC8A 4DQQA 1RT5A 2IYIA 4NMLA 1S1TA 5HBMB 1U24A 3LO3A 2ZH6A 2W8KA 3M2UB 3MR2A 2WRMA 3DHXA 1MMLA 1HFEL 4AYBD 3MAQA 3MEGA 5CQGA 3HK2A 2DPIA 4LF9F 4OZJA 3DLKA 4FF4A 4HI1A 1U25A 4NL5A 3OTDA 2FHKA 1HPZB 3V6HA 3JB9k 3LOUA 5D78A 5AJ3F 3D1QA 3CIZA 3DRRB 1VI7A 2R4FA 3QAUA 5DDQC 1W2IA 2RB7A 4FZVA 4C8ZA 1HNIB 5B0DA 2DITA 4N41A 3EPIA 2CQGA 1Y5LB 3V2UC 5I3UB 2Q66A 3W2WB 2KTQA 4ECTA 1HMVB 3JTOA 3PEHA 4QPTA 2MKIA 3MM6B 3DCAA 5DDOC 2VONA 5L9NA 3MDFA 4AE5A 3DMJB 1PILA 3OTBA 3KLEB 2DNQA 1S1XA 1SJ3P 2ZDOA 1T03A 4ECRA 5F9NA 1X0PA 1FVSA 5GAHU 4K0KF 3X1LB 3M8PA 1KSPA 2JDJA 1L3KA 2MKCA 3R27A 1JWWA 3GYNA 3HP6A 1P1TA 3I0SB 1VLYA 2JVRA 3MPVA 3PFEA 2W7PA 4EEYA 4PKDB 5KFHA 1HNXF 5GAGI 3CCTA 1VJWA 4KKOA 4IFVB 4ZA1A 3KK1B 2RU3A 4K4XA 2FJEB 4WIIA 4B3OB 1Q8IA 2OAUA 3V4IB 4Y2AA 2VBZA 2PE8A 3C3LA 3CJ0A 4R5PB