2MKRA

Structural characterization of a complex between the acidic transactivation domain of ebna2 and the tfb1/p62 subunit of tfiih.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
115
structure length
115
Chain Sequence
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II transcription factor B subunit 1
publication title Structural and Functional Characterization of a Complex between the Acidic Transactivation Domain of EBNA2 and the Tfb1/p62 Subunit of TFIIH.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Viral protein/transcription
total genus 17
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08567 PH_TFIIH TFIIH p62 subunit, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2mkrA00
3SV1A 1SHCA 2VRWB 5D3XA 4HB2B 3PVWA 1SGHA 4DX8A 1V5PA 3KSYA 4HAVB 3GYPA 2Z0OA 3HK0A 5L81A 5D27A 2COAA 1I7AA 3NSUA 4ZRIA 3DXCA 2D9ZA 4HB3B 2EMTA 2OTXA 1MKEA 4B6HA 4HATB 2RGNB 4HB4B 4MT7A 3PG7A 2EMSA 1N3HA 2GJYA 4HAZB 3WA0A 1Q67A 1MIXA 2DKQA 1V88A 4BBKA 5HE0A 4XWXA 1H4RA 3DXDA 4KHBB 2P0DA 5J3TA 4L6EA 2ROVA 1X1GA 5J3QA 2FJLA 2IYBA 1DYNA 1TJ6A 1LW3A 1EF1A 3CIKA 1UNPA 1GC6A 4C0AA 5C5BB 4EJNA 1Y19B 2Z0PA 1DDVA 2P0FA 2BCJA 5FI0A 1AQCA 1U5FA 4IAPA 5DHFB 5JHHA 3HW2B 4GMXB 4HDOA 2LKOA 5JP4A 1W1GA 1EVHA 1DDMA 2GCJA 2LYDA 1X11A 4ZRKA 5DIFB 3VOQA 3G9WA 1EAZA 4KHOA 2ELBA 2K00A 3PSCA 2RLOA 3ULCA 1V89A 3A8QA 1WGQA 3TO1A 3BJIA 2KGXB 3PEGA 2DFKA 1Z87A 2NMBA 3VIAA 3KY9A 1NTVA 1U29A 2YSZA 2JP2A 2YS3A 4GN1A 2CAYA 1M7RA 3PVLA 3SNHA 1RJ2A 4MY6A 2LULA 2COFA 2ELAA 5C6RA 2YT0A 1TXDA 2ADZA 1U5EA 3D8FA 1E5WA 1FB8A 2DHJA 2D9XA 1BWNA 1AWEA 5HE2A 2MWNB 3U7DA 3TW1A 1BTNA 2J0JA 5KQ4A 2DX1A 1V61A 4HAYB 2AEHA 2YF0A 1W1HA 1Y5OA 1IRSA 1V5MA 2YS1A 3U8ZA 2D2QA 2DHIA 1U5GA 5D3YA 1LB1A 5EFXA 2G35A 1TQZA 3OANA 4TYZA 5C79A 4CHMA 1X05A 2YVCA 3SUZA 2R0DA 3X23A 3PP2A 2H7EA 4A6HA 1MIZB 2Z0QA 3IVFA 1MAIA 4NY0A 4F7HA 1UPQA 3PVUA 3AU5A 1KI1B 1QQGA 4CYEA 2N23A 2ROZB 5KCVA 1XD4A 4HAXB 3A98B 4KVGB 4F7UP 2Q13A 2MKRA 1WVHA 2CRFA 2D9VA 4K81A 2DKPA 3TCAA 2LOZA 1MK9B 1P6SA 5CLLB 1M7EA 2J59M 3KZ1A 1MK7B 2M14A 4F7GA 5J3YA 1WJ1A 3F5RA 4MK0A 4H8SA 1DDWA 2OQBA 2RVBB 3FSSA 3QIJA 5LOPB 3ODXA 3AU4A 1ZM0A 3P6AA 2YRYA 2CY5A 2QKLA 1QC6A 5JLJB 1UNRA 3PZDA 3FEHA 1U2BA 4EMOA 1NTYA 1WJMA 5DHAB 3ODWA 2Y8GA 1FGZA 4Y94A 3DXEA 3TFMA 2PZ1A 4KAXB 4KHAA 4WJ7A 2LG1A 2I5FA 2M38A 2DHKA 4NSWA 3SYXA 3ULBA 4K2PA 4PQ0A 2P8VA 2AL6A 3M1IB 1ZC4B 4D0NB 3P7ZA 2Y8FA 3GYOA 1K5GB 2J0MA 3F0WA 1FHOA 4PNKA 2L2IA 2L1CA 2MFQA 3ODOA 2GCLA 1FHWA 2GS0A 3LJUX 2D10A 2DYNA 1ISNA 4K17A 2EC1A 3A8PA 3MDBC 1XR0B 3ZVRA 1J0WA 1OMWA 4WVFB 1H10A 4TKNA 1UNQA 5D3VA 3O96A 1MPHA 3T06A 2RNRB 4HB0B 3WYFB 3UZTA 1PMSA 1WI1A 2IFSA 3CXBB 1W1DA 1NU2A 2DX5A 4IFSA 4A6KA 2KUPA 3D8EA 3QWMA 2Y7BA 4DX90 2CODA 4YONA 2HE7A 3QBVB 2E2XA 4EKUA 4ZRJA 2EJ8A 4Z2NA 1XX0A 4HAUB 1DROA 2COCA 3MPXA 2DA0A 2QKMA 5CLQB 1GG3A 2D9WA 1OQNA 3KRWA 4A6FA 1FAOA 2HTHB 2P0HA 1OY2A 2W2WA 1DBHA 1KZ7A 2LOXA 3AJ4A 2X18A 1I2HA 1BTKA 2NZ8B 4GMVA 4CHJA 2DYQA 5KQ1A 4DXAB 3V5WA 2V76A 5JHGA 5DH9B 1PLSA 2H7DA 2DLWA 3BINA 1P3RA 2MDXA 1FHXA 1V5UA 5D3WA 2VKIA 1J19A 2D11A 3ZDTA 2W2XD 1WG7A 4HAWB 4Z2MB 2I1JA 2D4QA 5C16A 3TVVA 1FGYA 4HDQA 2K2UA 2UZSA 1XODA 4YL8A 3ML4A 1ZC3B 4HHVA 4K2OA 2K2JA 3HQCA 1BAKA 1XKEA 5C5BA 1UEFA 1KZGA 5HE1A 1NI2A 1B55A 2ZPYA 5LONB 1XCGA 4GPTB 2YS5A 1FOEA 1U5DA 3KRXA 2I5CA 4A5KA 2YT1A 1ZVRA 2RUKB 2DTCA 2XQNM 3D8DA 5GOWB 1UPRA 1K5DB 2J0KA 2W2XC 1X86A 4WSFA 1X1FA 1ZSQA 2N0YA 2CY4A 1RRPB 2KCJA 4DBBA 4GXBA 2D9YA 3N7CA 2R09A 3RCPA 3SO6A 4P7IA 4IOYX 1GC7A 2UZRA 1U27A 5FI1A 5HE3A 2RSGA 5DI9B 4GZUA 3FM8C 2I1KA 4A6FB 1WGUA 1PFJA 2DN6A 2VSZA 2UVMA 1EGXA 1P5TA
chains in the Genus database with same CATH superfamily
2KIEA 3A58A 3SV1A 1SHCA 2VRWB 5D3XA 4HB2B 3PVWA 1SGHA 4DX8A 1V5PA 3KSYA 2FJUB 3GYPA 2Z0OA 4HAVB 3HK0A 5L81A 5D27A 2COAA 1I7AA 3NSUA 4ZRIA 3DXCA 2D9ZA 4HB3B 2EMTA 2OTXA 1MKEA 4B6HA 4HATB 4QJ4B 2RGNB 4HB4B 4MT7A 3PG7A 2EMSA 1N3HA 2GJYA 4GNKB 4HAZB 3WA0A 1Q67A 1MIXA 2DKQA 1V88A 4BBKA 5HE0A 4XWXA 1H4RA 3DXDA 4KHBB 2P0DA 5J3TA 4L6EA 2ROVA 1X1GA 5J3QA 2FJLA 1ZYIA 4QXAB 2IYBA 1DYNA 2Z59A 1TJ6A 1LW3A 1EF1A 3CIKA 1UNPA 1GC6A 4C0AA 5C5BB 4EJNA 1Y19B 2Z0PA 3FVCA 1DDVA 2P0FA 2BCJA 5FI0A 1AQCA 1U5FA 4IAPA 5DHFB 5JHHA 3HW2B 4GMXB 4HSIA 4HDOA 2LKOA 5JP4A 1W1GA 2Z4DA 1EVHA 1DDMA 2GCJA 4OSNA 2KR0A 2LYDA 1X11A 4ZRKA 3DCXA 5DIFB 3VOQA 3G9WA 1EAZA 2KIGA 4KHOA 2ELBA 2K00A 3PSCA 2RLOA 3ULCA 1V89A 3A8QA 1MI1A 1WGQA 3TO1A 3BJIA 2KGXB 3PEGA 2DFKA 1Z87A 2NMBA 3VIAA 3KY9A 1NTVA 1U29A 3HSAA 2YSZA 2JP2A 2YS3A 4GN1A 2CAYA 1M7RA 3PVLA 3SNHA 1RJ2A 4MY6A 2LULA 2COFA 2ELAA 5C6RA 2YT0A 1TXDA 2ADZA 1U5EA 3B77A 3D8FA 1E5WA 1FB8A 2DHJA 2D9XA 1BWNA 1AWEA 5HE2A 2MWNB 3U7DA 3TW1A 1BTNA 2J0JA 5KQ4A 2DX1A 1V61A 4HAYB 2AEHA 2YF0A 1W1HA 1Y5OA 2YT2A 1IRSA 1V5MA 2YS1A 3U8ZA 2D2QA 5LG4B 2DHIA 1U5GA 5D3YA 1LB1A 5EFXA 2G35A 1TQZA 3OANA 2KUQA 4TYZA 5C79A 2NBVA 4CHMA 1X05A 2YVCA 3SUZA 2R0DA 1T77A 3X23A 3PP2A 2H7EA 4A6HA 1MIZB 2Z0QA 3IVFA 1MAIA 4NY0A 4F7HA 1UPQA 3PVUA 3AU5A 1KI1B 1QQGA 4CYEA 2N23A 2ROZB 5KCVA 1XD4A 4HAXB 3A98B 4KVGB 4F7UP 2Q13A 2MKRA 1WVHA 2CRFA 2D9VA 2K8EA 4K81A 2DKPA 3TCAA 2LOZA 1MK9B 1P6SA 5CLLB 1M7EA 2J59M 3KZ1A 1MK7B 2M14A 4F7GA 5J3YA 1WJ1A 5IRSA 3F5RA 3NW8A 4MK0A 4H8SA 4QJ5B 1DDWA 2OQBA 2RVBB 3FSSA 3QIJA 5LOPB 3ODXA 5M4YB 3AU4A 3OHMB 1ZM0A 3P6AA 2YRYA 2CY5A 2QKLA 1QC6A 5JLJB 1UNRA 3PZDA 3FEHA 1U2BA 4EMOA 1NTYA 1WJMA 5DHAB 3ODWA 2Y8GA 1FGZA 4Y94A 3DXEA 3TFMA 2PZ1A 4KAXB 4KHAA 4D6WA 4WJ7A 2LG1A 2I5FA 2M38A 2DHKA 4NSWA 3SYXA 3ULBA 4K2PA 4PQ0A 2P8VA 2AL6A 3M1IB 2RRFA 1ZC4B 4D0NB 2GUMA 3P7ZA 2Y8FA 3GYOA 1K5GB 2J0MA 3F0WA 1FHOA 4PNKA 2L2IA 2L1CA 2MFQA 4OT1A 3ODOA 2GCLA 1FHWA 2GS0A 3LJUX 2D10A 2DYNA 1ISNA 4K17A 2EC1A 3A8PA 3MDBC 1XR0B 4CSQA 3ZVRA 1J0WA 1OMWA 4WVFB 1H10A 4TKNA 1UNQA 5D3VA 3O96A 5I2MA 1MPHA 3T06A 2RNRB 4HB0B 3WYFB 3UZTA 1PMSA 1WI1A 2IFSA 3CXBB 1W1DA 1NU2A 2DX5A 4IFSA 4A6KA 2KUPA 3D8EA 3QWMA 2Y7BA 4DX90 2CODA 4YONA 2HE7A 3QBVB 2E2XA 4EKUA 4ZRJA 2EJ8A 4Z2NA 1XX0A 4HAUB 1DROA 2COCA 3MPXA 2DA0A 2QKMA 5CLQB 1GG3A 2D9WA 1OQNA 3KRWA 4A6FA 1FAOA 2HTHB 3NWDA 2P0HA 1OY2A 2W2WA 1DBHA 2K49A 1KZ7A 2LOXA 3AJ4A 2X18A 1I2HA 1BTKA 2NZ8B 4GMVA 4CHJA 2DYQA 5KQ1A 4DXAB 3V5WA 2V76A 3NWAA 5JHGA 5DH9B 1PLSA 2H7DA 3HIEA 4DIXA 2DLWA 3BINA 1P3RA 2R2YA 4L1RA 2MDXA 1FHXA 1V5UA 5D3WA 2VKIA 1J19A 2D11A 3ZDTA 2W2XD 1WG7A 4HAWB 4Z2MB 2I1JA 2Z14A 4KHBA 2D4QA 5C16A 3TVVA 1FGYA 4HDQA 2K2UA 2UZSA 1XODA 2Z13A 3ML4A 4YL8A 1ZC3B 4HHVA 4K2OA 2K2JA 3HQCA 1BAKA 1XKEA 5C5BA 1UEFA 1KZGA 5HE1A 1NI2A 1B55A 2ZPYA 4QJ3B 5LONB 1XCGA 4GPTB 2YS5A 3U12A 1FOEA 1U5DA 3KRXA 2I5CA 4A5KA 2YT1A 1ZVRA 2RUKB 2DTCA 2XQNM 3D8DA 5GOWB 2ZKMX 1UPRA 1K5DB 2J0KA 2W2XC 1X86A 4WSFA 1X1FA 1ZSQA 2N0YA 2CY4A 5I2SA 1RRPB 2KCJA 4DBBA 4GXBA 2D9YA 3N7CA 2R09A 4GOUA 3RCPA 3SO6A 4P7IA 4IOYX 1GC7A 2UZRA 1U27A 5FI1A 5HE3A 2RSGA 5DI9B 4GZUA 3FM8C 2I1KA 4A6FB 1WGUA 3NWFA 1PFJA 2DN6A 2VSZA 2UVMA 1EGXA 1P5TA
chains in the Genus database with same CATH topology
3SV1A 1SHCA 2VRWB 5D3XA 4HB2B 3PVWA 1SGHA 4DX8A 1V5PA 3KSYA 4HAVB 3GYPA 2Z0OA 3HK0A 5L81A 5D27A 2COAA 1I7AA 3NSUA 4ZRIA 3DXCA 2D9ZA 4HB3B 2EMTA 2OTXA 1MKEA 4B6HA 4HATB 2RGNB 4HB4B 4MT7A 3PG7A 2EMSA 1N3HA 2GJYA 4HAZB 3WA0A 1Q67A 1MIXA 2DKQA 1V88A 4BBKA 5HE0A 4XWXA 1H4RA 3DXDA 4KHBB 2P0DA 5J3TA 4L6EA 2ROVA 1X1GA 5J3QA 2FJLA 2IYBA 1DYNA 1TJ6A 1LW3A 1EF1A 3CIKA 1UNPA 1GC6A 4C0AA 5C5BB 4EJNA 1Y19B 2Z0PA 1DDVA 2P0FA 2BCJA 5FI0A 1AQCA 1U5FA 4IAPA 5DHFB 5JHHA 3HW2B 4GMXB 4HDOA 2LKOA 5JP4A 1W1GA 1EVHA 1DDMA 2GCJA 2LYDA 1X11A 4ZRKA 5DIFB 3VOQA 3G9WA 1EAZA 4KHOA 2ELBA 2K00A 3PSCA 2RLOA 3ULCA 1V89A 3A8QA 1WGQA 3TO1A 3BJIA 2KGXB 3PEGA 2DFKA 1Z87A 2NMBA 3VIAA 3KY9A 1NTVA 1U29A 2YSZA 2JP2A 2YS3A 4GN1A 2CAYA 1M7RA 3PVLA 3SNHA 1RJ2A 4MY6A 2LULA 2COFA 2ELAA 5C6RA 2YT0A 1TXDA 2ADZA 1U5EA 3D8FA 1E5WA 1FB8A 2DHJA 2D9XA 1BWNA 1AWEA 5HE2A 2MWNB 3U7DA 3TW1A 1BTNA 2J0JA 5KQ4A 2DX1A 1V61A 4HAYB 2AEHA 2YF0A 1W1HA 1Y5OA 1IRSA 1V5MA 2YS1A 3U8ZA 2D2QA 2DHIA 1U5GA 5D3YA 1LB1A 5EFXA 2G35A 1TQZA 3OANA 4TYZA 5C79A 4CHMA 1X05A 2YVCA 3SUZA 2R0DA 3X23A 3PP2A 2H7EA 4A6HA 1MIZB 2Z0QA 3IVFA 1MAIA 4NY0A 4F7HA 1UPQA 3PVUA 3AU5A 1KI1B 1QQGA 4CYEA 2N23A 2ROZB 5KCVA 1XD4A 4HAXB 3A98B 4KVGB 4F7UP 2Q13A 2MKRA 1WVHA 2CRFA 2D9VA 4K81A 2DKPA 3TCAA 2LOZA 1MK9B 1P6SA 5CLLB 1M7EA 2J59M 3KZ1A 1MK7B 2M14A 4F7GA 5J3YA 1WJ1A 3F5RA 4MK0A 4H8SA 1DDWA 2OQBA 2RVBB 3FSSA 3QIJA 5LOPB 3ODXA 3AU4A 1ZM0A 3P6AA 2YRYA 2CY5A 2QKLA 1QC6A 5JLJB 1UNRA 3PZDA 3FEHA 1U2BA 4EMOA 1NTYA 1WJMA 5DHAB 3ODWA 2Y8GA 1FGZA 4Y94A 3DXEA 3TFMA 2PZ1A 4KAXB 4KHAA 4WJ7A 2LG1A 2I5FA 2M38A 2DHKA 4NSWA 3SYXA 3ULBA 4K2PA 4PQ0A 2P8VA 2AL6A 3M1IB 1ZC4B 4D0NB 3P7ZA 2Y8FA 3GYOA 1K5GB 2J0MA 3F0WA 1FHOA 4PNKA 2L2IA 2L1CA 2MFQA 3ODOA 2GCLA 1FHWA 2GS0A 3LJUX 2D10A 2DYNA 1ISNA 4K17A 2EC1A 3A8PA 3MDBC 1XR0B 3ZVRA 1J0WA 1OMWA 4WVFB 1H10A 4TKNA 1UNQA 5D3VA 3O96A 1MPHA 3T06A 2RNRB 4HB0B 3WYFB 3UZTA 1PMSA 1WI1A 2IFSA 3CXBB 1W1DA 1NU2A 2DX5A 4IFSA 4A6KA 2KUPA 3D8EA 3QWMA 2Y7BA 4DX90 2CODA 4YONA 2HE7A 3QBVB 2E2XA 4EKUA 4ZRJA 2EJ8A 4Z2NA 1XX0A 4HAUB 1DROA 2COCA 3MPXA 2DA0A 2QKMA 5CLQB 1GG3A 2D9WA 1OQNA 3KRWA 4A6FA 1FAOA 2HTHB 2P0HA 1OY2A 2W2WA 1DBHA 1KZ7A 2LOXA 3AJ4A 2X18A 1I2HA 1BTKA 2NZ8B 4GMVA 4CHJA 2DYQA 5KQ1A 4DXAB 3V5WA 2V76A 5JHGA 5DH9B 1PLSA 2H7DA 2DLWA 3BINA 1P3RA 2MDXA 1FHXA 1V5UA 5D3WA 2VKIA 1J19A 2D11A 3ZDTA 2W2XD 1WG7A 4HAWB 4Z2MB 2I1JA 2D4QA 5C16A 3TVVA 1FGYA 4HDQA 2K2UA 2UZSA 1XODA 4YL8A 3ML4A 1ZC3B 4HHVA 4K2OA 2K2JA 3HQCA 1BAKA 1XKEA 5C5BA 1UEFA 1KZGA 5HE1A 1NI2A 1B55A 2ZPYA 5LONB 1XCGA 4GPTB 2YS5A 1FOEA 1U5DA 3KRXA 2I5CA 4A5KA 2YT1A 1ZVRA 2RUKB 2DTCA 2XQNM 3D8DA 5GOWB 1UPRA 1K5DB 2J0KA 2W2XC 1X86A 4WSFA 1X1FA 1ZSQA 2N0YA 2CY4A 1RRPB 2KCJA 4DBBA 4GXBA 2D9YA 3N7CA 2R09A 3RCPA 3SO6A 4P7IA 4IOYX 1GC7A 2UZRA 1U27A 5FI1A 5HE3A 2RSGA 5DI9B 4GZUA 3FM8C 2I1KA 4A6FB 1WGUA 1PFJA 2DN6A 2VSZA 2UVMA 1EGXA 1P5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV1 A;  1SHC A;  2VRW B;  5D3X A;  4HB2 B;  3PVW A;  1SGH A;  4DX8 A;  1V5P A;  3KSY A;  4HAV B;  3GYP A;  2Z0O A;  3HK0 A;  5L81 A;  5D27 A;  2COA A;  1I7A A;  3NSU A;  4ZRI A;  3DXC A;  2D9Z A;  4HB3 B;  2EMT A;  2OTX A;  1MKE A;  4B6H A;  4HAT B;  2RGN B;  4HB4 B;  4MT7 A;  3PG7 A;  2EMS A;  1N3H A;  2GJY A;  4HAZ B;  3WA0 A;  1Q67 A;  1MIX A;  2DKQ A;  1V88 A;  4BBK A;  5HE0 A;  4XWX A;  1H4R A;  3DXD A;  4KHB B;  2P0D A;  5J3T A;  4L6E A;  2ROV A;  1X1G A;  5J3Q A;  2FJL A;  2IYB A;  1DYN A;  1TJ6 A;  1LW3 A;  1EF1 A;  3CIK A;  1UNP A;  1GC6 A;  4C0A A;  5C5B B;  4EJN A;  1Y19 B;  2Z0P A;  1DDV A;  2P0F A;  2BCJ A;  5FI0 A;  1AQC A;  1U5F A;  4IAP A;  5DHF B;  5JHH A;  3HW2 B;  4GMX B;  4HDO A;  2LKO A;  5JP4 A;  1W1G A;  1EVH A;  1DDM A;  2GCJ A;  2LYD A;  1X11 A;  4ZRK A;  5DIF B;  3VOQ A;  3G9W A;  1EAZ A;  4KHO A;  2ELB A;  2K00 A;  3PSC A;  2RLO A;  3ULC A;  1V89 A;  3A8Q A;  1WGQ A;  3TO1 A;  3BJI A;  2KGX B;  3PEG A;  2DFK A;  1Z87 A;  2NMB A;  3VIA A;  3KY9 A;  1NTV A;  1U29 A;  2YSZ A;  2JP2 A;  2YS3 A;  4GN1 A;  2CAY A;  1M7R A;  3PVL A;  3SNH A;  1RJ2 A;  4MY6 A;  2LUL A;  2COF A;  2ELA A;  5C6R A;  2YT0 A;  1TXD A;  2ADZ A;  1U5E A;  3D8F A;  1E5W A;  1FB8 A;  2DHJ A;  2D9X A;  1BWN A;  1AWE A;  5HE2 A;  2MWN B;  3U7D A;  3TW1 A;  1BTN A;  2J0J A;  5KQ4 A;  2DX1 A;  1V61 A;  4HAY B;  2AEH A;  2YF0 A;  1W1H A;  1Y5O A;  1IRS A;  1V5M A;  2YS1 A;  3U8Z A;  2D2Q A;  2DHI A;  1U5G A;  5D3Y A;  1LB1 A;  5EFX A;  2G35 A;  1TQZ A;  3OAN A;  4TYZ A;  5C79 A;  4CHM A;  1X05 A;  2YVC A;  3SUZ A;  2R0D A;  3X23 A;  3PP2 A;  2H7E A;  4A6H A;  1MIZ B;  2Z0Q A;  3IVF A;  1MAI A;  4NY0 A;  4F7H A;  1UPQ A;  3PVU A;  3AU5 A;  1KI1 B;  1QQG A;  4CYE A;  2N23 A;  2ROZ B;  5KCV A;  1XD4 A;  4HAX B;  3A98 B;  4KVG B;  4F7U P;  2Q13 A;  2MKR A;  1WVH A;  2CRF A;  2D9V A;  4K81 A;  2DKP A;  3TCA A;  2LOZ A;  1MK9 B;  1P6S A;  5CLL B;  1M7E A;  2J59 M;  3KZ1 A;  1MK7 B;  2M14 A;  4F7G A;  5J3Y A;  1WJ1 A;  3F5R A;  4MK0 A;  4H8S A;  1DDW A;  2OQB A;  2RVB B;  3FSS A;  3QIJ A;  5LOP B;  3ODX A;  3AU4 A;  1ZM0 A;  3P6A A;  2YRY A;  2CY5 A;  2QKL A;  1QC6 A;  5JLJ B;  1UNR A;  3PZD A;  3FEH A;  1U2B A;  4EMO A;  1NTY A;  1WJM A;  5DHA B;  3ODW A;  2Y8G A;  1FGZ A;  4Y94 A;  3DXE A;  3TFM A;  2PZ1 A;  4KAX B;  4KHA A;  4WJ7 A;  2LG1 A;  2I5F A;  2M38 A;  2DHK A;  4NSW A;  3SYX A;  3ULB A;  4K2P A;  4PQ0 A;  2P8V A;  2AL6 A;  3M1I B;  1ZC4 B;  4D0N B;  3P7Z A;  2Y8F A;  3GYO A;  1K5G B;  2J0M A;  3F0W A;  1FHO A;  4PNK A;  2L2I A;  2L1C A;  2MFQ A;  3ODO A;  2GCL A;  1FHW A;  2GS0 A;  3LJU X;  2D10 A;  2DYN A;  1ISN A;  4K17 A;  2EC1 A;  3A8P A;  3MDB C;  1XR0 B;  3ZVR A;  1J0W A;  1OMW A;  4WVF B;  1H10 A;  4TKN A;  1UNQ A;  5D3V A;  3O96 A;  1MPH A;  3T06 A;  2RNR B;  4HB0 B;  3WYF B;  3UZT A;  1PMS A;  1WI1 A;  2IFS A;  3CXB B;  1W1D A;  1NU2 A;  2DX5 A;  4IFS A;  4A6K A;  2KUP A;  3D8E A;  3QWM A;  2Y7B A;  4DX9 0;  2COD A;  4YON A;  2HE7 A;  3QBV B;  2E2X A;  4EKU A;  4ZRJ A;  2EJ8 A;  4Z2N A;  1XX0 A;  4HAU B;  1DRO A;  2COC A;  3MPX A;  2DA0 A;  2QKM A;  5CLQ B;  1GG3 A;  2D9W A;  1OQN A;  3KRW A;  4A6F A;  1FAO A;  2HTH B;  2P0H A;  1OY2 A;  2W2W A;  1DBH A;  1KZ7 A;  2LOX A;  3AJ4 A;  2X18 A;  1I2H A;  1BTK A;  2NZ8 B;  4GMV A;  4CHJ A;  2DYQ A;  5KQ1 A;  4DXA B;  3V5W A;  2V76 A;  5JHG A;  5DH9 B;  1PLS A;  2H7D A;  2DLW A;  3BIN A;  1P3R A;  2MDX A;  1FHX A;  1V5U A;  5D3W A;  2VKI A;  1J19 A;  2D11 A;  3ZDT A;  2W2X D;  1WG7 A;  4HAW B;  4Z2M B;  2I1J A;  2D4Q A;  5C16 A;  3TVV A;  1FGY A;  4HDQ A;  2K2U A;  2UZS A;  1XOD A;  4YL8 A;  3ML4 A;  1ZC3 B;  4HHV A;  4K2O A;  2K2J A;  3HQC A;  1BAK A;  1XKE A;  5C5B A;  1UEF A;  1KZG A;  5HE1 A;  1NI2 A;  1B55 A;  2ZPY A;  5LON B;  1XCG A;  4GPT B;  2YS5 A;  1FOE A;  1U5D A;  3KRX A;  2I5C A;  4A5K A;  2YT1 A;  1ZVR A;  2RUK B;  2DTC A;  2XQN M;  3D8D A;  5GOW B;  1UPR A;  1K5D B;  2J0K A;  2W2X C;  1X86 A;  4WSF A;  1X1F A;  1ZSQ A;  2N0Y A;  2CY4 A;  1RRP B;  2KCJ A;  4DBB A;  4GXB A;  2D9Y A;  3N7C A;  2R09 A;  3RCP A;  3SO6 A;  4P7I A;  4IOY X;  1GC7 A;  2UZR A;  1U27 A;  5FI1 A;  5HE3 A;  2RSG A;  5DI9 B;  4GZU A;  3FM8 C;  2I1K A;  4A6F B;  1WGU A;  1PFJ A;  2DN6 A;  2VSZ A;  2UVM A;  1EGX A;  1P5T A; 
#chains in the Genus database with same CATH topology
 2KIE A;  3A58 A;  3SV1 A;  1SHC A;  2VRW B;  5D3X A;  4HB2 B;  3PVW A;  1SGH A;  4DX8 A;  1V5P A;  3KSY A;  2FJU B;  3GYP A;  2Z0O A;  4HAV B;  3HK0 A;  5L81 A;  5D27 A;  2COA A;  1I7A A;  3NSU A;  4ZRI A;  3DXC A;  2D9Z A;  4HB3 B;  2EMT A;  2OTX A;  1MKE A;  4B6H A;  4HAT B;  4QJ4 B;  2RGN B;  4HB4 B;  4MT7 A;  3PG7 A;  2EMS A;  1N3H A;  2GJY A;  4GNK B;  4HAZ B;  3WA0 A;  1Q67 A;  1MIX A;  2DKQ A;  1V88 A;  4BBK A;  5HE0 A;  4XWX A;  1H4R A;  3DXD A;  4KHB B;  2P0D A;  5J3T A;  4L6E A;  2ROV A;  1X1G A;  5J3Q A;  2FJL A;  1ZYI A;  4QXA B;  2IYB A;  1DYN A;  2Z59 A;  1TJ6 A;  1LW3 A;  1EF1 A;  3CIK A;  1UNP A;  1GC6 A;  4C0A A;  5C5B B;  4EJN A;  1Y19 B;  2Z0P A;  3FVC A;  1DDV A;  2P0F A;  2BCJ A;  5FI0 A;  1AQC A;  1U5F A;  4IAP A;  5DHF B;  5JHH A;  3HW2 B;  4GMX B;  4HSI A;  4HDO A;  2LKO A;  5JP4 A;  1W1G A;  2Z4D A;  1EVH A;  1DDM A;  2GCJ A;  4OSN A;  2KR0 A;  2LYD A;  1X11 A;  4ZRK A;  3DCX A;  5DIF B;  3VOQ A;  3G9W A;  1EAZ A;  2KIG A;  4KHO A;  2ELB A;  2K00 A;  3PSC A;  2RLO A;  3ULC A;  1V89 A;  3A8Q A;  1MI1 A;  1WGQ A;  3TO1 A;  3BJI A;  2KGX B;  3PEG A;  2DFK A;  1Z87 A;  2NMB A;  3VIA A;  3KY9 A;  1NTV A;  1U29 A;  3HSA A;  2YSZ A;  2JP2 A;  2YS3 A;  4GN1 A;  2CAY A;  1M7R A;  3PVL A;  3SNH A;  1RJ2 A;  4MY6 A;  2LUL A;  2COF A;  2ELA A;  5C6R A;  2YT0 A;  1TXD A;  2ADZ A;  1U5E A;  3B77 A;  3D8F A;  1E5W A;  1FB8 A;  2DHJ A;  2D9X A;  1BWN A;  1AWE A;  5HE2 A;  2MWN B;  3U7D A;  3TW1 A;  1BTN A;  2J0J A;  5KQ4 A;  2DX1 A;  1V61 A;  4HAY B;  2AEH A;  2YF0 A;  1W1H A;  1Y5O A;  2YT2 A;  1IRS A;  1V5M A;  2YS1 A;  3U8Z A;  2D2Q A;  5LG4 B;  2DHI A;  1U5G A;  5D3Y A;  1LB1 A;  5EFX A;  2G35 A;  1TQZ A;  3OAN A;  2KUQ A;  4TYZ A;  5C79 A;  2NBV A;  4CHM A;  1X05 A;  2YVC A;  3SUZ A;  2R0D A;  1T77 A;  3X23 A;  3PP2 A;  2H7E A;  4A6H A;  1MIZ B;  2Z0Q A;  3IVF A;  1MAI A;  4NY0 A;  4F7H A;  1UPQ A;  3PVU A;  3AU5 A;  1KI1 B;  1QQG A;  4CYE A;  2N23 A;  2ROZ B;  5KCV A;  1XD4 A;  4HAX B;  3A98 B;  4KVG B;  4F7U P;  2Q13 A;  2MKR A;  1WVH A;  2CRF A;  2D9V A;  2K8E A;  4K81 A;  2DKP A;  3TCA A;  2LOZ A;  1MK9 B;  1P6S A;  5CLL B;  1M7E A;  2J59 M;  3KZ1 A;  1MK7 B;  2M14 A;  4F7G A;  5J3Y A;  1WJ1 A;  5IRS A;  3F5R A;  3NW8 A;  4MK0 A;  4H8S A;  4QJ5 B;  1DDW A;  2OQB A;  2RVB B;  3FSS A;  3QIJ A;  5LOP B;  3ODX A;  5M4Y B;  3AU4 A;  3OHM B;  1ZM0 A;  3P6A A;  2YRY A;  2CY5 A;  2QKL A;  1QC6 A;  5JLJ B;  1UNR A;  3PZD A;  3FEH A;  1U2B A;  4EMO A;  1NTY A;  1WJM A;  5DHA B;  3ODW A;  2Y8G A;  1FGZ A;  4Y94 A;  3DXE A;  3TFM A;  2PZ1 A;  4KAX B;  4KHA A;  4D6W A;  4WJ7 A;  2LG1 A;  2I5F A;  2M38 A;  2DHK A;  4NSW A;  3SYX A;  3ULB A;  4K2P A;  4PQ0 A;  2P8V A;  2AL6 A;  3M1I B;  2RRF A;  1ZC4 B;  4D0N B;  2GUM A;  3P7Z A;  2Y8F A;  3GYO A;  1K5G B;  2J0M A;  3F0W A;  1FHO A;  4PNK A;  2L2I A;  2L1C A;  2MFQ A;  4OT1 A;  3ODO A;  2GCL A;  1FHW A;  2GS0 A;  3LJU X;  2D10 A;  2DYN A;  1ISN A;  4K17 A;  2EC1 A;  3A8P A;  3MDB C;  1XR0 B;  4CSQ A;  3ZVR A;  1J0W A;  1OMW A;  4WVF B;  1H10 A;  4TKN A;  1UNQ A;  5D3V A;  3O96 A;  5I2M A;  1MPH A;  3T06 A;  2RNR B;  4HB0 B;  3WYF B;  3UZT A;  1PMS A;  1WI1 A;  2IFS A;  3CXB B;  1W1D A;  1NU2 A;  2DX5 A;  4IFS A;  4A6K A;  2KUP A;  3D8E A;  3QWM A;  2Y7B A;  4DX9 0;  2COD A;  4YON A;  2HE7 A;  3QBV B;  2E2X A;  4EKU A;  4ZRJ A;  2EJ8 A;  4Z2N A;  1XX0 A;  4HAU B;  1DRO A;  2COC A;  3MPX A;  2DA0 A;  2QKM A;  5CLQ B;  1GG3 A;  2D9W A;  1OQN A;  3KRW A;  4A6F A;  1FAO A;  2HTH B;  3NWD A;  2P0H A;  1OY2 A;  2W2W A;  1DBH A;  2K49 A;  1KZ7 A;  2LOX A;  3AJ4 A;  2X18 A;  1I2H A;  1BTK A;  2NZ8 B;  4GMV A;  4CHJ A;  2DYQ A;  5KQ1 A;  4DXA B;  3V5W A;  2V76 A;  3NWA A;  5JHG A;  5DH9 B;  1PLS A;  2H7D A;  3HIE A;  4DIX A;  2DLW A;  3BIN A;  1P3R A;  2R2Y A;  4L1R A;  2MDX A;  1FHX A;  1V5U A;  5D3W A;  2VKI A;  1J19 A;  2D11 A;  3ZDT A;  2W2X D;  1WG7 A;  4HAW B;  4Z2M B;  2I1J A;  2Z14 A;  4KHB A;  2D4Q A;  5C16 A;  3TVV A;  1FGY A;  4HDQ A;  2K2U A;  2UZS A;  1XOD A;  2Z13 A;  3ML4 A;  4YL8 A;  1ZC3 B;  4HHV A;  4K2O A;  2K2J A;  3HQC A;  1BAK A;  1XKE A;  5C5B A;  1UEF A;  1KZG A;  5HE1 A;  1NI2 A;  1B55 A;  2ZPY A;  4QJ3 B;  5LON B;  1XCG A;  4GPT B;  2YS5 A;  3U12 A;  1FOE A;  1U5D A;  3KRX A;  2I5C A;  4A5K A;  2YT1 A;  1ZVR A;  2RUK B;  2DTC A;  2XQN M;  3D8D A;  5GOW B;  2ZKM X;  1UPR A;  1K5D B;  2J0K A;  2W2X C;  1X86 A;  4WSF A;  1X1F A;  1ZSQ A;  2N0Y A;  2CY4 A;  5I2S A;  1RRP B;  2KCJ A;  4DBB A;  4GXB A;  2D9Y A;  3N7C A;  2R09 A;  4GOU A;  3RCP A;  3SO6 A;  4P7I A;  4IOY X;  1GC7 A;  2UZR A;  1U27 A;  5FI1 A;  5HE3 A;  2RSG A;  5DI9 B;  4GZU A;  3FM8 C;  2I1K A;  4A6F B;  1WGU A;  3NWF A;  1PFJ A;  2DN6 A;  2VSZ A;  2UVM A;  1EGX A;  1P5T A; 
#chains in the Genus database with same CATH homology
 3SV1 A;  1SHC A;  2VRW B;  5D3X A;  4HB2 B;  3PVW A;  1SGH A;  4DX8 A;  1V5P A;  3KSY A;  4HAV B;  3GYP A;  2Z0O A;  3HK0 A;  5L81 A;  5D27 A;  2COA A;  1I7A A;  3NSU A;  4ZRI A;  3DXC A;  2D9Z A;  4HB3 B;  2EMT A;  2OTX A;  1MKE A;  4B6H A;  4HAT B;  2RGN B;  4HB4 B;  4MT7 A;  3PG7 A;  2EMS A;  1N3H A;  2GJY A;  4HAZ B;  3WA0 A;  1Q67 A;  1MIX A;  2DKQ A;  1V88 A;  4BBK A;  5HE0 A;  4XWX A;  1H4R A;  3DXD A;  4KHB B;  2P0D A;  5J3T A;  4L6E A;  2ROV A;  1X1G A;  5J3Q A;  2FJL A;  2IYB A;  1DYN A;  1TJ6 A;  1LW3 A;  1EF1 A;  3CIK A;  1UNP A;  1GC6 A;  4C0A A;  5C5B B;  4EJN A;  1Y19 B;  2Z0P A;  1DDV A;  2P0F A;  2BCJ A;  5FI0 A;  1AQC A;  1U5F A;  4IAP A;  5DHF B;  5JHH A;  3HW2 B;  4GMX B;  4HDO A;  2LKO A;  5JP4 A;  1W1G A;  1EVH A;  1DDM A;  2GCJ A;  2LYD A;  1X11 A;  4ZRK A;  5DIF B;  3VOQ A;  3G9W A;  1EAZ A;  4KHO A;  2ELB A;  2K00 A;  3PSC A;  2RLO A;  3ULC A;  1V89 A;  3A8Q A;  1WGQ A;  3TO1 A;  3BJI A;  2KGX B;  3PEG A;  2DFK A;  1Z87 A;  2NMB A;  3VIA A;  3KY9 A;  1NTV A;  1U29 A;  2YSZ A;  2JP2 A;  2YS3 A;  4GN1 A;  2CAY A;  1M7R A;  3PVL A;  3SNH A;  1RJ2 A;  4MY6 A;  2LUL A;  2COF A;  2ELA A;  5C6R A;  2YT0 A;  1TXD A;  2ADZ A;  1U5E A;  3D8F A;  1E5W A;  1FB8 A;  2DHJ A;  2D9X A;  1BWN A;  1AWE A;  5HE2 A;  2MWN B;  3U7D A;  3TW1 A;  1BTN A;  2J0J A;  5KQ4 A;  2DX1 A;  1V61 A;  4HAY B;  2AEH A;  2YF0 A;  1W1H A;  1Y5O A;  1IRS A;  1V5M A;  2YS1 A;  3U8Z A;  2D2Q A;  2DHI A;  1U5G A;  5D3Y A;  1LB1 A;  5EFX A;  2G35 A;  1TQZ A;  3OAN A;  4TYZ A;  5C79 A;  4CHM A;  1X05 A;  2YVC A;  3SUZ A;  2R0D A;  3X23 A;  3PP2 A;  2H7E A;  4A6H A;  1MIZ B;  2Z0Q A;  3IVF A;  1MAI A;  4NY0 A;  4F7H A;  1UPQ A;  3PVU A;  3AU5 A;  1KI1 B;  1QQG A;  4CYE A;  2N23 A;  2ROZ B;  5KCV A;  1XD4 A;  4HAX B;  3A98 B;  4KVG B;  4F7U P;  2Q13 A;  2MKR A;  1WVH A;  2CRF A;  2D9V A;  4K81 A;  2DKP A;  3TCA A;  2LOZ A;  1MK9 B;  1P6S A;  5CLL B;  1M7E A;  2J59 M;  3KZ1 A;  1MK7 B;  2M14 A;  4F7G A;  5J3Y A;  1WJ1 A;  3F5R A;  4MK0 A;  4H8S A;  1DDW A;  2OQB A;  2RVB B;  3FSS A;  3QIJ A;  5LOP B;  3ODX A;  3AU4 A;  1ZM0 A;  3P6A A;  2YRY A;  2CY5 A;  2QKL A;  1QC6 A;  5JLJ B;  1UNR A;  3PZD A;  3FEH A;  1U2B A;  4EMO A;  1NTY A;  1WJM A;  5DHA B;  3ODW A;  2Y8G A;  1FGZ A;  4Y94 A;  3DXE A;  3TFM A;  2PZ1 A;  4KAX B;  4KHA A;  4WJ7 A;  2LG1 A;  2I5F A;  2M38 A;  2DHK A;  4NSW A;  3SYX A;  3ULB A;  4K2P A;  4PQ0 A;  2P8V A;  2AL6 A;  3M1I B;  1ZC4 B;  4D0N B;  3P7Z A;  2Y8F A;  3GYO A;  1K5G B;  2J0M A;  3F0W A;  1FHO A;  4PNK A;  2L2I A;  2L1C A;  2MFQ A;  3ODO A;  2GCL A;  1FHW A;  2GS0 A;  3LJU X;  2D10 A;  2DYN A;  1ISN A;  4K17 A;  2EC1 A;  3A8P A;  3MDB C;  1XR0 B;  3ZVR A;  1J0W A;  1OMW A;  4WVF B;  1H10 A;  4TKN A;  1UNQ A;  5D3V A;  3O96 A;  1MPH A;  3T06 A;  2RNR B;  4HB0 B;  3WYF B;  3UZT A;  1PMS A;  1WI1 A;  2IFS A;  3CXB B;  1W1D A;  1NU2 A;  2DX5 A;  4IFS A;  4A6K A;  2KUP A;  3D8E A;  3QWM A;  2Y7B A;  4DX9 0;  2COD A;  4YON A;  2HE7 A;  3QBV B;  2E2X A;  4EKU A;  4ZRJ A;  2EJ8 A;  4Z2N A;  1XX0 A;  4HAU B;  1DRO A;  2COC A;  3MPX A;  2DA0 A;  2QKM A;  5CLQ B;  1GG3 A;  2D9W A;  1OQN A;  3KRW A;  4A6F A;  1FAO A;  2HTH B;  2P0H A;  1OY2 A;  2W2W A;  1DBH A;  1KZ7 A;  2LOX A;  3AJ4 A;  2X18 A;  1I2H A;  1BTK A;  2NZ8 B;  4GMV A;  4CHJ A;  2DYQ A;  5KQ1 A;  4DXA B;  3V5W A;  2V76 A;  5JHG A;  5DH9 B;  1PLS A;  2H7D A;  2DLW A;  3BIN A;  1P3R A;  2MDX A;  1FHX A;  1V5U A;  5D3W A;  2VKI A;  1J19 A;  2D11 A;  3ZDT A;  2W2X D;  1WG7 A;  4HAW B;  4Z2M B;  2I1J A;  2D4Q A;  5C16 A;  3TVV A;  1FGY A;  4HDQ A;  2K2U A;  2UZS A;  1XOD A;  4YL8 A;  3ML4 A;  1ZC3 B;  4HHV A;  4K2O A;  2K2J A;  3HQC A;  1BAK A;  1XKE A;  5C5B A;  1UEF A;  1KZG A;  5HE1 A;  1NI2 A;  1B55 A;  2ZPY A;  5LON B;  1XCG A;  4GPT B;  2YS5 A;  1FOE A;  1U5D A;  3KRX A;  2I5C A;  4A5K A;  2YT1 A;  1ZVR A;  2RUK B;  2DTC A;  2XQN M;  3D8D A;  5GOW B;  1UPR A;  1K5D B;  2J0K A;  2W2X C;  1X86 A;  4WSF A;  1X1F A;  1ZSQ A;  2N0Y A;  2CY4 A;  1RRP B;  2KCJ A;  4DBB A;  4GXB A;  2D9Y A;  3N7C A;  2R09 A;  3RCP A;  3SO6 A;  4P7I A;  4IOY X;  1GC7 A;  2UZR A;  1U27 A;  5FI1 A;  5HE3 A;  2RSG A;  5DI9 B;  4GZU A;  3FM8 C;  2I1K A;  4A6F B;  1WGU A;  1PFJ A;  2DN6 A;  2VSZ A;  2UVM A;  1EGX A;  1P5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...