2MLBA

Nmr solution structure of a computational designed protein based on template of human erythrocytic ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
MDTINITLPDGKTLTLTVTPEFTVKELAEEIARRLGLSPEDIKLTHNGKTLDPSLTLAEYGITPGSTITLEIKKKGGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords redesigned ubiquitin
publication title Protein design with a comprehensive statistical energy function and boosted by experimental selection for foldability
pubmed doi rcsb
source organism Synthetic
molecule tags De novo protein
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mlbA00
4DDGD 3DQVA 2JRIB 2LZ6A 4BKGA 1WGHA 2V4LA 4MELA 3VFKA 4DXAB 2KFKA 1GG3A 4GU2A 3DVGX 3KUDB 2KKCA 2KFJA 2KC2A 1P98A 3VVWB 3EECA 3QHTA 3PSEB 2EKEC 3GOEA 2IO0B 5LXIB 3B08A 3PRPB 1V81A 2KD0A 3ZVVA 2FAZA 4GOCA 4XZ4A 2IY1B 2KMCA 1P0RA 3NY5A 2JWZA 4HDQA 4BFRA 3M62B 2MRPA 4KSLC 4ZRIA 1Q1OA 4IM3A 2KTRB 3UQAA 1AARA 2ZNVB 1UELA 4W9EA 2A5UA 1J8CA 2WDTB 3ZTDA 2AEHA 4B6WA 2LI5A 4E71A 1J19A 2BGFA 3L0WB 3DVNV 2KNBA 3V62A 3HIZA 2Z0EB 2D11A 2KDIA 3UQBA 3WIMA 2N1VA 1OTRB 2KWCA 3K9OB 3KW5B 4RM9A 3ZNHB 4HLEA 4ANWA 1EUVB 2J0MA 3A4RA 3WANA 4X57B 4G11A 3ZRFA 3AU4A 1WJUA 2JF5A 2DYOA 1E8XA 1XQQA 3DVGY 1C3TA 2FCSA 1YX5B 2J0KA 4EZKA 3WALA 4DBGA 3B1LX 5CTRC 2KJHB 2K8HA 2D2QA 1D3ZA 2GBMA 1E90A 1L7YA 2Z59B 1YD8U 3MJWA 4FA6A 2N7DA 3N3KB 3A33B 3QA8A 4MM3A 1KM7A 2KMAA 1ISNA 2KK8A 2PEAA 4HK2A 4HWIB 3KH0A 4ASWC 2MWSB 1WF9A 4GN1A 3APDA 1ZW7A 2UWQA 3PZDA 3SU8X 3ECIA 1V86A 3CSTA 2NPTB 2K8CA 3H6NA 4B95A 2XEWA 2RSUA 3WAMA 2BYEA 3VDZA 2K39A 4CYEA 2RD0A 3PS6A 2CHZA 2IYDB 4KV2A 5DCNA 4URKA 4CO7A 2JPHA 1KJTA 1UGMA 2IO2B 1I42A 1IPGA 5CHFA 3EFUA 4I6NB 3V6EB 4M8NA 2JT4B 5DPRA 4FBJB 3VQIA 1KLVA 2KDEB 3JSVB 4JGHB 2O2VB 3VH3B 4GGQA 2FUHB 5C1ZA 2KXJA 2LWPA 1OEYJ 2MW5A 3B0AA 2LXCA 1LFDA 2IY0B 2YVCA 1WIAA 5LXHA 3VAWA 2LUEA 2WX1A 2DAJA 1EF5A 4BVUC 2RPQA 3H7PA 1OEYA 2MP2B 4JLCA 3P2BA 3MHSD 1WJ6A 3QK0A 4II2B 4DWFA 4FJYA 2XBBC 4KSKC 4FLHA 2GBJA 4LCDE 5JH5C 4A3OA 1WGYA 4BOZB 2VRRB 4NNJB 4FJVB 2BPSA 4TQ1A 4HVBA 4MJSA 1UD7A 3UIPB 1TZ1A 2MQJA 2KJ6A 4HCPB 3UINB 2BF8B 3IG3A 2REXA 5E6PA 1L2NA 4EUTA 2MBBB 5AZFA 3OJ3A 1T0YA 3OLMD 1WM2A 5D2MB 3VTWA 4W9HA 3RD2A 2LRUA 3QCAA 3SHQA 4MEMA 4K81A 3JVZX 4KIKB 1WXMA 5CX3A 5AZHA 4MDKE 4LDTB 2QHOA 2L0TA 2IBIB 4E74A 1SGHA 2C7NB 1UBIA 3VXWA 2NPTA 1V9JA 2R2QA 2ZPNA 3H1UA 3APFA 4RM8A 3PGEA 4KZ0A 4WWPA 1UZXB 3M63B 3AI5A 4TUUA 1WGDA 2BWES 5L83A 1IYFA 4KDIC 4WJNA 3K9PB 2JRHA 3RYTA 2FIDA 4N9F4 3KUCB 3JSVA 5G2NA 2O2VA 4IC7B 2G4DB 3PT2B 1E7VA 2BWFA 1OQYA 1A5RA 4B9KA 2KWVB 3DOWA 2M4NA 1H4RA 2NBUA 1J0GA 1LXDA 2AL6A 5G55A 1YJ1A 3L10B 2KO3A 3NZUA 4F1SA 1WX7A 4NQLB 2K6DB 4IWPA 3DPDA 3A1QB 5FR6A 4GB9A 2MP2A 2LRWA 3L16A 2WX0A 3CMMB 4IM2A 1WXAA 2EMSA 3KYDD 4W9FA 2PJHA 5KHOA 4TV3A 3ZUNA 2DX5B 4DHZB 3ZNID 2KJRA 1TGZB 3ZKJC 3MTNB 2MX2A 5CHWA 1R4MI 1WRDB 1V5OA 3SD5A 1JRUA 4GSWA 4NAWB 2I1KA 2ZCCA 3UF8A 4GDLB 4WJQA 3LJ3A 4WAAA 3WA0A 5E6OA 1SE9A 1BT0A 2DHZA 2KANA 3JYUA 3QQ8B 2KDBA 2RR9A 2KX3A 2BKRB 4PS8A 3A4SC 4ZDVA 4W9JA 4IWQA 4GMVA 2LGYA 4J6IA 3O65B 1RLFA 4TQ0A 2KZRA 4KIKA 2KLGA 4ZRKA 2KQ7A 1VCBA 2DZMA 2ZCBA 3L17A 2ZVOA 4OVVA 1GC6A 4LDTD 1P1AA 4YL8A 4HPLB 1TTNA 1V2YA 4PYZA 2DZJA 2Y5BB 4W9KA 3DBHI 4BOSC 1RRBA 1ZGUB 4IG7B 3DBLI 3U8ZA 2B3AA 1YQBA 3PLVA 1LM8B 2GBNA 3W1YA 4GDKB 1YIWA 1CMXB 1WMHB 1IP9A 1NDDA 1WI0A 2L7RA 3DDCB 2ZNVC 5IAAC 2JZZA 2MCNB 3U7DA 2G45B 1RFAA 5C23A 2V1YA 3VUWA 4ANXA 1WGRA 3BY4B 3PV1A 2CU1A 5AZGA 4EZLA 3QARA 5JHBA 3RZFA 4BKSD 2KHWB 4BKTA 2AYOB 3WAOA 3A1QA 3QAQA 2N9PC 4ANUA 3TL5A 2KDFB 2KTRA 2LASA 2KLCA 2EMTA 3QC8B 3RZWC 3H9DA 5D7GA 5EDSA 2ZEQA 4FHKA 5J2RA 3L54A 4XX5A 3T8MA 1P9DU 3QWZB 1WGGA 1WX9A 3QJZA 3TMPB 4K7SA 3DBSA 4WQOB 3D32A 2C60A 2JVCA 4EOYA 4HPMB 3VUYA 4F8CB 1WXSA 4F7ZA 1S1QB 4JIOU 4G50A 2MLBA 2KOXA 1U4AA 2CKHB 2N7EA 5HKHA 2KFKB 2ZPYA 2KC1A 4K1RB 2HE7A 3WAPA 3ZW3A 1PQSA 2CHWA 4M0WB 2J7QB 3KYCD 3TBLD 5D94A 3ZRCA 4I6LB 3ML9A 4LJPB 3VHTC 2NVUI 1WY8A 2R2OA 1UBQA 3RUIB 2J0JA 4G3XB 1X1MA 3V61A 3DCGA 1I35A 2KQSA 3APCA 4ICVA 1FXTB 4WJPA 2C7MB 4GDKA 4FN2A 1UH6A 2KWUB 1WR6E 3PRMB 2D3GA 2FCQA 2W9NA 3HK0A 1V5TA 3ZIMA 2KN5A 4G0NB 1WJ4A 3ZTCA 2O6VB 4MGKE 3AULA 2DAFA 2M1MA 1Q0WB 2K8BA 1E8WA 2N4FA 5E6NA 4IM0A 5BO4B 1E7UA 3H7SA 3A9JB 2K1FA 2KVRA 5L95C 3RULA 4E3CA 2V3SA 3EHVA 3NS8A 2PE6B 3IFWB 2G4SA 2DENB 4TKNA 2HJ8A 1WZ3A 3ML8A 4JQWC 2DYBA 4P7IA 4W9GA 3VUXA 1R4NI 2NR2A 3UGBB 2L8JA 4AP4C 2FNJB 2LVPA 2L3ZA 4FJZA 4RMAA 3LDZE 4PS3A 3KVFB 3S2AA 2DZIA 3IHPC 3ZLZA 3SDLC 3OJ4B 2I1JA 2BYFA 1K8RB 3GZNI 4II3B 4A20A 1HE8A 4HJKA 4AWJA 2N9XA 3RCZA 5JHAA 2Z0DB 2CS4A 1Y8RC 1V6EA 5IA7A 1WFYA 5KHQA 1S3SG 2M8SA 4AUQC 4ZYNA 1V80A 3DBRI 4W9LA 2IO3B 3PHXB 3QX1A 3PREA 3ZNZB 2FIFA 4XC2A 4DHJD 2K6QA 2G3QB 3L13A 2WYQA 2L0FA 1NBFC 4EFOA 4BBNF 2JUOA 2L00B 2CR5A 5J17A 2BKFA 3Q3JA 2FCNA 2LGXA 3EC8A 4IW0A 1YX6B 2O6VD 3AU5A 2MA9B 2O6VA 1LQBA 3IBEA 4NJ7A 2LD9A 4HCNB 3AXCA 4IUMB 2GBRA 5LLIA 5JZEB 2XK5B 4WWNA 2M17A 3H7PB 1RAXA 1WYWB 3VTVA 1GUAB 3CF6E 3A9JA 3ENEA 4I6PA 2HD5B 4EEWA 2NBWB 4W9DA 3U30A 5DPTA 2JXXA 4NQKE 2LXAA 3R7RA 4PYUA 4AJYB 2MSED 2ZZPB 1QZEA 2L05A 4A3PA 1Z2MA 3M95A 3ZNGC 5AEKB 4JL9A 4FADA 2UYZB 4MJSB 1WXVA 3VH4B 4OVUA 1OGWA 1WR1A 1GJZA 3NZSA 4CHKA 1WM3A 4AOFA 1Z5SB 3R3MA 1XT9B 1VD2A 1V49A 1XD3B 4HDOA 4K7WA 4BKSA 3V6CB 1Q5WB 2OOBB 3JW0X 3ZDMC 2NS5A 2M0XA 2NCNA 5DPWA 2K25A 4NJ6A 1WH3A 2AWTA 2HTHA 4IWOA 1KOTA 3A9KB 3VTUA 1WX8A 3L08A 4NAWA 2DYMA 2LVOA 2PPHA 1E8ZA 2LJ5A 4AJWA 3QIJA 3N32A 3PVLA 1E5WA 4GDLA 4K7UA 4ICUA 3HM6X 4EKUA 4DK5A 4GXBA 4MH0E 1P3QU 1WE7A 4KDLB 1TBEA 3R66C 4MSQB 5D6JB 3IVFA 4WJOA 3X0WA 2LGDA 5GMVA 4ZRJA 1WJNA 1C1YB 3ALBA 1M94A 2N9EB 3ZDTA 2MBEA 3ONSA 2KX0A 4DDID 4GIVA 4W9IA 3PHWB 3KUZA 3Q3FA 4MGZE 2L76A 4HXDA 4DHZE 3NOBA 3V60A 5J18A 4FHJA 1H8CA 1F9JA 2IZVB 2KTFA 1GNUA 3TIXA 4DHJB 4W9CA 1EO6A 3W1SC 5CHVC 2YLMA 2NBVB 4MSMB 2MBHA 1NI2A 2XK5A 2FCMA 2WWZA 4LJOB 1EF1A 1GC7A 2MBOA 4M8MA 2PE9A 2RGFA 4NY0A 2MBQA 2N1WA 5DPSA 1WMHA 2JZ3B 3DVNU 3ZO5B 3PTFC 2A4ZA 3N30A 2ZJDA 1ZKHA 2DZKA 1MG8A 3CSFA 4FULA 3NHEB 1SIFA 3UIOB 2C7HA 2JY6A 3HHMA 2GBKA 4BBNC 2BYVE 3W1SA 1WZ0A 2CHXA 1E8YA 2AL3A 3TJPA 2ASQA 5TR5A 4PS7A 2C9WB 2ZVNA 2GOWA 3M3JA 3X23A 2GMIC 3BINA 4KVGB 2IO1B 4KZCA 3TCAA 1G6JA 4WWOA 3PRZA 3HM3A 3I3TB 3OAWA 3PPAA 3R7QA 4MGYE 3C0RB 2C5LC 2D10A 2LVQA 4ANVA 1WE6A 3T9LA 2D07B 4EZJA 3A9KA 2OJRA 3RT3B 3PLUA 4NPNA 4MGIE
chains in the Genus database with same CATH superfamily
4DDGD 3EUB2 4BKGA 1WGHA 2WU5B 1ZP0B 2KFKA 3DVGX 5AUIA 1F52A 1V81A 2KD0A 2FAZA 2IY1B 2JWZA 2TSSA 4HDQA 3M62B 4ZRIA 1KLUD 2KQ4X 4W9EA 1VRAB 3L0WB 2I2YA 1C4AA 2JYTA 3K9OB 3KW5B 4RM9A 1SE3A 4ANWA 2J0MA 4P1CC 3WANA 2G1EA 3DVGY 2FCSA 4C56C 4EZKA 1PFDA 3B1LX 5CTRC 5BMHA 2RMMA 1YD8U 3MJWA 3FKYA 3QA8A 4MM3A 2KMAA 3P4QB 2MWSB 2D5GA 4GN1A 1ZW7A 3OG5A 1V86A 2E6XA 2NPTB 3PO0A 2XEWA 2RSUA 2BYEA 2CHZA 4URKA 2WXRA 3RI7C 4FBJB 4IDIA 1KLVA 2KDEB 4JWSC 5H92C 1JCKB 2LWPA 2LXCA 1LFDA 3T3OA 2YVCA 1YQ3B 1DGJA 5LXHA 2DAJA 2WDQB 1EWYC 1E10A 1FCLA 3MHSD 4DWFA 2PMVA 3C19A 4KSKC 4FLHA 5JH5C 4A3OA 2WXMA 4NNJB 2JSVX 3AM9A 2BPSA 1UD7A 3MC9A 1UNSA 2RDGA 4WAFA 3UINB 2REXA 5E6PA 2MBBB 3FC4A 2INPE 1KRHA 3VTWA 1XCQL 1WM2A 4UDUC 2LRUA 1HEZE 3Q8CA 3JVZX 4KIKB 1V8CA 3AE6B 5CX3A 5AZHA 4LDTB 2QHOA 2L0TA 3H8HA 1UBIA 3VXWA 2NPTA 1V9JA 3SEBA 3H1UA 3PGEA 3P42A 1KLGD 4P1BC 3AI5A 1IYFA 4R3DA 3K9PB 4USAA 1SJED 4JWUC 4PK1A 1E7VA 2BWFA 3DOWA 3CIRB 4LNOA 1H4RA 1STEA 3Q2AC 3L10B 3AEEB 3O13A 5FR6A 4GB9A 3KWLA 4W9FA 2EMSA 3J9CA 3ZUNA 1VLBA 2KJRA 2KDMA 2MX2A 1V5OA 1JRUA 4GSWA 3UI3A 3UF8A 1L4DB 3LJ3A 2KDBA 2BKRB 4J6IA 2LGYA 3N1XC 4TQ0A 1JRPA 2JWUA 2KZRA 4KIKA 2DZMA 4OVVA 1ROEA 1P1AA 2BW2A 4HPLB 4PYZA 4W9KA 1UUPA 3NVZA 3DBLI 1YMHE 3P4PB 2W55A 1LM8B 3W1YA 4GDKB 1V1OA 3DHGC 2WXPA 3MHZA 4P16A 3BVZA 3RNAC 4ANXA 4A9AA 3BY4B 4A55A 3PV1A 1KTKA 5AZGA 1NENB 3U52E 2JZPA 1P7FA 4H2AA 4ANUA 4C80A 5D7GA 1ESFA 2V4IB 3L54A 4XX5A 3T8MA 1QLBB 1DYQA 3QWZB 1WX9A 4K7SA 2C60A 4HPMB 4G50A 3ZW3A 1UWXA 4M0WB 5IKCM 4AS1A 3ML9A 1XLQA 1WY8A 2INCC 5HG2A 3RUIB 3Q69A 2V3NA 4WURA 1VZ7A 4ICVA 2C7MB 4GDKA 2ICIA 3MFGA 3HK0A 1V5TA 3ZIMA 4G0NB 2LHDA 3AULA 2M1MA 2WXFA 1T0QC 1E8WA 1VJKA 2N4FA 5E6NA 2QIEB 2V3SA 1B9RA 1GAQB 2G4SA 2DYBA 3VUXA 2BB6A 4ACFA 3W5VB 3AE8B 1E7PB 1MPEA 3OJ4B 1QKZA 2BYFA 1K8RB 4AWJA 1LO5D 1D5ZC 3Q3OC 1Y8RC 5IA7A 1WFYA 5EE3A 2VH1A 1L5PA 1YJJA 3ZNZB 2GRIA 3L13A 2WYQA 2GLSA 4C4VB 4EFOA 3Q14C 1TJEA 4K3CA 1OQQA 2VH2A 2BKFA 3Q3JA 2BVCA 1XO3A 2FCNA 3NJTA 1D5MC 5FK9C 3BIID 4XWTA 3AXCA 4B0MA 5JZEB 2XK5B 4WWNA 1ZE3D 3H7PB 2MH7A 3Q6BA 3VTVA 3CF6E 2WXIA 2NBWB 2K0PA 4W9DA 5DPTA 3R7RA 3V05A 4AJYB 1QZEA 1T5XD 2L05A 1F77A 1XEEA 2UYZB 1UWMA 4MJSB 2AQ3B 1I7HA 3ZGZA 1GJZA 1RYJA 3NZSA 1OQRA 4CHKA 2RDHA 2PVOD 1M4VA 3ZQ4A 4M01A 2NS5A 2NCNA 2QCZA 1PGBA 5DPWA 2AWTA 2HTHA 2WDVB 3L08A 4NAWA 2QILA 1E8ZA 3ABVB 1D4BA 1BXTA 3QIJA 3VR9B 4DK5A 1P3QU 1WE7A 4MSQB 3R66C 1F0ZA 2BQQA 1C1YB 1M94A 3RPFC 4C4VA 4DDID 1R4NB 4WQMA 4W9IA 4DHZE 3NOBA 5J18A 2KTFA 4W9CA 4KX6B 3W1SC 4MSMB 2XK5A 2WWZA 4M8MA 3GZNB 1VR9A 2PE9A 4RH6A 2V0GA 2LFIA 5DPSA 2JZ3B 3DVNU 3ZO5B 2HJ1A 3DHIC 3Q3MC 2ZW1A 2KMMA 2DZKA 3DBRB 3CSFA 1SIFA 3UIOB 3B9JA 2BYVE 3W1SA 4PS7A 2ZVNA 5EE9A 4KVGB 2D3AA 4C7ZA 2KWDA 3PRZA 1T3QA 3I3TB 3AH7A 5FR3A 2MJ3A 1V1PB 3NS1A 1OFFA 2B76B 3TEWA 1ZDXA 2MHJA 4US8A 3DQVA 5BMGA 4DXAB 1JWBD 4GU2A 4N6EB 2KFJA 2KYWA 3GB1A 3AEGB 2IO0B 3FAHA 5LXIB 1R7SA 3PRPB 3ZVVA 2KN4A 5H8YE 4XYCA 1P0RA 2WXLA 4KGRA 1IGCA 2Q5WD 4IM3A 1QOGA 2D3BA 2KTRB 2ZNVB 2A5UA 1J8CA 2WDTB 2AEHA 1J19A 3DVNV 3V62A 3P4SB 1MHXA 2KDIA 1FEHA 4RFBA 1E0ZA 4A8XC 4LNNA 3A4RA 5D3DA 4B0EA 1WJUA 2JF5A 4YTMB 1YX5B 2J0KA 1V1PA 2KJHB 4ARCA 2PEAA 4HWIB 1T6BX 4ZRQA 1MG4A 3AE5B 2UWQA 3Q8AA 1BMLC 3FILB 4WIPA 3WAMA 1I4GA 2RD0A 4KV2A 1TIFA 4CO7A 2JPHA 1KJTA 1UGMA 1C79A 2X8XX 1CJEA 1FD6A 3JSVB 3VRAB 5C1ZA 1OEYJ 1YOVB 2MW5A 3RMKC 3B0AA 1WIAA 3VAWA 4BAXA 2LUEA 1OEYA 1FPYA 3Q8EA 1FFVA 3I5JC 3QK0A 1WJ6A 3Q8FA 2GBJA 3U4EG 1HTOA 4BOZB 2H89B 4FJVB 1K53A 4TQ1A 1FNWA 1P7EA 3UIPB 3R2TA 2KJ6A 1YJIA 3N20C 2BF8B 1L2NA 5C2TB 1T0YA 5D2MB 3P1MA 4W9HA 1JWAD 3QCAA 3SHQA 2INNE 4Q2JA 1ZXHA 1ZXIA 2IBIB 2R2QA 1WWTA 2MJEA 3N9YC 1WGDA 2BWES 4KDIC 4N9F4 1K51A 3JSVA 2KWVB 4YTPB 2WS3B 2IPKD 2NBUA 1LXDA 2AL6A 5G55A 4JPSA 4F1SA 3A1QB 2GB1A 1AN8A 3CMMB 4IM2A 4TV3A 3ZNID 1TGZB 1WRDB 2ZCCA 1J7CA 1CZPA 4WJQA 2KANA 1BT0A 3I9V1 1PYWD 4PS8A 4W9JA 4IWQA 3O65B 1YN4A 2ZCBA 4KGTA 1QOAA 5BMIA 2W3RA 1I4PA 1RRBA 1K50A 1YIWA 1WMHB 3BVMA 2AQ1B 1WI0A 3DDCB 5IAAC 2JZZA 2MCNB 2G45B 4MH8A 3VUWA 1LGRA 4EZLA 5JHBA 3RZFA 1JROA 2IDYA 3A1QA 2N9PC 3TL5A 1TYGB 2KDFB 1WYGA 2KLCA 2LASA 5EDSA 2J4XA 2ZEQA 1P9DU 2V3PA 2WXOA 3DBSA 1MJDA 1WXSA 1VZ8A 1S1QB 4F7ZA 2CKHB 1FCCC 2ZPYA 2HE7A 3WAPA 1FO4A 2FUG1 1PQSA 1VDVA 2J7QB 5D94A 1UBQA 1FRDA 4ZYSA 1JWSD 3V61A 3SR6A 1J7BA 1I35A 4L23A 1FXTB 2WHIA 4FN2A 1F1HA 2KWUB 4ITKA 3ZTCA 5IN7A 4MGKE 2JXTA 5BO4B 1E7UA 3A9JB 2MJDA 2PVGC 3AV8A 3EHVA 3NS8A 5JXVA 2PE6B 3BYYB 3IFWB 1WZ3A 3ML8A 2V9HA 4JQWC 2LUMA 1R4NI 2Y3AA 2NR2A 2HDEA 1FNUA 1J7AA 2LVPA 3TEZA 3LDZE 3B2FA 1SE4A 1DOYA 4RNAA 2DZIA 3ZLZA 2QSDA 3GZNI 1I4HA 4HJKA 1C9FA 1K52A 5JHAA 3AE7B 1PUTA 1S3SG 4P6VF 4ZYNA 4ZHPA 3DBRI 4JE3B 1XCTL 1SF0A 2FIFA 2BT6A 2K6QA 3Q3NC 4BBNF 1ZDVA 1MHHE 3RNEC 3GS2A 1TKEA 4REZA 2L83A 2LGXA 4EE2A 4IW0A 2KT7A 2O6VD 4NZLB 4RGOS 2LD9A 4HCNB 4IUMB 2GBRA 1RAXA 1WYWB 2K9XA 3A9JA 3I63C 2JXXA 4NQKE 2LXAA 2N9LA 3C8YA 2MSED 4A3PA 3M95A 1NVID 3ZNGC 5AEKB 3LYYA 4OVUA 2PLPA 1WR1A 1N6ZA 2CU3A 1WM3A 4AOFA 3R3MA 1XT9B 1VD2A 2KAJA 4BKSA 1YN3A 3MP9A 4DXFA 3JW0X 4D2KA 2WQYB 4OW0A 2K25A 1WH3A 1KOTA 2CJNA 1YQ4B 4AQ7A 4HEA1 2LVOA 2PPHA 4AJWA 3PVLA 1E5WA 4ICUA 3HM6X 4GXBA 1TY0A 4MH0E 1FM0D 3GE8C 1TBEA 4WJOA 2LGDA 4OHJA 5BYSA 4OZCA 4ZRJA 2MBEA 2KX0A 3AE1B 3PHWB 3N1YC 4KKJA 4A90A 1KH0A 4FHJA 4HRSA 2IZVB 4DHJB 1EO6A 2YLMA 2J52A 2MBHA 4LJOB 1EF1A 1AWDA 2WLBA 2G9HD 2BB5A 1N61A 1I4QA 1MG8A 3NHEB 3AECB 2L32A 1WZ0A 2AL3A 2PTLA 4M02A 2ASQA 2C9WB 4IKGA 3M3JA 2IO1B 2VZKD 3TCAA 4WWOA 1L0VB 2ZW0A 1N5WA 4MGYE 2LVQA 4EZJA 4C7YA 2OJRA 1EM7A 2GI9A 4NPNA 2L52A 1L0XB 2DWQA 3R2IA 2QC8A 1IBXB 2LZ6A 2NTSA 3SFDB 4L1BA 4MELA 3KQ4A 4NJCA 1RWSA 3VFKA 1SJHD 4M0WA 2KKCA 2N9KA 3NUHB 3EECA 3QHTA 3PSEB 4LLGM 2IGDA 3B08A 4NAMA 4XZ4A 2KMCA 2MRPA 4KSLC 3MC8A 1AARA 3T3NA 4B6WA 2LI5A 4YSZB 5IP4D 3HIZA 3WIMA 2N1VA 1OTRB 3ZNHB 4FXCA 4HLEA 2IGHA 1EUVB 1AYFA 4G11A 4X57B 2PIAA 3AU4A 2DYOA 3P63A 1E8XA 1C3TA 3WALA 3RNBC 4DBGA 1EWCA 1IUEA 2K8HA 4FA6A 3N3KB 2KK8A 3KH0A 3APDA 3ECIA 3CSTA 2AX5A 2K8CA 3H6NA 3HRDD 2NTTA 2LEKA 3PS6A 2IYDB 2IO2B 1I42A 4RF0A 4S0RA 5DPRA 3VQIA 2KVZA 4DXGA 3VH3B 2K5PA 2KXJA 2IY0B 1HXYD 1Q10A 2WX1A 1EF5A 3H7PA 3KWVA 2E3TA 4JLCA 3P2BA 4II2B 2XBBC 4LCDE 1EU3A 3MJ5A 1WGYA 2VRRB 1CQVA 2Y5CA 4HVBA 4MJSA 1TZ1A 2JYEA 4CQNA 3HUIA 1WGKA 3AN1A 5AZFA 3OJ3A 3OLMD 3RD2A 3BK2A 4MEMA 2WNMA 3IT6B 2ON8A 2C7NB 2ZPNA 3APFA 4RM8A 4KZ0A 5D3IB 5GXGB 4WWPA 1UZXB 4TUUA 4WJNA 2JRHA 5G2NA 2G4DB 3PT2B 3ETRA 1A5RA 1E9MA 2DNFA 2M4NA 3IT4B 1J0GA 1YJ1A 5E6JA 1WX7A 3P4RB 2K6DB 2FE8A 3DPDA 3VRBB 3LXFA 1FNVA 2WX0A 5KHQA 1WXAA 2PJHA 2DX5B 1TS4A 4DHZB 1FFUA 3MTNB 5BYQA 4GDLB 4N59A 4OVZA 3WA0A 5E6OA 1SE9A 1I4XA 2M0AA 2RR9A 2KX3A 4ZDVA 3A4SC 4GMVA 2H88B 1RLFA 3R8BA 4ZRKA 2KLGA 2ZVOA 1GC6A 2Y5BB 1EU4A 1ZGUB 4IG7B 1N62A 1BUIC 4KGSA 2LJIA 2UU7A 1YQBA 3PLVA 2GBNA 1CMXB 4MT5A 2D3CA 2QMTA 2ZNVC 1NYQA 2LHEA 3U7DA 5C23A 3RNFC 3U7ZA 1WGRA 2LGIA 1FXAA 1KF6B 4RGTA 3QARA 1SXTA 1FRRA 4BKTA 3WAOA 5HHDG 1C4CA 2KTRA 4XGAB 1C4PA 2EMTA 1WXQA 3W5UB 2QEJC 5J2RA 3TMPB 4WQOB 3D32A 4HPPA 4EOYA 5MPOA 2WGSA 2N7EA 2BS4B 2KFKB 3AB5A 2KC1A 1Y56A 1A70A 3AE9B 3HVDA 2R61A 2NVUI 2R2OA 2J0JA 4G3XB 1X1MA 3DCGA 4L2YA 2PW9A 1JQ4A 3APCA 4ARIA 3TUOA 3OWEB 2JQRB 3NVYA 1WR6E 3PRMB 2W9NA 1ET9A 3GP7A 2O6VB 1R4MB 3FILA 1Q0WB 2K8BA 4IM0A 3H7SA 2KVRA 2WXQA 3E9SA 5L95C 2DENB 5BYRA 4W9GA 3RNGC 1FIQA 5AUKA 4AP4C 2L3ZA 4RMAA 4PS3A 3BWUD 3DBHB 3S2AA 1TS3A 1QILA 3SDLC 1XLPA 4MM3B 4A20A 5T8IA 3RCZA 1N5XA 2Z0DB 2CS4A 5I4DA 3U2SC 1DOXA 2M8SA 1V80A 4W9LA 3PHXB 3PREA 4XC2A 1C77A 3BZDB 2G3QB 3E56A 1JWUD 2MEKA 5EE1A 2JUOA 2L00B 4OZBA 5G5GA 2INDC 3AU5A 2MA9B 2O6VA 2QJLA 1SEBD 5LLIA 3KLSX 1GOZA 2M17A 3ZJUA 1GUAB 4LTUA 1L6VA 2HD5B 4EEWA 3U30A 2OHFA 1GPXA 4PYUA 1JW9D 2ZZPB 1Z2MA 4FADA 1T0SC 1WXVA 1OGWA 3NG0A 3SFEB 1KFYB 4K7WA 3V6CB 2WP9B 2OOBB 4HJGE 2VZKB 2ACZB 2M0XA 4LK0M 1D6EC 4IWOA 3ZYYX 1WX8A 3I57A 2LJ5A 3N32A 3V3XA 2M19A 4KDLB 5D6JB 3IVFA 3ZDTA 2OEDA 3KUZA 3Q3FA 3AMZA 4MGZE 4HXDA 2OJWA 3IXSA 1H8CA 2WXGA 1GNUA 1XXGA 1NI2A 1GC7A 2MBOA 4RF1A 2RGFA 4NY0A 2MBQA 1WMHA 4TMAB 1XLOA 2ZJDA 2YEPF 1TZOA 4FULA 3PZ7A 3HHMA 1VZ6A 2GBKA 2BS2B 2CJOA 2CHXA 3AE4B 2GOWA 2GMIC 4HKZE 1B1ZA 3HM3A 3PPAA 3R7QA 2C5LC 3IAM1 1PDXA 1WE6A 2D07B 4YT0B 4BOSC 2N7JA 4MGIE 4O1NA 1HQRD 1HTQA 2JRIB 5C3JB 3IAS1 2V4LA 3RN9C 3TEXA 1N60A 1NYRA 1RM6C 1GG3A 2HTME 2SEBD 3KUDB 2KC2A 4BZAA 1P98A 3VVWB 1XLNA 2EKEC 1ACCA 3DHHC 3GOEA 2DBYA 4GOCA 3NY5A 1E6EB 4BFRA 4ZOHC 4C00A 1Q1OA 1HA5A 3UQAA 1UGJA 1UELA 1ZOYB 3ZTDA 4E71A 1I4RA 2BGFA 1FXIA 2KNBA 2RPVA 2Z0EB 2D11A 2JU6X 3UQBA 2KWCA 4XDDA 2Y5PA 1RFKA 4MACA 3ZRFA 4YSXB 1TKGA 1XQQA 4XWWA 1HZ6A 1ENFA 2BTEA 2D2QA 1D3ZA 2GBMA 3AE3B 1E90A 1C78A 1L7YA 2Z59B 3RFZB 4S17A 1F2RI 2N7DA 3A33B 4ZRPA 1KM7A 4XDCA 1ISNA 1L0YB 4HK2A 1JWMD 1T0RC 4ASWC 4DQOC 1WF9A 4J3OD 3SU8X 3PZDA 2FBWB 4B95A 4YTNB 3VDZA 2K39A 4CYEA 5DCNA 3VR8B 1IPGA 5CHFA 3EFUA 4I6NB 3CWIA 4M8NA 2JT4B 3V6EB 2IGGA 4JGHB 2O2VB 4GGQA 2FUHB 2I38A 1TKYA 2EELA 1XF5L 2Z8LA 4BVUC 2RPQA 2MP2B 2J42A 3NVWA 2SAKA 4FJYA 5HFYA 4IOIE 2W54A 1L4ZB 2MQJA 2RDBC 4HCPB 1SIJA 3IG3A 1ET6A 4EUTA 3EFCA 1SBBB 1YNTE 3AEFB 2BBCA 4K81A 1WXMA 4MDKE 4RCOA 4E74A 1SGHA 3AEAB 3EA6A 3M63B 1TY2A 5L83A 3RYTA 2FIDA 3KUCB 2O2VA 4IC7B 1OQYA 4A6QA 1L6UA 3BVGA 4B9KA 4RGNA 2KO3A 3NZUA 1NI3A 4NQLB 2M56B 4IWPA 1V97A 2MP2A 2LRWA 3L16A 2BS3B 3KYDD 4XE0A 4GLSC 5KHOA 3Q8BA 5IO9A 1C76A 4HROA 3ZKJC 5CHWA 1R4MI 3SD5A 4YXDB 4NAWB 2I1KA 2IJ0A 3B2GA 4WAAA 3JYUA 2DHZA 3QQ8B 1GB4A 2PKOA 2JX5A 1PGXA 2QDFA 2KACA 4RGMA 1VCBA 2KQ7A 3TEYA 3L17A 4LDTD 3AEBB 4YL8A 1TTNA 1V2YA 2DZJA 3DBHI 3ZJTA 3WCQA 3U8ZA 2B3AA 3AEDB 1NEKB 1IBXA 1QOBA 1IP9A 1NDDA 2L7RA 3GE3C 1RFAA 3N1ZC 2V1YA 1TS5A 1ZPSA 2J53A 2CU1A 4BKSD 2KHWB 2AYOB 3QAQA 4KKIA 3AE2B 1SB3C 1WRIA 1JMLA 2WXJA 3ZXRA 2WXHA 3QC8B 3RZWC 3H9DA 3NVVA 4FHKA 1WGGA 5G5HA 3QJZA 1QOFA 4YSYB 2JVCA 4LNFA 3VUYA 4F8CB 1N63A 4JIOU 2MLBA 2KOXA 2DLBA 1U4AA 3L4PA 5HKHA 4K1RB 1TT5B 2ONQA 2CHWA 1ZUD2 4K3BA 3KYCD 3TBLD 3ZRCA 4I6LB 4LJPB 3VHTC 2WDRB 1GB1A 1D5XC 5HI1A 2KQSA 4WJPA 1UH6A 3W9CB 2D3GA 2FCQA 2KN5A 1WJ4A 4PT5A 2DAFA 2NMQA 4TSSA 1SE2A 4LNKA 1UF0A 1MFWA 5IOIA 2K1FA 3RULA 4E3CA 2N0SB 4QAYA 4TKNA 2HJ8A 4P7IA 3UGBB 2L8JA 4ZHOA 4WH4A 1TS2A 4US9A 2W82A 3HVZA 2FNJB 4FJZA 3KVFB 4M00A 3IHPC 2I1JA 1YN5A 3DBLB 1MVKA 1DOIA 4II3B 2K22A 1IGDA 1HE8A 3RNCC 2N9XA 2LGSA 5FKAC 1V6EA 2X38A 3DWGC 4AUQC 5TSSA 2IO3B 3QX1A 2EKIA 1FMAD 4DHJD 2L0FA 1NBFC 3BYTB 2WU2B 2CR5A 2YEPB 3MC0B 5J17A 2W3SA 3EC8A 2WXNA 1YX6B 1LQBA 3IBEA 4NJ7A 4YWGG 4JX1C 3ENEA 4I6PA 1AW7A 1F2RC 2L1AA 1CK1A 3ZJVA 4JL9A 3BK1A 3VH4B 1Z5SB 1XD3B 1V49A 4HDOA 1Q5WB 3ZDMC 3LB8C 4NJ6A 2LMCA 3A9KB 3VTUA 3W2DA 1QQRA 2DYMA 3ZXVA 1WSPA 4GDLA 4K7UA 4EKUA 3X0WA 4N58A 5GMVA 1WJNA 3ALBA 1PGAA 2N9EB 2XN9C 3URYA 3ONSA 4GIVA 4OZAA 2L76A 1JALA 2BYTA 3V60A 1SSNA 4HKQA 1F9JA 3TIXA 3NRZA 5CHVC 2NBVB 2FCMA 1MI0A 2N1WA 3PTFC 3TSSA 2A4ZA 4LNIA 3N30A 1HZ5A 1ZKHA 3EGRA 2C7HA 2JY6A 4BBNC 1E8YA 3TJPA 5TR5A 3NZ3A 3X23A 3BINA 1G6JA 4KZCA 2WXKA 5LNK1 4WWMA 2K3UA 3OAWA 2AQ2B 3C0RB 2D10A 4ANVA 3T9LA 5EE0A 3A9KA 3PZ8A 3RT3B 1QF6A 1QT9A 3DWMA 3PLUA 2XNAC
chains in the Genus database with same CATH topology
4DDGD 3DQVA 2JRIB 2LZ6A 4BKGA 1WGHA 2V4LA 4MELA 3VFKA 4DXAB 2KFKA 1GG3A 4GU2A 3DVGX 3KUDB 2KKCA 2KFJA 2KC2A 1P98A 3VVWB 3EECA 3QHTA 3PSEB 2EKEC 3GOEA 2IO0B 5LXIB 3B08A 3PRPB 1V81A 2KD0A 3ZVVA 2FAZA 4GOCA 4XZ4A 2IY1B 2KMCA 1P0RA 3NY5A 2JWZA 4HDQA 4BFRA 3M62B 2MRPA 4KSLC 4ZRIA 1Q1OA 4IM3A 2KTRB 3UQAA 1AARA 2ZNVB 1UELA 4W9EA 2A5UA 1J8CA 2WDTB 3ZTDA 2AEHA 4B6WA 2LI5A 4E71A 1J19A 2BGFA 3L0WB 3DVNV 2KNBA 3V62A 3HIZA 2Z0EB 2D11A 2KDIA 3UQBA 3WIMA 2N1VA 1OTRB 2KWCA 3K9OB 3KW5B 4RM9A 3ZNHB 4HLEA 4ANWA 1EUVB 2J0MA 3A4RA 3WANA 4X57B 4G11A 3ZRFA 3AU4A 1WJUA 2JF5A 2DYOA 1E8XA 1XQQA 3DVGY 1C3TA 2FCSA 1YX5B 2J0KA 4EZKA 3WALA 4DBGA 3B1LX 5CTRC 2KJHB 2K8HA 2D2QA 1D3ZA 2GBMA 1E90A 1L7YA 2Z59B 1YD8U 3MJWA 4FA6A 2N7DA 3N3KB 3A33B 3QA8A 4MM3A 1KM7A 2KMAA 1ISNA 2KK8A 2PEAA 4HK2A 4HWIB 3KH0A 4ASWC 2MWSB 1WF9A 4GN1A 3APDA 1ZW7A 2UWQA 3PZDA 3SU8X 3ECIA 1V86A 3CSTA 2NPTB 2K8CA 3H6NA 4B95A 2XEWA 2RSUA 3WAMA 2BYEA 3VDZA 2K39A 4CYEA 2RD0A 3PS6A 2CHZA 2IYDB 4KV2A 5DCNA 4URKA 4CO7A 2JPHA 1KJTA 1UGMA 2IO2B 1I42A 1IPGA 5CHFA 3EFUA 4I6NB 3V6EB 4M8NA 2JT4B 5DPRA 4FBJB 3VQIA 1KLVA 2KDEB 3JSVB 4JGHB 2O2VB 3VH3B 4GGQA 2FUHB 5C1ZA 2KXJA 2LWPA 1OEYJ 2MW5A 3B0AA 2LXCA 1LFDA 2IY0B 2YVCA 1WIAA 5LXHA 3VAWA 2LUEA 2WX1A 2DAJA 1EF5A 4BVUC 2RPQA 3H7PA 1OEYA 2MP2B 4JLCA 3P2BA 3MHSD 1WJ6A 3QK0A 4II2B 4DWFA 4FJYA 2XBBC 4KSKC 4FLHA 2GBJA 4LCDE 5JH5C 4A3OA 1WGYA 4BOZB 2VRRB 4NNJB 4FJVB 2BPSA 4TQ1A 4HVBA 4MJSA 1UD7A 3UIPB 1TZ1A 2MQJA 2KJ6A 4HCPB 3UINB 2BF8B 3IG3A 2REXA 5E6PA 1L2NA 4EUTA 2MBBB 5AZFA 3OJ3A 1T0YA 3OLMD 1WM2A 5D2MB 3VTWA 4W9HA 3RD2A 2LRUA 3QCAA 3SHQA 4MEMA 4K81A 3JVZX 4KIKB 1WXMA 5CX3A 5AZHA 4MDKE 4LDTB 2QHOA 2L0TA 2IBIB 4E74A 1SGHA 2C7NB 1UBIA 3VXWA 2NPTA 1V9JA 2R2QA 2ZPNA 3H1UA 3APFA 4RM8A 3PGEA 4KZ0A 4WWPA 1UZXB 3M63B 3AI5A 4TUUA 1WGDA 2BWES 5L83A 1IYFA 4KDIC 4WJNA 3K9PB 2JRHA 3RYTA 2FIDA 4N9F4 3KUCB 3JSVA 5G2NA 2O2VA 4IC7B 2G4DB 3PT2B 1E7VA 2BWFA 1OQYA 1A5RA 4B9KA 2KWVB 3DOWA 2M4NA 1H4RA 2NBUA 1J0GA 1LXDA 2AL6A 5G55A 1YJ1A 3L10B 2KO3A 3NZUA 4F1SA 1WX7A 4NQLB 2K6DB 4IWPA 3DPDA 3A1QB 5FR6A 4GB9A 2MP2A 2LRWA 3L16A 2WX0A 3CMMB 4IM2A 1WXAA 2EMSA 3KYDD 4W9FA 2PJHA 5KHOA 4TV3A 3ZUNA 2DX5B 4DHZB 3ZNID 2KJRA 1TGZB 3ZKJC 3MTNB 2MX2A 5CHWA 1R4MI 1WRDB 1V5OA 3SD5A 1JRUA 4GSWA 4NAWB 2I1KA 2ZCCA 3UF8A 4GDLB 4WJQA 3LJ3A 4WAAA 3WA0A 5E6OA 1SE9A 1BT0A 2DHZA 2KANA 3JYUA 3QQ8B 2KDBA 2RR9A 2KX3A 2BKRB 4PS8A 3A4SC 4ZDVA 4W9JA 4IWQA 4GMVA 2LGYA 4J6IA 3O65B 1RLFA 4TQ0A 2KZRA 4KIKA 2KLGA 4ZRKA 2KQ7A 1VCBA 2DZMA 2ZCBA 3L17A 2ZVOA 4OVVA 1GC6A 4LDTD 1P1AA 4YL8A 4HPLB 1TTNA 1V2YA 4PYZA 2DZJA 2Y5BB 4W9KA 3DBHI 4BOSC 1RRBA 1ZGUB 4IG7B 3DBLI 3U8ZA 2B3AA 1YQBA 3PLVA 1LM8B 2GBNA 3W1YA 4GDKB 1YIWA 1CMXB 1WMHB 1IP9A 1NDDA 1WI0A 2L7RA 3DDCB 2ZNVC 5IAAC 2JZZA 2MCNB 3U7DA 2G45B 1RFAA 5C23A 2V1YA 3VUWA 4ANXA 1WGRA 3BY4B 3PV1A 2CU1A 5AZGA 4EZLA 3QARA 5JHBA 3RZFA 4BKSD 2KHWB 4BKTA 2AYOB 3WAOA 3A1QA 3QAQA 2N9PC 4ANUA 3TL5A 2KDFB 2KTRA 2LASA 2KLCA 2EMTA 3QC8B 3RZWC 3H9DA 5D7GA 5EDSA 2ZEQA 4FHKA 5J2RA 3L54A 4XX5A 3T8MA 1P9DU 3QWZB 1WGGA 1WX9A 3QJZA 3TMPB 4K7SA 3DBSA 4WQOB 3D32A 2C60A 2JVCA 4EOYA 4HPMB 3VUYA 4F8CB 1WXSA 4F7ZA 1S1QB 4JIOU 4G50A 2MLBA 2KOXA 1U4AA 2CKHB 2N7EA 5HKHA 2KFKB 2ZPYA 2KC1A 4K1RB 2HE7A 3WAPA 3ZW3A 1PQSA 2CHWA 4M0WB 2J7QB 3KYCD 3TBLD 5D94A 3ZRCA 4I6LB 3ML9A 4LJPB 3VHTC 2NVUI 1WY8A 2R2OA 1UBQA 3RUIB 2J0JA 4G3XB 1X1MA 3V61A 3DCGA 1I35A 2KQSA 3APCA 4ICVA 1FXTB 4WJPA 2C7MB 4GDKA 4FN2A 1UH6A 2KWUB 1WR6E 3PRMB 2D3GA 2FCQA 2W9NA 3HK0A 1V5TA 3ZIMA 2KN5A 4G0NB 1WJ4A 3ZTCA 2O6VB 4MGKE 3AULA 2DAFA 2M1MA 1Q0WB 2K8BA 1E8WA 2N4FA 5E6NA 4IM0A 5BO4B 1E7UA 3H7SA 3A9JB 2K1FA 2KVRA 5L95C 3RULA 4E3CA 2V3SA 3EHVA 3NS8A 2PE6B 3IFWB 2G4SA 2DENB 4TKNA 2HJ8A 1WZ3A 3ML8A 4JQWC 2DYBA 4P7IA 4W9GA 3VUXA 1R4NI 2NR2A 3UGBB 2L8JA 4AP4C 2FNJB 2LVPA 2L3ZA 4FJZA 4RMAA 3LDZE 4PS3A 3KVFB 3S2AA 2DZIA 3IHPC 3ZLZA 3SDLC 3OJ4B 2I1JA 2BYFA 1K8RB 3GZNI 4II3B 4A20A 1HE8A 4HJKA 4AWJA 2N9XA 3RCZA 5JHAA 2Z0DB 2CS4A 1Y8RC 1V6EA 5IA7A 1WFYA 5KHQA 1S3SG 2M8SA 4AUQC 4ZYNA 1V80A 3DBRI 4W9LA 2IO3B 3PHXB 3QX1A 3PREA 3ZNZB 2FIFA 4XC2A 4DHJD 2K6QA 2G3QB 3L13A 2WYQA 2L0FA 1NBFC 4EFOA 4BBNF 2JUOA 2L00B 2CR5A 5J17A 2BKFA 3Q3JA 2FCNA 2LGXA 3EC8A 4IW0A 1YX6B 2O6VD 3AU5A 2MA9B 2O6VA 1LQBA 3IBEA 4NJ7A 2LD9A 4HCNB 3AXCA 4IUMB 2GBRA 5LLIA 5JZEB 2XK5B 4WWNA 2M17A 3H7PB 1RAXA 1WYWB 3VTVA 1GUAB 3CF6E 3A9JA 3ENEA 4I6PA 2HD5B 4EEWA 2NBWB 4W9DA 3U30A 5DPTA 2JXXA 4NQKE 2LXAA 3R7RA 4PYUA 4AJYB 2MSED 2ZZPB 1QZEA 2L05A 4A3PA 1Z2MA 3M95A 3ZNGC 5AEKB 4JL9A 4FADA 2UYZB 4MJSB 1WXVA 3VH4B 4OVUA 1OGWA 1WR1A 1GJZA 3NZSA 4CHKA 1WM3A 4AOFA 1Z5SB 3R3MA 1XT9B 1VD2A 1V49A 1XD3B 4HDOA 4K7WA 4BKSA 3V6CB 1Q5WB 2OOBB 3JW0X 3ZDMC 2NS5A 2M0XA 2NCNA 5DPWA 2K25A 4NJ6A 1WH3A 2AWTA 2HTHA 4IWOA 1KOTA 3A9KB 3VTUA 1WX8A 3L08A 4NAWA 2DYMA 2LVOA 2PPHA 1E8ZA 2LJ5A 4AJWA 3QIJA 3N32A 3PVLA 1E5WA 4GDLA 4K7UA 4ICUA 3HM6X 4EKUA 4DK5A 4GXBA 4MH0E 1P3QU 1WE7A 4KDLB 1TBEA 3R66C 4MSQB 5D6JB 3IVFA 4WJOA 3X0WA 2LGDA 5GMVA 4ZRJA 1WJNA 1C1YB 3ALBA 1M94A 2N9EB 3ZDTA 2MBEA 3ONSA 2KX0A 4DDID 4GIVA 4W9IA 3PHWB 3KUZA 3Q3FA 4MGZE 2L76A 4HXDA 4DHZE 3NOBA 3V60A 5J18A 4FHJA 1H8CA 1F9JA 2IZVB 2KTFA 1GNUA 3TIXA 4DHJB 4W9CA 1EO6A 3W1SC 5CHVC 2YLMA 2NBVB 4MSMB 2MBHA 1NI2A 2XK5A 2FCMA 2WWZA 4LJOB 1EF1A 1GC7A 2MBOA 4M8MA 2PE9A 2RGFA 4NY0A 2MBQA 2N1WA 5DPSA 1WMHA 2JZ3B 3DVNU 3ZO5B 3PTFC 2A4ZA 3N30A 2ZJDA 1ZKHA 2DZKA 1MG8A 3CSFA 4FULA 3NHEB 1SIFA 3UIOB 2C7HA 2JY6A 3HHMA 2GBKA 4BBNC 2BYVE 3W1SA 1WZ0A 2CHXA 1E8YA 2AL3A 3TJPA 2ASQA 5TR5A 4PS7A 2C9WB 2ZVNA 2GOWA 3M3JA 3X23A 2GMIC 3BINA 4KVGB 2IO1B 4KZCA 3TCAA 1G6JA 4WWOA 3PRZA 3HM3A 3I3TB 3OAWA 3PPAA 3R7QA 4MGYE 3C0RB 2C5LC 2D10A 2LVQA 4ANVA 1WE6A 3T9LA 2D07B 4EZJA 3A9KA 2OJRA 3RT3B 3PLUA 4NPNA 4MGIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DDG D;  3DQV A;  2JRI B;  2LZ6 A;  4BKG A;  1WGH A;  2V4L A;  4MEL A;  3VFK A;  4DXA B;  2KFK A;  1GG3 A;  4GU2 A;  3DVG X;  3KUD B;  2KKC A;  2KFJ A;  2KC2 A;  1P98 A;  3VVW B;  3EEC A;  3QHT A;  3PSE B;  2EKE C;  3GOE A;  2IO0 B;  5LXI B;  3B08 A;  3PRP B;  1V81 A;  2KD0 A;  3ZVV A;  2FAZ A;  4GOC A;  4XZ4 A;  2IY1 B;  2KMC A;  1P0R A;  3NY5 A;  2JWZ A;  4HDQ A;  4BFR A;  3M62 B;  2MRP A;  4KSL C;  4ZRI A;  1Q1O A;  4IM3 A;  2KTR B;  3UQA A;  1AAR A;  2ZNV B;  1UEL A;  4W9E A;  2A5U A;  1J8C A;  2WDT B;  3ZTD A;  2AEH A;  4B6W A;  2LI5 A;  4E71 A;  1J19 A;  2BGF A;  3L0W B;  3DVN V;  2KNB A;  3V62 A;  3HIZ A;  2Z0E B;  2D11 A;  2KDI A;  3UQB A;  3WIM A;  2N1V A;  1OTR B;  2KWC A;  3K9O B;  3KW5 B;  4RM9 A;  3ZNH B;  4HLE A;  4ANW A;  1EUV B;  2J0M A;  3A4R A;  3WAN A;  4X57 B;  4G11 A;  3ZRF A;  3AU4 A;  1WJU A;  2JF5 A;  2DYO A;  1E8X A;  1XQQ A;  3DVG Y;  1C3T A;  2FCS A;  1YX5 B;  2J0K A;  4EZK A;  3WAL A;  4DBG A;  3B1L X;  5CTR C;  2KJH B;  2K8H A;  2D2Q A;  1D3Z A;  2GBM A;  1E90 A;  1L7Y A;  2Z59 B;  1YD8 U;  3MJW A;  4FA6 A;  2N7D A;  3N3K B;  3A33 B;  3QA8 A;  4MM3 A;  1KM7 A;  2KMA A;  1ISN A;  2KK8 A;  2PEA A;  4HK2 A;  4HWI B;  3KH0 A;  4ASW C;  2MWS B;  1WF9 A;  4GN1 A;  3APD A;  1ZW7 A;  2UWQ A;  3PZD A;  3SU8 X;  3ECI A;  1V86 A;  3CST A;  2NPT B;  2K8C A;  3H6N A;  4B95 A;  2XEW A;  2RSU A;  3WAM A;  2BYE A;  3VDZ A;  2K39 A;  4CYE A;  2RD0 A;  3PS6 A;  2CHZ A;  2IYD B;  4KV2 A;  5DCN A;  4URK A;  4CO7 A;  2JPH A;  1KJT A;  1UGM A;  2IO2 B;  1I42 A;  1IPG A;  5CHF A;  3EFU A;  4I6N B;  3V6E B;  4M8N A;  2JT4 B;  5DPR A;  4FBJ B;  3VQI A;  1KLV A;  2KDE B;  3JSV B;  4JGH B;  2O2V B;  3VH3 B;  4GGQ A;  2FUH B;  5C1Z A;  2KXJ A;  2LWP A;  1OEY J;  2MW5 A;  3B0A A;  2LXC A;  1LFD A;  2IY0 B;  2YVC A;  1WIA A;  5LXH A;  3VAW A;  2LUE A;  2WX1 A;  2DAJ A;  1EF5 A;  4BVU C;  2RPQ A;  3H7P A;  1OEY A;  2MP2 B;  4JLC A;  3P2B A;  3MHS D;  1WJ6 A;  3QK0 A;  4II2 B;  4DWF A;  4FJY A;  2XBB C;  4KSK C;  4FLH A;  2GBJ A;  4LCD E;  5JH5 C;  4A3O A;  1WGY A;  4BOZ B;  2VRR B;  4NNJ B;  4FJV B;  2BPS A;  4TQ1 A;  4HVB A;  4MJS A;  1UD7 A;  3UIP B;  1TZ1 A;  2MQJ A;  2KJ6 A;  4HCP B;  3UIN B;  2BF8 B;  3IG3 A;  2REX A;  5E6P A;  1L2N A;  4EUT A;  2MBB B;  5AZF A;  3OJ3 A;  1T0Y A;  3OLM D;  1WM2 A;  5D2M B;  3VTW A;  4W9H A;  3RD2 A;  2LRU A;  3QCA A;  3SHQ A;  4MEM A;  4K81 A;  3JVZ X;  4KIK B;  1WXM A;  5CX3 A;  5AZH A;  4MDK E;  4LDT B;  2QHO A;  2L0T A;  2IBI B;  4E74 A;  1SGH A;  2C7N B;  1UBI A;  3VXW A;  2NPT A;  1V9J A;  2R2Q A;  2ZPN A;  3H1U A;  3APF A;  4RM8 A;  3PGE A;  4KZ0 A;  4WWP A;  1UZX B;  3M63 B;  3AI5 A;  4TUU A;  1WGD A;  2BWE S;  5L83 A;  1IYF A;  4KDI C;  4WJN A;  3K9P B;  2JRH A;  3RYT A;  2FID A;  4N9F 4;  3KUC B;  3JSV A;  5G2N A;  2O2V A;  4IC7 B;  2G4D B;  3PT2 B;  1E7V A;  2BWF A;  1OQY A;  1A5R A;  4B9K A;  2KWV B;  3DOW A;  2M4N A;  1H4R A;  2NBU A;  1J0G A;  1LXD A;  2AL6 A;  5G55 A;  1YJ1 A;  3L10 B;  2KO3 A;  3NZU A;  4F1S A;  1WX7 A;  4NQL B;  2K6D B;  4IWP A;  3DPD A;  3A1Q B;  5FR6 A;  4GB9 A;  2MP2 A;  2LRW A;  3L16 A;  2WX0 A;  3CMM B;  4IM2 A;  1WXA A;  2EMS A;  3KYD D;  4W9F A;  2PJH A;  5KHO A;  4TV3 A;  3ZUN A;  2DX5 B;  4DHZ B;  3ZNI D;  2KJR A;  1TGZ B;  3ZKJ C;  3MTN B;  2MX2 A;  5CHW A;  1R4M I;  1WRD B;  1V5O A;  3SD5 A;  1JRU A;  4GSW A;  4NAW B;  2I1K A;  2ZCC A;  3UF8 A;  4GDL B;  4WJQ A;  3LJ3 A;  4WAA A;  3WA0 A;  5E6O A;  1SE9 A;  1BT0 A;  2DHZ A;  2KAN A;  3JYU A;  3QQ8 B;  2KDB A;  2RR9 A;  2KX3 A;  2BKR B;  4PS8 A;  3A4S C;  4ZDV A;  4W9J A;  4IWQ A;  4GMV A;  2LGY A;  4J6I A;  3O65 B;  1RLF A;  4TQ0 A;  2KZR A;  4KIK A;  2KLG A;  4ZRK A;  2KQ7 A;  1VCB A;  2DZM A;  2ZCB A;  3L17 A;  2ZVO A;  4OVV A;  1GC6 A;  4LDT D;  1P1A A;  4YL8 A;  4HPL B;  1TTN A;  1V2Y A;  4PYZ A;  2DZJ A;  2Y5B B;  4W9K A;  3DBH I;  4BOS C;  1RRB A;  1ZGU B;  4IG7 B;  3DBL I;  3U8Z A;  2B3A A;  1YQB A;  3PLV A;  1LM8 B;  2GBN A;  3W1Y A;  4GDK B;  1YIW A;  1CMX B;  1WMH B;  1IP9 A;  1NDD A;  1WI0 A;  2L7R A;  3DDC B;  2ZNV C;  5IAA C;  2JZZ A;  2MCN B;  3U7D A;  2G45 B;  1RFA A;  5C23 A;  2V1Y A;  3VUW A;  4ANX A;  1WGR A;  3BY4 B;  3PV1 A;  2CU1 A;  5AZG A;  4EZL A;  3QAR A;  5JHB A;  3RZF A;  4BKS D;  2KHW B;  4BKT A;  2AYO B;  3WAO A;  3A1Q A;  3QAQ A;  2N9P C;  4ANU A;  3TL5 A;  2KDF B;  2KTR A;  2LAS A;  2KLC A;  2EMT A;  3QC8 B;  3RZW C;  3H9D A;  5D7G A;  5EDS A;  2ZEQ A;  4FHK A;  5J2R A;  3L54 A;  4XX5 A;  3T8M A;  1P9D U;  3QWZ B;  1WGG A;  1WX9 A;  3QJZ A;  3TMP B;  4K7S A;  3DBS A;  4WQO B;  3D32 A;  2C60 A;  2JVC A;  4EOY A;  4HPM B;  3VUY A;  4F8C B;  1WXS A;  4F7Z A;  1S1Q B;  4JIO U;  4G50 A;  2MLB A;  2KOX A;  1U4A A;  2CKH B;  2N7E A;  5HKH A;  2KFK B;  2ZPY A;  2KC1 A;  4K1R B;  2HE7 A;  3WAP A;  3ZW3 A;  1PQS A;  2CHW A;  4M0W B;  2J7Q B;  3KYC D;  3TBL D;  5D94 A;  3ZRC A;  4I6L B;  3ML9 A;  4LJP B;  3VHT C;  2NVU I;  1WY8 A;  2R2O A;  1UBQ A;  3RUI B;  2J0J A;  4G3X B;  1X1M A;  3V61 A;  3DCG A;  1I35 A;  2KQS A;  3APC A;  4ICV A;  1FXT B;  4WJP A;  2C7M B;  4GDK A;  4FN2 A;  1UH6 A;  2KWU B;  1WR6 E;  3PRM B;  2D3G A;  2FCQ A;  2W9N A;  3HK0 A;  1V5T A;  3ZIM A;  2KN5 A;  4G0N B;  1WJ4 A;  3ZTC A;  2O6V B;  4MGK E;  3AUL A;  2DAF A;  2M1M A;  1Q0W B;  2K8B A;  1E8W A;  2N4F A;  5E6N A;  4IM0 A;  5BO4 B;  1E7U A;  3H7S A;  3A9J B;  2K1F A;  2KVR A;  5L95 C;  3RUL A;  4E3C A;  2V3S A;  3EHV A;  3NS8 A;  2PE6 B;  3IFW B;  2G4S A;  2DEN B;  4TKN A;  2HJ8 A;  1WZ3 A;  3ML8 A;  4JQW C;  2DYB A;  4P7I A;  4W9G A;  3VUX A;  1R4N I;  2NR2 A;  3UGB B;  2L8J A;  4AP4 C;  2FNJ B;  2LVP A;  2L3Z A;  4FJZ A;  4RMA A;  3LDZ E;  4PS3 A;  3KVF B;  3S2A A;  2DZI A;  3IHP C;  3ZLZ A;  3SDL C;  3OJ4 B;  2I1J A;  2BYF A;  1K8R B;  3GZN I;  4II3 B;  4A20 A;  1HE8 A;  4HJK A;  4AWJ A;  2N9X A;  3RCZ A;  5JHA A;  2Z0D B;  2CS4 A;  1Y8R C;  1V6E A;  5IA7 A;  1WFY A;  5KHQ A;  1S3S G;  2M8S A;  4AUQ C;  4ZYN A;  1V80 A;  3DBR I;  4W9L A;  2IO3 B;  3PHX B;  3QX1 A;  3PRE A;  3ZNZ B;  2FIF A;  4XC2 A;  4DHJ D;  2K6Q A;  2G3Q B;  3L13 A;  2WYQ A;  2L0F A;  1NBF C;  4EFO A;  4BBN F;  2JUO A;  2L00 B;  2CR5 A;  5J17 A;  2BKF A;  3Q3J A;  2FCN A;  2LGX A;  3EC8 A;  4IW0 A;  1YX6 B;  2O6V D;  3AU5 A;  2MA9 B;  2O6V A;  1LQB A;  3IBE A;  4NJ7 A;  2LD9 A;  4HCN B;  3AXC A;  4IUM B;  2GBR A;  5LLI A;  5JZE B;  2XK5 B;  4WWN A;  2M17 A;  3H7P B;  1RAX A;  1WYW B;  3VTV A;  1GUA B;  3CF6 E;  3A9J A;  3ENE A;  4I6P A;  2HD5 B;  4EEW A;  2NBW B;  4W9D A;  3U30 A;  5DPT A;  2JXX A;  4NQK E;  2LXA A;  3R7R A;  4PYU A;  4AJY B;  2MSE D;  2ZZP B;  1QZE A;  2L05 A;  4A3P A;  1Z2M A;  3M95 A;  3ZNG C;  5AEK B;  4JL9 A;  4FAD A;  2UYZ B;  4MJS B;  1WXV A;  3VH4 B;  4OVU A;  1OGW A;  1WR1 A;  1GJZ A;  3NZS A;  4CHK A;  1WM3 A;  4AOF A;  1Z5S B;  3R3M A;  1XT9 B;  1VD2 A;  1V49 A;  1XD3 B;  4HDO A;  4K7W A;  4BKS A;  3V6C B;  1Q5W B;  2OOB B;  3JW0 X;  3ZDM C;  2NS5 A;  2M0X A;  2NCN A;  5DPW A;  2K25 A;  4NJ6 A;  1WH3 A;  2AWT A;  2HTH A;  4IWO A;  1KOT A;  3A9K B;  3VTU A;  1WX8 A;  3L08 A;  4NAW A;  2DYM A;  2LVO A;  2PPH A;  1E8Z A;  2LJ5 A;  4AJW A;  3QIJ A;  3N32 A;  3PVL A;  1E5W A;  4GDL A;  4K7U A;  4ICU A;  3HM6 X;  4EKU A;  4DK5 A;  4GXB A;  4MH0 E;  1P3Q U;  1WE7 A;  4KDL B;  1TBE A;  3R66 C;  4MSQ B;  5D6J B;  3IVF A;  4WJO A;  3X0W A;  2LGD A;  5GMV A;  4ZRJ A;  1WJN A;  1C1Y B;  3ALB A;  1M94 A;  2N9E B;  3ZDT A;  2MBE A;  3ONS A;  2KX0 A;  4DDI D;  4GIV A;  4W9I A;  3PHW B;  3KUZ A;  3Q3F A;  4MGZ E;  2L76 A;  4HXD A;  4DHZ E;  3NOB A;  3V60 A;  5J18 A;  4FHJ A;  1H8C A;  1F9J A;  2IZV B;  2KTF A;  1GNU A;  3TIX A;  4DHJ B;  4W9C A;  1EO6 A;  3W1S C;  5CHV C;  2YLM A;  2NBV B;  4MSM B;  2MBH A;  1NI2 A;  2XK5 A;  2FCM A;  2WWZ A;  4LJO B;  1EF1 A;  1GC7 A;  2MBO A;  4M8M A;  2PE9 A;  2RGF A;  4NY0 A;  2MBQ A;  2N1W A;  5DPS A;  1WMH A;  2JZ3 B;  3DVN U;  3ZO5 B;  3PTF C;  2A4Z A;  3N30 A;  2ZJD A;  1ZKH A;  2DZK A;  1MG8 A;  3CSF A;  4FUL A;  3NHE B;  1SIF A;  3UIO B;  2C7H A;  2JY6 A;  3HHM A;  2GBK A;  4BBN C;  2BYV E;  3W1S A;  1WZ0 A;  2CHX A;  1E8Y A;  2AL3 A;  3TJP A;  2ASQ A;  5TR5 A;  4PS7 A;  2C9W B;  2ZVN A;  2GOW A;  3M3J A;  3X23 A;  2GMI C;  3BIN A;  4KVG B;  2IO1 B;  4KZC A;  3TCA A;  1G6J A;  4WWO A;  3PRZ A;  3HM3 A;  3I3T B;  3OAW A;  3PPA A;  3R7Q A;  4MGY E;  3C0R B;  2C5L C;  2D10 A;  2LVQ A;  4ANV A;  1WE6 A;  3T9L A;  2D07 B;  4EZJ A;  3A9K A;  2OJR A;  3RT3 B;  3PLU A;  4NPN A;  4MGI E; 
#chains in the Genus database with same CATH topology
 4DDG D;  3EUB 2;  4BKG A;  1WGH A;  2WU5 B;  1ZP0 B;  2KFK A;  3DVG X;  5AUI A;  1F52 A;  1V81 A;  2KD0 A;  2FAZ A;  2IY1 B;  2JWZ A;  2TSS A;  4HDQ A;  3M62 B;  4ZRI A;  1KLU D;  2KQ4 X;  4W9E A;  1VRA B;  3L0W B;  2I2Y A;  1C4A A;  2JYT A;  3K9O B;  3KW5 B;  4RM9 A;  1SE3 A;  4ANW A;  2J0M A;  4P1C C;  3WAN A;  2G1E A;  3DVG Y;  2FCS A;  4C56 C;  4EZK A;  1PFD A;  3B1L X;  5CTR C;  5BMH A;  2RMM A;  1YD8 U;  3MJW A;  3FKY A;  3QA8 A;  4MM3 A;  2KMA A;  3P4Q B;  2MWS B;  2D5G A;  4GN1 A;  1ZW7 A;  3OG5 A;  1V86 A;  2E6X A;  2NPT B;  3PO0 A;  2XEW A;  2RSU A;  2BYE A;  2CHZ A;  4URK A;  2WXR A;  3RI7 C;  4FBJ B;  4IDI A;  1KLV A;  2KDE B;  4JWS C;  5H92 C;  1JCK B;  2LWP A;  2LXC A;  1LFD A;  3T3O A;  2YVC A;  1YQ3 B;  1DGJ A;  5LXH A;  2DAJ A;  2WDQ B;  1EWY C;  1E10 A;  1FCL A;  3MHS D;  4DWF A;  2PMV A;  3C19 A;  4KSK C;  4FLH A;  5JH5 C;  4A3O A;  2WXM A;  4NNJ B;  2JSV X;  3AM9 A;  2BPS A;  1UD7 A;  3MC9 A;  1UNS A;  2RDG A;  4WAF A;  3UIN B;  2REX A;  5E6P A;  2MBB B;  3FC4 A;  2INP E;  1KRH A;  3VTW A;  1XCQ L;  1WM2 A;  4UDU C;  2LRU A;  1HEZ E;  3Q8C A;  3JVZ X;  4KIK B;  1V8C A;  3AE6 B;  5CX3 A;  5AZH A;  4LDT B;  2QHO A;  2L0T A;  3H8H A;  1UBI A;  3VXW A;  2NPT A;  1V9J A;  3SEB A;  3H1U A;  3PGE A;  3P42 A;  1KLG D;  4P1B C;  3AI5 A;  1IYF A;  4R3D A;  3K9P B;  4USA A;  1SJE D;  4JWU C;  4PK1 A;  1E7V A;  2BWF A;  3DOW A;  3CIR B;  4LNO A;  1H4R A;  1STE A;  3Q2A C;  3L10 B;  3AEE B;  3O13 A;  5FR6 A;  4GB9 A;  3KWL A;  4W9F A;  2EMS A;  3J9C A;  3ZUN A;  1VLB A;  2KJR A;  2KDM A;  2MX2 A;  1V5O A;  1JRU A;  4GSW A;  3UI3 A;  3UF8 A;  1L4D B;  3LJ3 A;  2KDB A;  2BKR B;  4J6I A;  2LGY A;  3N1X C;  4TQ0 A;  1JRP A;  2JWU A;  2KZR A;  4KIK A;  2DZM A;  4OVV A;  1ROE A;  1P1A A;  2BW2 A;  4HPL B;  4PYZ A;  4W9K A;  1UUP A;  3NVZ A;  3DBL I;  1YMH E;  3P4P B;  2W55 A;  1LM8 B;  3W1Y A;  4GDK B;  1V1O A;  3DHG C;  2WXP A;  3MHZ A;  4P16 A;  3BVZ A;  3RNA C;  4ANX A;  4A9A A;  3BY4 B;  4A55 A;  3PV1 A;  1KTK A;  5AZG A;  1NEN B;  3U52 E;  2JZP A;  1P7F A;  4H2A A;  4ANU A;  4C80 A;  5D7G A;  1ESF A;  2V4I B;  3L54 A;  4XX5 A;  3T8M A;  1QLB B;  1DYQ A;  3QWZ B;  1WX9 A;  4K7S A;  2C60 A;  4HPM B;  4G50 A;  3ZW3 A;  1UWX A;  4M0W B;  5IKC M;  4AS1 A;  3ML9 A;  1XLQ A;  1WY8 A;  2INC C;  5HG2 A;  3RUI B;  3Q69 A;  2V3N A;  4WUR A;  1VZ7 A;  4ICV A;  2C7M B;  4GDK A;  2ICI A;  3MFG A;  3HK0 A;  1V5T A;  3ZIM A;  4G0N B;  2LHD A;  3AUL A;  2M1M A;  2WXF A;  1T0Q C;  1E8W A;  1VJK A;  2N4F A;  5E6N A;  2QIE B;  2V3S A;  1B9R A;  1GAQ B;  2G4S A;  2DYB A;  3VUX A;  2BB6 A;  4ACF A;  3W5V B;  3AE8 B;  1E7P B;  1MPE A;  3OJ4 B;  1QKZ A;  2BYF A;  1K8R B;  4AWJ A;  1LO5 D;  1D5Z C;  3Q3O C;  1Y8R C;  5IA7 A;  1WFY A;  5EE3 A;  2VH1 A;  1L5P A;  1YJJ A;  3ZNZ B;  2GRI A;  3L13 A;  2WYQ A;  2GLS A;  4C4V B;  4EFO A;  3Q14 C;  1TJE A;  4K3C A;  1OQQ A;  2VH2 A;  2BKF A;  3Q3J A;  2BVC A;  1XO3 A;  2FCN A;  3NJT A;  1D5M C;  5FK9 C;  3BII D;  4XWT A;  3AXC A;  4B0M A;  5JZE B;  2XK5 B;  4WWN A;  1ZE3 D;  3H7P B;  2MH7 A;  3Q6B A;  3VTV A;  3CF6 E;  2WXI A;  2NBW B;  2K0P A;  4W9D A;  5DPT A;  3R7R A;  3V05 A;  4AJY B;  1QZE A;  1T5X D;  2L05 A;  1F77 A;  1XEE A;  2UYZ B;  1UWM A;  4MJS B;  2AQ3 B;  1I7H A;  3ZGZ A;  1GJZ A;  1RYJ A;  3NZS A;  1OQR A;  4CHK A;  2RDH A;  2PVO D;  1M4V A;  3ZQ4 A;  4M01 A;  2NS5 A;  2NCN A;  2QCZ A;  1PGB A;  5DPW A;  2AWT A;  2HTH A;  2WDV B;  3L08 A;  4NAW A;  2QIL A;  1E8Z A;  3ABV B;  1D4B A;  1BXT A;  3QIJ A;  3VR9 B;  4DK5 A;  1P3Q U;  1WE7 A;  4MSQ B;  3R66 C;  1F0Z A;  2BQQ A;  1C1Y B;  1M94 A;  3RPF C;  4C4V A;  4DDI D;  1R4N B;  4WQM A;  4W9I A;  4DHZ E;  3NOB A;  5J18 A;  2KTF A;  4W9C A;  4KX6 B;  3W1S C;  4MSM B;  2XK5 A;  2WWZ A;  4M8M A;  3GZN B;  1VR9 A;  2PE9 A;  4RH6 A;  2V0G A;  2LFI A;  5DPS A;  2JZ3 B;  3DVN U;  3ZO5 B;  2HJ1 A;  3DHI C;  3Q3M C;  2ZW1 A;  2KMM A;  2DZK A;  3DBR B;  3CSF A;  1SIF A;  3UIO B;  3B9J A;  2BYV E;  3W1S A;  4PS7 A;  2ZVN A;  5EE9 A;  4KVG B;  2D3A A;  4C7Z A;  2KWD A;  3PRZ A;  1T3Q A;  3I3T B;  3AH7 A;  5FR3 A;  2MJ3 A;  1V1P B;  3NS1 A;  1OFF A;  2B76 B;  3TEW A;  1ZDX A;  2MHJ A;  4US8 A;  3DQV A;  5BMG A;  4DXA B;  1JWB D;  4GU2 A;  4N6E B;  2KFJ A;  2KYW A;  3GB1 A;  3AEG B;  2IO0 B;  3FAH A;  5LXI B;  1R7S A;  3PRP B;  3ZVV A;  2KN4 A;  5H8Y E;  4XYC A;  1P0R A;  2WXL A;  4KGR A;  1IGC A;  2Q5W D;  4IM3 A;  1QOG A;  2D3B A;  2KTR B;  2ZNV B;  2A5U A;  1J8C A;  2WDT B;  2AEH A;  1J19 A;  3DVN V;  3V62 A;  3P4S B;  1MHX A;  2KDI A;  1FEH A;  4RFB A;  1E0Z A;  4A8X C;  4LNN A;  3A4R A;  5D3D A;  4B0E A;  1WJU A;  2JF5 A;  4YTM B;  1YX5 B;  2J0K A;  1V1P A;  2KJH B;  4ARC A;  2PEA A;  4HWI B;  1T6B X;  4ZRQ A;  1MG4 A;  3AE5 B;  2UWQ A;  3Q8A A;  1BML C;  3FIL B;  4WIP A;  3WAM A;  1I4G A;  2RD0 A;  4KV2 A;  1TIF A;  4CO7 A;  2JPH A;  1KJT A;  1UGM A;  1C79 A;  2X8X X;  1CJE A;  1FD6 A;  3JSV B;  3VRA B;  5C1Z A;  1OEY J;  1YOV B;  2MW5 A;  3RMK C;  3B0A A;  1WIA A;  3VAW A;  4BAX A;  2LUE A;  1OEY A;  1FPY A;  3Q8E A;  1FFV A;  3I5J C;  3QK0 A;  1WJ6 A;  3Q8F A;  2GBJ A;  3U4E G;  1HTO A;  4BOZ B;  2H89 B;  4FJV B;  1K53 A;  4TQ1 A;  1FNW A;  1P7E A;  3UIP B;  3R2T A;  2KJ6 A;  1YJI A;  3N20 C;  2BF8 B;  1L2N A;  5C2T B;  1T0Y A;  5D2M B;  3P1M A;  4W9H A;  1JWA D;  3QCA A;  3SHQ A;  2INN E;  4Q2J A;  1ZXH A;  1ZXI A;  2IBI B;  2R2Q A;  1WWT A;  2MJE A;  3N9Y C;  1WGD A;  2BWE S;  4KDI C;  4N9F 4;  1K51 A;  3JSV A;  2KWV B;  4YTP B;  2WS3 B;  2IPK D;  2NBU A;  1LXD A;  2AL6 A;  5G55 A;  4JPS A;  4F1S A;  3A1Q B;  2GB1 A;  1AN8 A;  3CMM B;  4IM2 A;  4TV3 A;  3ZNI D;  1TGZ B;  1WRD B;  2ZCC A;  1J7C A;  1CZP A;  4WJQ A;  2KAN A;  1BT0 A;  3I9V 1;  1PYW D;  4PS8 A;  4W9J A;  4IWQ A;  3O65 B;  1YN4 A;  2ZCB A;  4KGT A;  1QOA A;  5BMI A;  2W3R A;  1I4P A;  1RRB A;  1K50 A;  1YIW A;  1WMH B;  3BVM A;  2AQ1 B;  1WI0 A;  3DDC B;  5IAA C;  2JZZ A;  2MCN B;  2G45 B;  4MH8 A;  3VUW A;  1LGR A;  4EZL A;  5JHB A;  3RZF A;  1JRO A;  2IDY A;  3A1Q A;  2N9P C;  3TL5 A;  1TYG B;  2KDF B;  1WYG A;  2KLC A;  2LAS A;  5EDS A;  2J4X A;  2ZEQ A;  1P9D U;  2V3P A;  2WXO A;  3DBS A;  1MJD A;  1WXS A;  1VZ8 A;  1S1Q B;  4F7Z A;  2CKH B;  1FCC C;  2ZPY A;  2HE7 A;  3WAP A;  1FO4 A;  2FUG 1;  1PQS A;  1VDV A;  2J7Q B;  5D94 A;  1UBQ A;  1FRD A;  4ZYS A;  1JWS D;  3V61 A;  3SR6 A;  1J7B A;  1I35 A;  4L23 A;  1FXT B;  2WHI A;  4FN2 A;  1F1H A;  2KWU B;  4ITK A;  3ZTC A;  5IN7 A;  4MGK E;  2JXT A;  5BO4 B;  1E7U A;  3A9J B;  2MJD A;  2PVG C;  3AV8 A;  3EHV A;  3NS8 A;  5JXV A;  2PE6 B;  3BYY B;  3IFW B;  1WZ3 A;  3ML8 A;  2V9H A;  4JQW C;  2LUM A;  1R4N I;  2Y3A A;  2NR2 A;  2HDE A;  1FNU A;  1J7A A;  2LVP A;  3TEZ A;  3LDZ E;  3B2F A;  1SE4 A;  1DOY A;  4RNA A;  2DZI A;  3ZLZ A;  2QSD A;  3GZN I;  1I4H A;  4HJK A;  1C9F A;  1K52 A;  5JHA A;  3AE7 B;  1PUT A;  1S3S G;  4P6V F;  4ZYN A;  4ZHP A;  3DBR I;  4JE3 B;  1XCT L;  1SF0 A;  2FIF A;  2BT6 A;  2K6Q A;  3Q3N C;  4BBN F;  1ZDV A;  1MHH E;  3RNE C;  3GS2 A;  1TKE A;  4REZ A;  2L83 A;  2LGX A;  4EE2 A;  4IW0 A;  2KT7 A;  2O6V D;  4NZL B;  4RGO S;  2LD9 A;  4HCN B;  4IUM B;  2GBR A;  1RAX A;  1WYW B;  2K9X A;  3A9J A;  3I63 C;  2JXX A;  4NQK E;  2LXA A;  2N9L A;  3C8Y A;  2MSE D;  4A3P A;  3M95 A;  1NVI D;  3ZNG C;  5AEK B;  3LYY A;  4OVU A;  2PLP A;  1WR1 A;  1N6Z A;  2CU3 A;  1WM3 A;  4AOF A;  3R3M A;  1XT9 B;  1VD2 A;  2KAJ A;  4BKS A;  1YN3 A;  3MP9 A;  4DXF A;  3JW0 X;  4D2K A;  2WQY B;  4OW0 A;  2K25 A;  1WH3 A;  1KOT A;  2CJN A;  1YQ4 B;  4AQ7 A;  4HEA 1;  2LVO A;  2PPH A;  4AJW A;  3PVL A;  1E5W A;  4ICU A;  3HM6 X;  4GXB A;  1TY0 A;  4MH0 E;  1FM0 D;  3GE8 C;  1TBE A;  4WJO A;  2LGD A;  4OHJ A;  5BYS A;  4OZC A;  4ZRJ A;  2MBE A;  2KX0 A;  3AE1 B;  3PHW B;  3N1Y C;  4KKJ A;  4A90 A;  1KH0 A;  4FHJ A;  4HRS A;  2IZV B;  4DHJ B;  1EO6 A;  2YLM A;  2J52 A;  2MBH A;  4LJO B;  1EF1 A;  1AWD A;  2WLB A;  2G9H D;  2BB5 A;  1N61 A;  1I4Q A;  1MG8 A;  3NHE B;  3AEC B;  2L32 A;  1WZ0 A;  2AL3 A;  2PTL A;  4M02 A;  2ASQ A;  2C9W B;  4IKG A;  3M3J A;  2IO1 B;  2VZK D;  3TCA A;  4WWO A;  1L0V B;  2ZW0 A;  1N5W A;  4MGY E;  2LVQ A;  4EZJ A;  4C7Y A;  2OJR A;  1EM7 A;  2GI9 A;  4NPN A;  2L52 A;  1L0X B;  2DWQ A;  3R2I A;  2QC8 A;  1IBX B;  2LZ6 A;  2NTS A;  3SFD B;  4L1B A;  4MEL A;  3KQ4 A;  4NJC A;  1RWS A;  3VFK A;  1SJH D;  4M0W A;  2KKC A;  2N9K A;  3NUH B;  3EEC A;  3QHT A;  3PSE B;  4LLG M;  2IGD A;  3B08 A;  4NAM A;  4XZ4 A;  2KMC A;  2MRP A;  4KSL C;  3MC8 A;  1AAR A;  3T3N A;  4B6W A;  2LI5 A;  4YSZ B;  5IP4 D;  3HIZ A;  3WIM A;  2N1V A;  1OTR B;  3ZNH B;  4FXC A;  4HLE A;  2IGH A;  1EUV B;  1AYF A;  4G11 A;  4X57 B;  2PIA A;  3AU4 A;  2DYO A;  3P63 A;  1E8X A;  1C3T A;  3WAL A;  3RNB C;  4DBG A;  1EWC A;  1IUE A;  2K8H A;  4FA6 A;  3N3K B;  2KK8 A;  3KH0 A;  3APD A;  3ECI A;  3CST A;  2AX5 A;  2K8C A;  3H6N A;  3HRD D;  2NTT A;  2LEK A;  3PS6 A;  2IYD B;  2IO2 B;  1I42 A;  4RF0 A;  4S0R A;  5DPR A;  3VQI A;  2KVZ A;  4DXG A;  3VH3 B;  2K5P A;  2KXJ A;  2IY0 B;  1HXY D;  1Q10 A;  2WX1 A;  1EF5 A;  3H7P A;  3KWV A;  2E3T A;  4JLC A;  3P2B A;  4II2 B;  2XBB C;  4LCD E;  1EU3 A;  3MJ5 A;  1WGY A;  2VRR B;  1CQV A;  2Y5C A;  4HVB A;  4MJS A;  1TZ1 A;  2JYE A;  4CQN A;  3HUI A;  1WGK A;  3AN1 A;  5AZF A;  3OJ3 A;  3OLM D;  3RD2 A;  3BK2 A;  4MEM A;  2WNM A;  3IT6 B;  2ON8 A;  2C7N B;  2ZPN A;  3APF A;  4RM8 A;  4KZ0 A;  5D3I B;  5GXG B;  4WWP A;  1UZX B;  4TUU A;  4WJN A;  2JRH A;  5G2N A;  2G4D B;  3PT2 B;  3ETR A;  1A5R A;  1E9M A;  2DNF A;  2M4N A;  3IT4 B;  1J0G A;  1YJ1 A;  5E6J A;  1WX7 A;  3P4R B;  2K6D B;  2FE8 A;  3DPD A;  3VRB B;  3LXF A;  1FNV A;  2WX0 A;  5KHQ A;  1WXA A;  2PJH A;  2DX5 B;  1TS4 A;  4DHZ B;  1FFU A;  3MTN B;  5BYQ A;  4GDL B;  4N59 A;  4OVZ A;  3WA0 A;  5E6O A;  1SE9 A;  1I4X A;  2M0A A;  2RR9 A;  2KX3 A;  4ZDV A;  3A4S C;  4GMV A;  2H88 B;  1RLF A;  3R8B A;  4ZRK A;  2KLG A;  2ZVO A;  1GC6 A;  2Y5B B;  1EU4 A;  1ZGU B;  4IG7 B;  1N62 A;  1BUI C;  4KGS A;  2LJI A;  2UU7 A;  1YQB A;  3PLV A;  2GBN A;  1CMX B;  4MT5 A;  2D3C A;  2QMT A;  2ZNV C;  1NYQ A;  2LHE A;  3U7D A;  5C23 A;  3RNF C;  3U7Z A;  1WGR A;  2LGI A;  1FXA A;  1KF6 B;  4RGT A;  3QAR A;  1SXT A;  1FRR A;  4BKT A;  3WAO A;  5HHD G;  1C4C A;  2KTR A;  4XGA B;  1C4P A;  2EMT A;  1WXQ A;  3W5U B;  2QEJ C;  5J2R A;  3TMP B;  4WQO B;  3D32 A;  4HPP A;  4EOY A;  5MPO A;  2WGS A;  2N7E A;  2BS4 B;  2KFK B;  3AB5 A;  2KC1 A;  1Y56 A;  1A70 A;  3AE9 B;  3HVD A;  2R61 A;  2NVU I;  2R2O A;  2J0J A;  4G3X B;  1X1M A;  3DCG A;  4L2Y A;  2PW9 A;  1JQ4 A;  3APC A;  4ARI A;  3TUO A;  3OWE B;  2JQR B;  3NVY A;  1WR6 E;  3PRM B;  2W9N A;  1ET9 A;  3GP7 A;  2O6V B;  1R4M B;  3FIL A;  1Q0W B;  2K8B A;  4IM0 A;  3H7S A;  2KVR A;  2WXQ A;  3E9S A;  5L95 C;  2DEN B;  5BYR A;  4W9G A;  3RNG C;  1FIQ A;  5AUK A;  4AP4 C;  2L3Z A;  4RMA A;  4PS3 A;  3BWU D;  3DBH B;  3S2A A;  1TS3 A;  1QIL A;  3SDL C;  1XLP A;  4MM3 B;  4A20 A;  5T8I A;  3RCZ A;  1N5X A;  2Z0D B;  2CS4 A;  5I4D A;  3U2S C;  1DOX A;  2M8S A;  1V80 A;  4W9L A;  3PHX B;  3PRE A;  4XC2 A;  1C77 A;  3BZD B;  2G3Q B;  3E56 A;  1JWU D;  2MEK A;  5EE1 A;  2JUO A;  2L00 B;  4OZB A;  5G5G A;  2IND C;  3AU5 A;  2MA9 B;  2O6V A;  2QJL A;  1SEB D;  5LLI A;  3KLS X;  1GOZ A;  2M17 A;  3ZJU A;  1GUA B;  4LTU A;  1L6V A;  2HD5 B;  4EEW A;  3U30 A;  2OHF A;  1GPX A;  4PYU A;  1JW9 D;  2ZZP B;  1Z2M A;  4FAD A;  1T0S C;  1WXV A;  1OGW A;  3NG0 A;  3SFE B;  1KFY B;  4K7W A;  3V6C B;  2WP9 B;  2OOB B;  4HJG E;  2VZK B;  2ACZ B;  2M0X A;  4LK0 M;  1D6E C;  4IWO A;  3ZYY X;  1WX8 A;  3I57 A;  2LJ5 A;  3N32 A;  3V3X A;  2M19 A;  4KDL B;  5D6J B;  3IVF A;  3ZDT A;  2OED A;  3KUZ A;  3Q3F A;  3AMZ A;  4MGZ E;  4HXD A;  2OJW A;  3IXS A;  1H8C A;  2WXG A;  1GNU A;  1XXG A;  1NI2 A;  1GC7 A;  2MBO A;  4RF1 A;  2RGF A;  4NY0 A;  2MBQ A;  1WMH A;  4TMA B;  1XLO A;  2ZJD A;  2YEP F;  1TZO A;  4FUL A;  3PZ7 A;  3HHM A;  1VZ6 A;  2GBK A;  2BS2 B;  2CJO A;  2CHX A;  3AE4 B;  2GOW A;  2GMI C;  4HKZ E;  1B1Z A;  3HM3 A;  3PPA A;  3R7Q A;  2C5L C;  3IAM 1;  1PDX A;  1WE6 A;  2D07 B;  4YT0 B;  4BOS C;  2N7J A;  4MGI E;  4O1N A;  1HQR D;  1HTQ A;  2JRI B;  5C3J B;  3IAS 1;  2V4L A;  3RN9 C;  3TEX A;  1N60 A;  1NYR A;  1RM6 C;  1GG3 A;  2HTM E;  2SEB D;  3KUD B;  2KC2 A;  4BZA A;  1P98 A;  3VVW B;  1XLN A;  2EKE C;  1ACC A;  3DHH C;  3GOE A;  2DBY A;  4GOC A;  3NY5 A;  1E6E B;  4BFR A;  4ZOH C;  4C00 A;  1Q1O A;  1HA5 A;  3UQA A;  1UGJ A;  1UEL A;  1ZOY B;  3ZTD A;  4E71 A;  1I4R A;  2BGF A;  1FXI A;  2KNB A;  2RPV A;  2Z0E B;  2D11 A;  2JU6 X;  3UQB A;  2KWC A;  4XDD A;  2Y5P A;  1RFK A;  4MAC A;  3ZRF A;  4YSX B;  1TKG A;  1XQQ A;  4XWW A;  1HZ6 A;  1ENF A;  2BTE A;  2D2Q A;  1D3Z A;  2GBM A;  3AE3 B;  1E90 A;  1C78 A;  1L7Y A;  2Z59 B;  3RFZ B;  4S17 A;  1F2R I;  2N7D A;  3A33 B;  4ZRP A;  1KM7 A;  4XDC A;  1ISN A;  1L0Y B;  4HK2 A;  1JWM D;  1T0R C;  4ASW C;  4DQO C;  1WF9 A;  4J3O D;  3SU8 X;  3PZD A;  2FBW B;  4B95 A;  4YTN B;  3VDZ A;  2K39 A;  4CYE A;  5DCN A;  3VR8 B;  1IPG A;  5CHF A;  3EFU A;  4I6N B;  3CWI A;  4M8N A;  2JT4 B;  3V6E B;  2IGG A;  4JGH B;  2O2V B;  4GGQ A;  2FUH B;  2I38 A;  1TKY A;  2EEL A;  1XF5 L;  2Z8L A;  4BVU C;  2RPQ A;  2MP2 B;  2J42 A;  3NVW A;  2SAK A;  4FJY A;  5HFY A;  4IOI E;  2W54 A;  1L4Z B;  2MQJ A;  2RDB C;  4HCP B;  1SIJ A;  3IG3 A;  1ET6 A;  4EUT A;  3EFC A;  1SBB B;  1YNT E;  3AEF B;  2BBC A;  4K81 A;  1WXM A;  4MDK E;  4RCO A;  4E74 A;  1SGH A;  3AEA B;  3EA6 A;  3M63 B;  1TY2 A;  5L83 A;  3RYT A;  2FID A;  3KUC B;  2O2V A;  4IC7 B;  1OQY A;  4A6Q A;  1L6U A;  3BVG A;  4B9K A;  4RGN A;  2KO3 A;  3NZU A;  1NI3 A;  4NQL B;  2M56 B;  4IWP A;  1V97 A;  2MP2 A;  2LRW A;  3L16 A;  2BS3 B;  3KYD D;  4XE0 A;  4GLS C;  5KHO A;  3Q8B A;  5IO9 A;  1C76 A;  4HRO A;  3ZKJ C;  5CHW A;  1R4M I;  3SD5 A;  4YXD B;  4NAW B;  2I1K A;  2IJ0 A;  3B2G A;  4WAA A;  3JYU A;  2DHZ A;  3QQ8 B;  1GB4 A;  2PKO A;  2JX5 A;  1PGX A;  2QDF A;  2KAC A;  4RGM A;  1VCB A;  2KQ7 A;  3TEY A;  3L17 A;  4LDT D;  3AEB B;  4YL8 A;  1TTN A;  1V2Y A;  2DZJ A;  3DBH I;  3ZJT A;  3WCQ A;  3U8Z A;  2B3A A;  3AED B;  1NEK B;  1IBX A;  1QOB A;  1IP9 A;  1NDD A;  2L7R A;  3GE3 C;  1RFA A;  3N1Z C;  2V1Y A;  1TS5 A;  1ZPS A;  2J53 A;  2CU1 A;  4BKS D;  2KHW B;  2AYO B;  3QAQ A;  4KKI A;  3AE2 B;  1SB3 C;  1WRI A;  1JML A;  2WXJ A;  3ZXR A;  2WXH A;  3QC8 B;  3RZW C;  3H9D A;  3NVV A;  4FHK A;  1WGG A;  5G5H A;  3QJZ A;  1QOF A;  4YSY B;  2JVC A;  4LNF A;  3VUY A;  4F8C B;  1N63 A;  4JIO U;  2MLB A;  2KOX A;  2DLB A;  1U4A A;  3L4P A;  5HKH A;  4K1R B;  1TT5 B;  2ONQ A;  2CHW A;  1ZUD 2;  4K3B A;  3KYC D;  3TBL D;  3ZRC A;  4I6L B;  4LJP B;  3VHT C;  2WDR B;  1GB1 A;  1D5X C;  5HI1 A;  2KQS A;  4WJP A;  1UH6 A;  3W9C B;  2D3G A;  2FCQ A;  2KN5 A;  1WJ4 A;  4PT5 A;  2DAF A;  2NMQ A;  4TSS A;  1SE2 A;  4LNK A;  1UF0 A;  1MFW A;  5IOI A;  2K1F A;  3RUL A;  4E3C A;  2N0S B;  4QAY A;  4TKN A;  2HJ8 A;  4P7I A;  3UGB B;  2L8J A;  4ZHO A;  4WH4 A;  1TS2 A;  4US9 A;  2W82 A;  3HVZ A;  2FNJ B;  4FJZ A;  3KVF B;  4M00 A;  3IHP C;  2I1J A;  1YN5 A;  3DBL B;  1MVK A;  1DOI A;  4II3 B;  2K22 A;  1IGD A;  1HE8 A;  3RNC C;  2N9X A;  2LGS A;  5FKA C;  1V6E A;  2X38 A;  3DWG C;  4AUQ C;  5TSS A;  2IO3 B;  3QX1 A;  2EKI A;  1FMA D;  4DHJ D;  2L0F A;  1NBF C;  3BYT B;  2WU2 B;  2CR5 A;  2YEP B;  3MC0 B;  5J17 A;  2W3S A;  3EC8 A;  2WXN A;  1YX6 B;  1LQB A;  3IBE A;  4NJ7 A;  4YWG G;  4JX1 C;  3ENE A;  4I6P A;  1AW7 A;  1F2R C;  2L1A A;  1CK1 A;  3ZJV A;  4JL9 A;  3BK1 A;  3VH4 B;  1Z5S B;  1XD3 B;  1V49 A;  4HDO A;  1Q5W B;  3ZDM C;  3LB8 C;  4NJ6 A;  2LMC A;  3A9K B;  3VTU A;  3W2D A;  1QQR A;  2DYM A;  3ZXV A;  1WSP A;  4GDL A;  4K7U A;  4EKU A;  3X0W A;  4N58 A;  5GMV A;  1WJN A;  3ALB A;  1PGA A;  2N9E B;  2XN9 C;  3URY A;  3ONS A;  4GIV A;  4OZA A;  2L76 A;  1JAL A;  2BYT A;  3V60 A;  1SSN A;  4HKQ A;  1F9J A;  3TIX A;  3NRZ A;  5CHV C;  2NBV B;  2FCM A;  1MI0 A;  2N1W A;  3PTF C;  3TSS A;  2A4Z A;  4LNI A;  3N30 A;  1HZ5 A;  1ZKH A;  3EGR A;  2C7H A;  2JY6 A;  4BBN C;  1E8Y A;  3TJP A;  5TR5 A;  3NZ3 A;  3X23 A;  3BIN A;  1G6J A;  4KZC A;  2WXK A;  5LNK 1;  4WWM A;  2K3U A;  3OAW A;  2AQ2 B;  3C0R B;  2D10 A;  4ANV A;  3T9L A;  5EE0 A;  3A9K A;  3PZ8 A;  3RT3 B;  1QF6 A;  1QT9 A;  3DWM A;  3PLU A;  2XNA C; 
#chains in the Genus database with same CATH homology
 4DDG D;  3DQV A;  2JRI B;  2LZ6 A;  4BKG A;  1WGH A;  2V4L A;  4MEL A;  3VFK A;  4DXA B;  2KFK A;  1GG3 A;  4GU2 A;  3DVG X;  3KUD B;  2KKC A;  2KFJ A;  2KC2 A;  1P98 A;  3VVW B;  3EEC A;  3QHT A;  3PSE B;  2EKE C;  3GOE A;  2IO0 B;  5LXI B;  3B08 A;  3PRP B;  1V81 A;  2KD0 A;  3ZVV A;  2FAZ A;  4GOC A;  4XZ4 A;  2IY1 B;  2KMC A;  1P0R A;  3NY5 A;  2JWZ A;  4HDQ A;  4BFR A;  3M62 B;  2MRP A;  4KSL C;  4ZRI A;  1Q1O A;  4IM3 A;  2KTR B;  3UQA A;  1AAR A;  2ZNV B;  1UEL A;  4W9E A;  2A5U A;  1J8C A;  2WDT B;  3ZTD A;  2AEH A;  4B6W A;  2LI5 A;  4E71 A;  1J19 A;  2BGF A;  3L0W B;  3DVN V;  2KNB A;  3V62 A;  3HIZ A;  2Z0E B;  2D11 A;  2KDI A;  3UQB A;  3WIM A;  2N1V A;  1OTR B;  2KWC A;  3K9O B;  3KW5 B;  4RM9 A;  3ZNH B;  4HLE A;  4ANW A;  1EUV B;  2J0M A;  3A4R A;  3WAN A;  4X57 B;  4G11 A;  3ZRF A;  3AU4 A;  1WJU A;  2JF5 A;  2DYO A;  1E8X A;  1XQQ A;  3DVG Y;  1C3T A;  2FCS A;  1YX5 B;  2J0K A;  4EZK A;  3WAL A;  4DBG A;  3B1L X;  5CTR C;  2KJH B;  2K8H A;  2D2Q A;  1D3Z A;  2GBM A;  1E90 A;  1L7Y A;  2Z59 B;  1YD8 U;  3MJW A;  4FA6 A;  2N7D A;  3N3K B;  3A33 B;  3QA8 A;  4MM3 A;  1KM7 A;  2KMA A;  1ISN A;  2KK8 A;  2PEA A;  4HK2 A;  4HWI B;  3KH0 A;  4ASW C;  2MWS B;  1WF9 A;  4GN1 A;  3APD A;  1ZW7 A;  2UWQ A;  3PZD A;  3SU8 X;  3ECI A;  1V86 A;  3CST A;  2NPT B;  2K8C A;  3H6N A;  4B95 A;  2XEW A;  2RSU A;  3WAM A;  2BYE A;  3VDZ A;  2K39 A;  4CYE A;  2RD0 A;  3PS6 A;  2CHZ A;  2IYD B;  4KV2 A;  5DCN A;  4URK A;  4CO7 A;  2JPH A;  1KJT A;  1UGM A;  2IO2 B;  1I42 A;  1IPG A;  5CHF A;  3EFU A;  4I6N B;  3V6E B;  4M8N A;  2JT4 B;  5DPR A;  4FBJ B;  3VQI A;  1KLV A;  2KDE B;  3JSV B;  4JGH B;  2O2V B;  3VH3 B;  4GGQ A;  2FUH B;  5C1Z A;  2KXJ A;  2LWP A;  1OEY J;  2MW5 A;  3B0A A;  2LXC A;  1LFD A;  2IY0 B;  2YVC A;  1WIA A;  5LXH A;  3VAW A;  2LUE A;  2WX1 A;  2DAJ A;  1EF5 A;  4BVU C;  2RPQ A;  3H7P A;  1OEY A;  2MP2 B;  4JLC A;  3P2B A;  3MHS D;  1WJ6 A;  3QK0 A;  4II2 B;  4DWF A;  4FJY A;  2XBB C;  4KSK C;  4FLH A;  2GBJ A;  4LCD E;  5JH5 C;  4A3O A;  1WGY A;  4BOZ B;  2VRR B;  4NNJ B;  4FJV B;  2BPS A;  4TQ1 A;  4HVB A;  4MJS A;  1UD7 A;  3UIP B;  1TZ1 A;  2MQJ A;  2KJ6 A;  4HCP B;  3UIN B;  2BF8 B;  3IG3 A;  2REX A;  5E6P A;  1L2N A;  4EUT A;  2MBB B;  5AZF A;  3OJ3 A;  1T0Y A;  3OLM D;  1WM2 A;  5D2M B;  3VTW A;  4W9H A;  3RD2 A;  2LRU A;  3QCA A;  3SHQ A;  4MEM A;  4K81 A;  3JVZ X;  4KIK B;  1WXM A;  5CX3 A;  5AZH A;  4MDK E;  4LDT B;  2QHO A;  2L0T A;  2IBI B;  4E74 A;  1SGH A;  2C7N B;  1UBI A;  3VXW A;  2NPT A;  1V9J A;  2R2Q A;  2ZPN A;  3H1U A;  3APF A;  4RM8 A;  3PGE A;  4KZ0 A;  4WWP A;  1UZX B;  3M63 B;  3AI5 A;  4TUU A;  1WGD A;  2BWE S;  5L83 A;  1IYF A;  4KDI C;  4WJN A;  3K9P B;  2JRH A;  3RYT A;  2FID A;  4N9F 4;  3KUC B;  3JSV A;  5G2N A;  2O2V A;  4IC7 B;  2G4D B;  3PT2 B;  1E7V A;  2BWF A;  1OQY A;  1A5R A;  4B9K A;  2KWV B;  3DOW A;  2M4N A;  1H4R A;  2NBU A;  1J0G A;  1LXD A;  2AL6 A;  5G55 A;  1YJ1 A;  3L10 B;  2KO3 A;  3NZU A;  4F1S A;  1WX7 A;  4NQL B;  2K6D B;  4IWP A;  3DPD A;  3A1Q B;  5FR6 A;  4GB9 A;  2MP2 A;  2LRW A;  3L16 A;  2WX0 A;  3CMM B;  4IM2 A;  1WXA A;  2EMS A;  3KYD D;  4W9F A;  2PJH A;  5KHO A;  4TV3 A;  3ZUN A;  2DX5 B;  4DHZ B;  3ZNI D;  2KJR A;  1TGZ B;  3ZKJ C;  3MTN B;  2MX2 A;  5CHW A;  1R4M I;  1WRD B;  1V5O A;  3SD5 A;  1JRU A;  4GSW A;  4NAW B;  2I1K A;  2ZCC A;  3UF8 A;  4GDL B;  4WJQ A;  3LJ3 A;  4WAA A;  3WA0 A;  5E6O A;  1SE9 A;  1BT0 A;  2DHZ A;  2KAN A;  3JYU A;  3QQ8 B;  2KDB A;  2RR9 A;  2KX3 A;  2BKR B;  4PS8 A;  3A4S C;  4ZDV A;  4W9J A;  4IWQ A;  4GMV A;  2LGY A;  4J6I A;  3O65 B;  1RLF A;  4TQ0 A;  2KZR A;  4KIK A;  2KLG A;  4ZRK A;  2KQ7 A;  1VCB A;  2DZM A;  2ZCB A;  3L17 A;  2ZVO A;  4OVV A;  1GC6 A;  4LDT D;  1P1A A;  4YL8 A;  4HPL B;  1TTN A;  1V2Y A;  4PYZ A;  2DZJ A;  2Y5B B;  4W9K A;  3DBH I;  4BOS C;  1RRB A;  1ZGU B;  4IG7 B;  3DBL I;  3U8Z A;  2B3A A;  1YQB A;  3PLV A;  1LM8 B;  2GBN A;  3W1Y A;  4GDK B;  1YIW A;  1CMX B;  1WMH B;  1IP9 A;  1NDD A;  1WI0 A;  2L7R A;  3DDC B;  2ZNV C;  5IAA C;  2JZZ A;  2MCN B;  3U7D A;  2G45 B;  1RFA A;  5C23 A;  2V1Y A;  3VUW A;  4ANX A;  1WGR A;  3BY4 B;  3PV1 A;  2CU1 A;  5AZG A;  4EZL A;  3QAR A;  5JHB A;  3RZF A;  4BKS D;  2KHW B;  4BKT A;  2AYO B;  3WAO A;  3A1Q A;  3QAQ A;  2N9P C;  4ANU A;  3TL5 A;  2KDF B;  2KTR A;  2LAS A;  2KLC A;  2EMT A;  3QC8 B;  3RZW C;  3H9D A;  5D7G A;  5EDS A;  2ZEQ A;  4FHK A;  5J2R A;  3L54 A;  4XX5 A;  3T8M A;  1P9D U;  3QWZ B;  1WGG A;  1WX9 A;  3QJZ A;  3TMP B;  4K7S A;  3DBS A;  4WQO B;  3D32 A;  2C60 A;  2JVC A;  4EOY A;  4HPM B;  3VUY A;  4F8C B;  1WXS A;  4F7Z A;  1S1Q B;  4JIO U;  4G50 A;  2MLB A;  2KOX A;  1U4A A;  2CKH B;  2N7E A;  5HKH A;  2KFK B;  2ZPY A;  2KC1 A;  4K1R B;  2HE7 A;  3WAP A;  3ZW3 A;  1PQS A;  2CHW A;  4M0W B;  2J7Q B;  3KYC D;  3TBL D;  5D94 A;  3ZRC A;  4I6L B;  3ML9 A;  4LJP B;  3VHT C;  2NVU I;  1WY8 A;  2R2O A;  1UBQ A;  3RUI B;  2J0J A;  4G3X B;  1X1M A;  3V61 A;  3DCG A;  1I35 A;  2KQS A;  3APC A;  4ICV A;  1FXT B;  4WJP A;  2C7M B;  4GDK A;  4FN2 A;  1UH6 A;  2KWU B;  1WR6 E;  3PRM B;  2D3G A;  2FCQ A;  2W9N A;  3HK0 A;  1V5T A;  3ZIM A;  2KN5 A;  4G0N B;  1WJ4 A;  3ZTC A;  2O6V B;  4MGK E;  3AUL A;  2DAF A;  2M1M A;  1Q0W B;  2K8B A;  1E8W A;  2N4F A;  5E6N A;  4IM0 A;  5BO4 B;  1E7U A;  3H7S A;  3A9J B;  2K1F A;  2KVR A;  5L95 C;  3RUL A;  4E3C A;  2V3S A;  3EHV A;  3NS8 A;  2PE6 B;  3IFW B;  2G4S A;  2DEN B;  4TKN A;  2HJ8 A;  1WZ3 A;  3ML8 A;  4JQW C;  2DYB A;  4P7I A;  4W9G A;  3VUX A;  1R4N I;  2NR2 A;  3UGB B;  2L8J A;  4AP4 C;  2FNJ B;  2LVP A;  2L3Z A;  4FJZ A;  4RMA A;  3LDZ E;  4PS3 A;  3KVF B;  3S2A A;  2DZI A;  3IHP C;  3ZLZ A;  3SDL C;  3OJ4 B;  2I1J A;  2BYF A;  1K8R B;  3GZN I;  4II3 B;  4A20 A;  1HE8 A;  4HJK A;  4AWJ A;  2N9X A;  3RCZ A;  5JHA A;  2Z0D B;  2CS4 A;  1Y8R C;  1V6E A;  5IA7 A;  1WFY A;  5KHQ A;  1S3S G;  2M8S A;  4AUQ C;  4ZYN A;  1V80 A;  3DBR I;  4W9L A;  2IO3 B;  3PHX B;  3QX1 A;  3PRE A;  3ZNZ B;  2FIF A;  4XC2 A;  4DHJ D;  2K6Q A;  2G3Q B;  3L13 A;  2WYQ A;  2L0F A;  1NBF C;  4EFO A;  4BBN F;  2JUO A;  2L00 B;  2CR5 A;  5J17 A;  2BKF A;  3Q3J A;  2FCN A;  2LGX A;  3EC8 A;  4IW0 A;  1YX6 B;  2O6V D;  3AU5 A;  2MA9 B;  2O6V A;  1LQB A;  3IBE A;  4NJ7 A;  2LD9 A;  4HCN B;  3AXC A;  4IUM B;  2GBR A;  5LLI A;  5JZE B;  2XK5 B;  4WWN A;  2M17 A;  3H7P B;  1RAX A;  1WYW B;  3VTV A;  1GUA B;  3CF6 E;  3A9J A;  3ENE A;  4I6P A;  2HD5 B;  4EEW A;  2NBW B;  4W9D A;  3U30 A;  5DPT A;  2JXX A;  4NQK E;  2LXA A;  3R7R A;  4PYU A;  4AJY B;  2MSE D;  2ZZP B;  1QZE A;  2L05 A;  4A3P A;  1Z2M A;  3M95 A;  3ZNG C;  5AEK B;  4JL9 A;  4FAD A;  2UYZ B;  4MJS B;  1WXV A;  3VH4 B;  4OVU A;  1OGW A;  1WR1 A;  1GJZ A;  3NZS A;  4CHK A;  1WM3 A;  4AOF A;  1Z5S B;  3R3M A;  1XT9 B;  1VD2 A;  1V49 A;  1XD3 B;  4HDO A;  4K7W A;  4BKS A;  3V6C B;  1Q5W B;  2OOB B;  3JW0 X;  3ZDM C;  2NS5 A;  2M0X A;  2NCN A;  5DPW A;  2K25 A;  4NJ6 A;  1WH3 A;  2AWT A;  2HTH A;  4IWO A;  1KOT A;  3A9K B;  3VTU A;  1WX8 A;  3L08 A;  4NAW A;  2DYM A;  2LVO A;  2PPH A;  1E8Z A;  2LJ5 A;  4AJW A;  3QIJ A;  3N32 A;  3PVL A;  1E5W A;  4GDL A;  4K7U A;  4ICU A;  3HM6 X;  4EKU A;  4DK5 A;  4GXB A;  4MH0 E;  1P3Q U;  1WE7 A;  4KDL B;  1TBE A;  3R66 C;  4MSQ B;  5D6J B;  3IVF A;  4WJO A;  3X0W A;  2LGD A;  5GMV A;  4ZRJ A;  1WJN A;  1C1Y B;  3ALB A;  1M94 A;  2N9E B;  3ZDT A;  2MBE A;  3ONS A;  2KX0 A;  4DDI D;  4GIV A;  4W9I A;  3PHW B;  3KUZ A;  3Q3F A;  4MGZ E;  2L76 A;  4HXD A;  4DHZ E;  3NOB A;  3V60 A;  5J18 A;  4FHJ A;  1H8C A;  1F9J A;  2IZV B;  2KTF A;  1GNU A;  3TIX A;  4DHJ B;  4W9C A;  1EO6 A;  3W1S C;  5CHV C;  2YLM A;  2NBV B;  4MSM B;  2MBH A;  1NI2 A;  2XK5 A;  2FCM A;  2WWZ A;  4LJO B;  1EF1 A;  1GC7 A;  2MBO A;  4M8M A;  2PE9 A;  2RGF A;  4NY0 A;  2MBQ A;  2N1W A;  5DPS A;  1WMH A;  2JZ3 B;  3DVN U;  3ZO5 B;  3PTF C;  2A4Z A;  3N30 A;  2ZJD A;  1ZKH A;  2DZK A;  1MG8 A;  3CSF A;  4FUL A;  3NHE B;  1SIF A;  3UIO B;  2C7H A;  2JY6 A;  3HHM A;  2GBK A;  4BBN C;  2BYV E;  3W1S A;  1WZ0 A;  2CHX A;  1E8Y A;  2AL3 A;  3TJP A;  2ASQ A;  5TR5 A;  4PS7 A;  2C9W B;  2ZVN A;  2GOW A;  3M3J A;  3X23 A;  2GMI C;  3BIN A;  4KVG B;  2IO1 B;  4KZC A;  3TCA A;  1G6J A;  4WWO A;  3PRZ A;  3HM3 A;  3I3T B;  3OAW A;  3PPA A;  3R7Q A;  4MGY E;  3C0R B;  2C5L C;  2D10 A;  2LVQ A;  4ANV A;  1WE6 A;  3T9L A;  2D07 B;  4EZJ A;  3A9K A;  2OJR A;  3RT3 B;  3PLU A;  4NPN A;  4MGI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...