2MLBA

Nmr solution structure of a computational designed protein based on template of human erythrocytic ubiquitin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
MDTINITLPDGKTLTLTVTPEFTVKELAEEIARRLGLSPEDIKLTHNGKTLDPSLTLAEYGITPGSTITLEIKKKGGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords redesigned ubiquitin
publication title Protein design with a comprehensive statistical energy function and boosted by experimental selection for foldability
pubmed doi rcsb
source organism Synthetic
molecule tags De novo protein
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mlbA00
1UGMA 5LXHA 2ZJDA 2GBNA 2KX0A 1WXSA 2J0KA 4LJPB 1WRDB 4MGYE 4W9HA 1R4MI 1YD8U 4BBNF 4I6LB 2MLBA 3N30A 2G4DB 3NZSA 2G3QB 3NHEB 3Q3FA 3IFWB 4PS3A 5EDSA 3M63B 3WALA 3QHTA 2C9WB 4WJPA 3V61A 2KQSA 3GOEA 2KWVB 3QX1A 2K6QA 2LD9A 3VQIA 4GIVA 3JW0X 4KSLC 3V6CB 2IYDB 4IC7B 3ZKJC 3L08A 3RZFA 3UGBB 1WGGA 1E8WA 3PLUA 4W9CA 2BGFA 3VH3B 1Z2MA 3DOWA 1WJ6A 4HLEA 1WR6E 4TUUA 1UZXB 3H7PB 3PGEA 4RMAA 3ZRCA 4FBJB 2KANA 3QA8A 1XQQA 4KZCA 2W9NA 2LGXA 1P98A 1H8CA 2KOXA 3A1QB 4KDLB 4ASWC 3JSVB 4GSWA 2KWCA 2KDBA 2N7EA 2L3ZA 4MEMA 2RPQA 3UF8A 4ZRJA 4KIKA 3VUXA 4F8CB 2YLMA 4KZ0A 1V9JA 4FHJA 3OLMD 4J6IA 4G11A 2ASQA 3VHTC 3ZNGC 4M8NA 3PS6A 1XD3B 1FXTB 4MGZE 4PYUA 3TMPB 4A20A 4CYEA 3W1SC 1ZKHA 1WE6A 4ICVA 2NVUI 4MJSB 3NS8A 1YJ1A 4WJOA 2ZCBA 2LXCA 3A33B 2EMSA 3RULA 1GJZA 2C5LC 1KM7A 5E6PA 3C0RB 1P1AA 1E5WA 2MBQA 2CS4A 4ZDVA 3KW5B 2FCQA 2JRIB 4LJOB 3KVFB 2Z0EB 1LM8B 4MSMB 2K8HA 4FJVB 3DVNV 3M62B 2REXA 5DPRA 3K9OB 3DCGA 3H1UA 1CMXB 1WE7A 3MJWA 3ZTCA 2CHZA 2MW5A 1WXMA 2MRPA 1RRBA 1V6EA 2BKRB 2ZPYA 2I1KA 1IPGA 5IAAC 4ANVA 3PZDA 1S3SG 3MHSD 2JWZA 2KLGA 2WX1A 2KTRA 2BWES 1RFAA 4G0NB 1KJTA 1UBQA 3ZW3A 4EKUA 4JQWC 4NNJB 2LJ5A 5G2NA 3RCZA 2OOBB 2KFKB 2UYZB 4NQLB 1V5OA 4DHJB 4YL8A 3P2BA 2ZVNA 3DPDA 5AEKB 4KV2A 4M8MA 1Q1OA 5CX3A 4B95A 4F1SA 2DAFA 1YX5B 3HM6X 4BKSA 1EO6A 2K39A 2LWPA 2FNJB 5IA7A 3NOBA 2NBUA 2M8SA 2BYFA 3W1SA 3PRMB 2D3GA 3KYDD 1UELA 2NPTB 3PPAA 1E8XA 3QWZB 4DK5A 1RAXA 2M0XA 2L05A 1GG3A 3PRPB 3SHQA 4BOZB 3TIXA 2N9PC 3ZLZA 1V80A 1P3QU 5AZGA 5JHAA 1WY8A 3DQVA 2N9XA 1WMHB 1OQYA 2GBMA 4DHJD 2I1JA 1WF9A 2GOWA 3ZDMC 4MSQB 3ZTDA 2D2QA 1NI2A 4DDID 3EHVA 5CHWA 1V81A 1ZGUB 3X23A 4LDTB 2JUOA 1WX9A 4W9KA 3TBLD 3ZUNA 1YQBA 4W9LA 2KDIA 4FA6A 2J0MA 2O2VA 2FAZA 2FUHB 3APCA 4EUTA 4AWJA 1E8ZA 3ML9A 3Q3JA 3JVZX 2YVCA 1I42A 1NBFC 3H6NA 1TTNA 3QK0A 3AULA 2O6VA 2KZRA 3EECA 1WI0A 2DZIA 2XK5A 1GC6A 2JF5A 2LRWA 4IM2A 3D32A 3KUDB 1WX7A 1C3TA 2GBJA 2ZPNA 3EFUA 3H7SA 3UQBA 1WFYA 2FIDA 2PPHA 1SE9A 4RM9A 2KDFB 2AEHA 2C7HA 2LUEA 4LDTD 4JL9A 2LVOA 3I3TB 1WZ3A 4KIKB 3V60A 4NY0A 4PS8A 4K7UA 4N9F4 4HK2A 1SIFA 2BWFA 2MP2A 1WJUA 3CF6E 3PTFC 3QJZA 4GDLA 4NAWA 4BVUC 4BBNC 1Q0WB 1Q5WB 2K1FA 4W9EA 2LI5A 4IWQA 3TL5A 1L2NA 1QZEA 3QC8B 5D94A 2IY1B 4NQKE 5E6OA 5C23A 2K25A 2K6DB 3U8ZA 3VAWA 3UIOB 1Y8RC 2L8JA 3NY5A 4P7IA 3CSFA 5BO4B 2DYBA 1X1MA 3VDZA 3B1LX 2KMAA 2V3SA 4A3PA 1WZ0A 2JXXA 1HE8A 2KTFA 2RD0A 3V6EB 1RLFA 2JVCA 4AOFA 1ZW7A 3T8MA 2AL6A 5CTRC 3WA0A 1NDDA 4WWOA 1J0GA 2N9EB 1F9JA 2IO2B 2EMTA 2L0FA 2LVPA 2KDEB 2KO3A 5LLIA 1S1QB 2ZEQA 4W9GA 1H4RA 4EZLA 4ICUA 4MH0E 4G3XB 1ISNA 1KOTA 2K8CA 3KUCB 2KJ6A 2K8BA 1IYFA 4IM3A 2KTRB 2LASA 4I6NB 4F7ZA 4KDIC 4B6WA 2WX0A 3R66C 3M3JA 3ZDTA 1OTRB 2D10A 1EUVB 3DBRI 3A9KA 4GN1A 4WQOB 3OJ4B 5G55A 2DENB 3N3KB 2KVRA 2ZNVC 3DBHI 1WM3A 5FR6A 2WYQA 4CO7A 4K81A 2BYEA 4ZYNA 3MTNB 3T9LA 4NJ6A 3QARA 3WAMA 1WJ4A 2JPHA 4M0WB 5D6JB 4ANUA 2MBHA 2IO3B 3U7DA 4HCPB 4JLCA 4EEWA 3ZVVA 3ZIMA 4WWPA 4IWOA 4ANWA 2NR2A 2C7NB 3S2AA 2M1MA 1UH6A 2FCNA 2MQJA 1IP9A 3DVGY 1WYWB 4LCDE 3WAOA 3AI5A 3X0WA 3DBSA 3A9JA 2CHXA 2XEWA 3V62A 3ZNHB 1V5TA 1D3ZA 1LQBA 2Z59B 4NJ7A 4MGKE 3VFKA 3BY4B 4AUQC 2A4ZA 2KWUB 1MG8A 3GZNI 1I35A 2G45B 2KJRA 4MM3A 4RM8A 3OAWA 3PHWB 2A5UA 3HIZA 4GGQA 3WAPA 3CSTA 4WAAA 3DVNU 3RT3B 2M4NA 2PE9A 4IUMB 3OJ3A 4FHKA 4IWPA 3ZNID 4EZJA 2WDTB 2AYOB 5L83A 2O2VB 2AWTA 4BKGA 1V2YA 3JYUA 4EFOA 2NBWB 3O65B 1Z5SB 1GUAB 4II2B 3IVFA 3LJ3A 4GDKA 4GOCA 4PYZA 1WM2A 2PJHA 2LXAA 5DPTA 2NCNA 2O6VB 3PT2B 1YIWA 1YX6B 3ENEA 2KK8A 2KKCA 4EZKA 2KHWB 5GMVA 4FADA 4XC2A 2KNBA 2GBRA 3L54A 3VXWA 1KLVA 3B0AA 4HDOA 1SGHA 3W1YA 2R2QA 3AU5A 2LZ6A 1V86A 2NS5A 4HVBA 2CU1A 2XBBC 1WH3A 3DBLI 2HE7A 4XZ4A 2GBKA 3R7RA 4AP4C 2RSUA 2BYVE 2KD0A 4HPLB 4KSKC 5J2RA 3IG3A 3TCAA 4HXDA 2LGYA 4BFRA 1E7UA 2MP2B 1EF1A 5D2MB 2KC1A 3RUIB 4OVUA 5J18A 2R2OA 2MBOA 2O6VD 2UWQA 2NPTA 3RYTA 5JH5C 2RGFA 4E74A 5KHQA 4FULA 4DDGD 2N7DA 4B9KA 3AU4A 4BKTA 4NPNA 3WANA 3PV1A 3QIJA 1P0RA 3HK0A 4II3B 3N32A 3RD2A 4TKNA 1E8YA 1PQSA 2EKEC 1J19A 1TGZB 2JZ3B 2BKFA 3ZRFA 3R7QA 2DZKA 4GMVA 3APFA 4W9JA 5CHVC 4X57B 4WJQA 4URKA 2DX5B 2B3AA 4WJNA 2IO1B 3WIMA 2OJRA 3ECIA 1V49A 5C1ZA 4JGHB 1TBEA 2Z0DB 4FLHA 1UBIA 3PSEB 1E90A 5D7GA 3KH0A 2CHWA 3VH4B 2MWSB 2NBVB 2IBIB 1WR1A 4W9FA 2DHZA 2IZVB 3A9KB 2KMCA 2KJHB 3UIPB 4MGIE 1OEYJ 2Y5BB 2HD5B 4XX5A 4MDKE 2JRHA 2L0TA 2BF8B 4W9IA 4TQ0A 2KLCA 3QAQA 4WWNA 1WJNA 4GB9A 3VUWA 3EC8A 3PRZA 4TQ1A 5J17A 1M94A 1WXVA 5JZEB 3LDZE 3TJPA 2MX2A 3ALBA 2JT4B 2V4LA 4G50A 5CHFA 3RZWC 1AARA 2JZZA 1OGWA 2DYOA 2GMIC 2J7QB 1A5RA 2DZJA 1UD7A 3AXCA 3IBEA 1E7VA 3H7PA 3A4SC 3IHPC 3A4RA 3A9JB 3R3MA 4HDQA 5AZFA 1C1YB 2ZCCA 1XT9B 2ZVOA 3A1QA 2D07B 4HWIB 2N4FA 2ZZPB 3JSVA 4GXBA 1LXDA 2L00B 3KUZA 2HJ8A 4FN2A 2MA9B 1LFDA 4DXAB 3UQAA 4FJZA 2VRRB 2KQ7A 5AZHA 3L0WB 4CHKA 2MBEA 1J8CA 2DAJA 1OEYA 2PE6B 4I6PA 2RR9A 1VCBA 4MJSA 1WGHA 4OVVA 3ZO5B 2BPSA 2MSED 3ZNZB 2KN5A 2LVQA 2J0JA 2QHOA 4GDKB 5L95C 3L13A 2KXJA 3HM3A 2FIFA 3VVWB 2C60A 3VUYA 4JIOU 4ZRIA 2MBBB 5DPWA 1WX8A 4PS7A 2PEAA 4BKSD 2FCSA 2ZNVB 2CR5A 4ANXA 4BOSC 1P9DU 1T0YA 4ZRKA 2L76A 2DZMA 4FJYA 4HPMB 1WGYA 2CKHB 2IO0B 2AL3A 3L17A 3PVLA 3U30A 3B08A 1GNUA 2KX3A 4K1RB 4W9DA 2MCNB 4A3OA 3CMMB 1G6JA 1VD2A 4KVGB 4DHZE 4EOYA 3PREA 1GC7A 5DCNA 2C7MB 3BINA 1L7YA 3H9DA 1WXAA 2FCMA 2XK5B 3K9PB 3APDA 2G4SA 3NZUA 3SU8X 4DBGA 5JHBA 5TR5A 3SDLC 2HTHA 3PLVA 4E71A 2LGDA 5KHOA 2L7RA 2KFKA 3KYCD 3DDCB 4HCNB 2V1YA 1BT0A 4IM0A 4DWFA 2N1VA 1JRUA 3M95A 2M17A 3ML8A 3DVGX 4IW0A 3VTWA 1EF5A 4IG7B 3PHXB 1K8RB 4TV3A 3ONSA 5HKHA 2LRUA 4AJWA 4GDLB 4NAWB 2D11A 3HHMA 4HJKA 4MELA 2IY0B 4K7WA 4E3CA 3L16A 3QCAA 3UINB 5E6NA 1TZ1A 1U4AA 2WWZA 3VTUA 4DHZB 2N1WA 5DPSA 4AJYB 4GU2A 1R4NI 2KFJA 1WGDA 3L10B 3SD5A 1WIAA 2DYMA 2JY6A 3QQ8B 1WGRA 1WMHA 4K7SA 3VTVA 2KC2A 5LXIB
chains in the Genus database with same CATH superfamily
1AN8A 2J0KA 4MGYE 2WXKA 1YD8U 2MLBA 3N30A 2G4DB 1J7CA 3AE6B 3Q3FA 5EDSA 3WALA 3QHTA 4WJPA 2WXIA 3GOEA 1VR9A 3QX1A 2K6QA 3VQIA 4GIVA 1NI3A 3UGBB 1WGGA 2M19A 1Z2MA 1WJ6A 4RMAA 2KANA 3QA8A 1P98A 4OZAA 2KOXA 3NG0A 1AYFA 4ASWC 5MPOA 2IGHA 4MEMA 2L3ZA 5FR3A 2DBYA 3KQ4A 1V9JA 1EWCA 4J6IA 4NZLB 3PS6A 2YEPB 1FXTB 4A20A 2W3SA 1WE6A 2NVUI 2INNE 4WJOA 3FKYA 2ZCBA 3A33B 2EMSA 1E0ZA 3SEBA 3AE1B 2WXRA 5E6PA 1V1PB 1P1AA 1E5WA 2MBQA 3E56A 4A90A 3TEYA 3NVVA 3Q2AC 3ETRA 1CMXB 3ZTCA 3L4PA 1V6EA 1IBXA 2I1KA 1FO4A 1DGJA 2KLGA 1RFAA 1TIFA 4RH6A 4JQWC 2LJ5A 2KFKB 1V5OA 3Q3MC 4ARIA 2ZVNA 5AEKB 3FC4A 5IOIA 1Q1OA 2DAFA 4MH8A 3HM6X 4KKJA 1NVID 3PRMB 1B9RA 4WURA 3CIRB 2FUG1 1UELA 1E9MA 3MC9A 2M0XA 2L05A 2PMVA 3PRPB 2KT7A 3HUIA 1P3QU 5JHAA 2KQ4X 4K3BA 4DHJD 1YMHE 1WF9A 2PVOD 2W54A 4DDID 5CHWA 1IGCA 4REZA 4BAXA 4W9KA 1TYGB 3ZUNA 2PTLA 3GB1A 2ONQA 4TMAB 4AWJA 1NBFC 1MG4A 1TTNA 2BB6A 3AULA 2O6VA 2KZRA 1GC6A 4IM2A 2WHIA 3KUDB 3UQBA 1WFYA 1KFYB 4RM9A 2KDFB 1MPEA 4LDTD 3PZ8A 1TY0A 3AE8B 2X38A 4PS8A 4HK2A 1SIFA 4JWUC 3T3NA 5FK9C 4W9EA 1QZEA 5D94A 2IY1B 4NQKE 5C23A 1GB1A 3VAWA 3UIOB 4LNKA 3NY5A 4A3PA 3RN9C 2JXXA 2LUMA 1NEKB 1WYGA 2RD0A 1ET9A 1ZW7A 3AEAB 1XXGA 3WA0A 2N9EB 2L0FA 4OHJA 1IBXB 4G3XB 2BW2A 1FFVA 3Q14C 3KUCB 1IYFA 4IM3A 3MP9A 4I6NB 4B6WA 3R66C 1OTRB 3DBRI 3N9YC 4YXDB 3BK2A 4WQOB 2RDBC 2MJDA 2LGIA 2GRIA 1FM0D 2WYQA 4M02A 2BYEA 4ZYNA 3T9LA 3QARA 3WAMA 5D6JB 1KF6B 2M1MA 1XO3A 1UH6A 2KVZA 4H2AA 3AI5A 1JWSD 4GLSC 4KX6B 2A4ZA 3GZNI 4M01A 1FMAD 3WAPA 4YTPB 4DQOC 2M4NA 2AQ1B 4IUMB 4FHKA 2WDTB 5L83A 2AWTA 3JYUA 2MEKA 1SJHD 3LJ3A 4GOCA 4PYZA 1WM2A 5EE0A 3Q8EA 2O6VB 3PT2B 1YIWA 2QSDA 3MHZA 2KK8A 3DBRB 4WH4A 4EZKA 4FADA 1N60A 3MC8A 2GBRA 5BYSA 1KLVA 2LFIA 3W1YA 4ZHPA 1Q10A 1YNTE 1WH3A 3AECB 4JE3B 3N1XC 2BQQA 4HPLB 4KSKC 5J2RA 3IG3A 3AE7B 4HXDA 2LGYA 1FIQA 5BYRA 1KLUD 5JH5C 2NPTA 3RYTA 2YEPF 1FFUA 4DDGD 3RNGC 2JYEA 2V3PA 3AU4A 5D3DA 3WANA 3HK0A 1JWAD 3N32A 4II3B 4TKNA 1E8YA 5CHVC 4WJQA 1NYQA 2DX5B 4WJNA 2IO1B 1ZDVA 3NS1A 3ECIA 4JGHB 2BT6A 4RF0A 1GAQB 1T5XD 1I4HA 1YJIA 1QOFA 1YN4A 2KMCA 2WXHA 3P4QB 3RNCC 4MDKE 5EE1A 1HEZE 3QAQA 4WWNA 4GB9A 3VUWA 3EC8A 3PRZA 4TQ1A 3AEBB 5J17A 1WXVA 3LDZE 1AW7A 1P7EA 2E3TA 3Q6BA 2G1EA 1R4NB 4AS1A 1XLPA 2D07B 2INCC 1Y56A 3JSVA 4GXBA 3RI7C 2HJ8A 2IDYA 4CHKA 2MBEA 1MHXA 2DAJA 1OEYA 4MJSA 1WGHA 1SSNA 2VZKD 2KN5A 2J0JA 3DHGC 3L13A 2KXJA 3BYTB 2KAJA 3VUYA 1TS5A 2LEKA 4PS7A 1CK1A 1MFWA 1L0XB 4ANXA 2AX5A 2MHJA 4JX1C 1QF6A 1N61A 2AL3A 2D3BA 3U30A 3B08A 1GNUA 2KX3A 4W9DA 2MCNB 3PREA 1L7YA 3U52E 2N9KA 2FCMA 3K9PB 4DBGA 5TR5A 1ZUD2 2LGDA 4US8A 2WXOA 3DDCB 1BT0A 1L6UA 2IGGA 3ML8A 3DVGX 3GS2A 4ACFA 3PHXB 4K7WA 3L16A 3VTUA 2ZW0A 3IXSA 4AJYB 1WGDA 3SD5A 2JY6A 4RGNA 4K7SA 3VR9B 3RMKC 3BZDB 2KX0A 4LJPB 1XEEA 1RWSA 1R4MI 4BBNF 5HI1A 1ZP0B 1ACCA 2WGSA 4HROA 2KQSA 4LNIA 2LD9A 1IGDA 3JW0X 1K51A 4KSLC 1JCKB 2IYDB 4IOIE 3ZKJC 3L08A 1XF5L 3PLUA 4W9CA 1I4PA 3DOWA 3ZXRA 4FBJB 1CZPA 1XQQA 4KZCA 1C4AA 3AMZA 2W3RA 2PVGC 3JSVB 2WXLA 2KWCA 2KDBA 4GSWA 1ET6A 4NJCA 1WGKA 1YN3A 4ZRJA 3UF8A 3VUXA 5HHDG 2YLMA 4FHJA 3OLMD 2ASQA 3VHTC 1XD3B 4MGZE 3W1SC 1ZKHA 4MJSB 3H8HA 1YJJA 3RULA 4A8XC 4CQNA 1GJZA 2C5LC 3KW5B 2FCQA 2JRIB 3M62B 2REXA 5DPRA 3K9OB 3DCGA 4B0EA 1RRBA 1C79A 4US9A 4D2KA 2JWZA 2WX1A 1WSPA 5IKCM 1N6ZA 1KJTA 1UBQA 2IJ0A 5G2NA 2OOBB 3P2BA 3DPDA 2KN4A 3TUOA 2WXGA 4M8MA 5CX3A 2L83A 2FNJB 5IA7A 1OQQA 3W1SA 1UNSA 4KKIA 3QWZB 2MJEA 4DK5A 2PLPA 3NUHB 1GG3A 4N58A 3TIXA 2N9PC 3ZLZA 1V80A 1E10A 1OQYA 2DNFA 2I1JA 2JU6X 4MSQB 3ZTDA 1NI2A 1XLNA 3EHVA 1V81A 1ZGUB 2XNAC 3VRAB 3X23A 2BYTA 3HVDA 3TBLD 2HTME 1V8CA 3RNEC 2O2VA 2FAZA 2FUHB 3N20C 1E8ZA 2WLBA 3Q3JA 3JVZX 2YVCA 1MHHE 2AQ2B 3AM9A 3QK0A 3Q8BA 1DYQA 1WI0A 2DZIA 2XK5A 2SEBD 2JF5A 3B2FA 2RDHA 1C3TA 3EFUA 3H7SA 2OEDA 2PW9A 1L5PA 2AEHA 2C7HA 1TY2A 1VZ6A 3I3TB 4YT0B 4K7UA 1QOAA 2BWFA 2MP2A 1WJUA 2WNMA 3CF6E 4GDLA 4NAWA 1JWUD 4BBNC 1Q0WB 1Q5WB 1NYRA 2K1FA 1J7BA 2LI5A 2J52A 4IWQA 3QC8B 2K3UA 3ZJUA 4P7IA 4P6VF 3CSFA 5BO4B 2DYBA 3B1LX 2KMAA 2SAKA 1WZ0A 2KTFA 4AOFA 1RLFA 1ZXIA 4HEA1 1NDDA 1FNVA 3W5VB 2IO2B 2EMTA 2BBCA 2KDEB 5LLIA 4YSXB 4EZLA 1DOIA 1ISNA 2RPVA 1KOTA 1JMLA 4XDCA 3M3JA 4P16A 1PGXA 3B2GA 1N63A 1A70A 1SE3A 2Y3AA 4WQMA 1WJ4A 2JPHA 2N7JA 2MBHA 2DLBA 4WIPA 1L4ZB 4HCPB 4JLCA 3ZVVA 3ZIMA 4IWOA 1GB4A 3KWLA 1HTQA 3I5JC 1JWMD 2WXPA 3DVGY 3X0WA 2CJNA 3DBSA 1TJEA 3A9JA 3ZNHB 2XEWA 2ICIA 2Z59B 4PT5A 4AUQC 1I35A 2KJRA 2VH2A 3OAWA 3PHWB 4WAFA 2QJLA 4WAAA 2Y5CA 3RT3B 3ZNID 3OJ3A 4IWPA 2O2VB 1N5WA 1HXYD 3O65B 4MT5A 4II2B 2PJHA 2LXAA 2NCNA 5TSSA 2KKCA 2KHWB 3AE5B 3Q3OC 1TKEA 3B0AA 4HDOA 2NS5A 4HVBA 1FRDA 3PO0A 3P4RB 1I4RA 3MJ5A 1JRPA 2HE7A 4OZCA 4XWWA 4LNOA 4YSYB 1ENFA 2RSUA 2BYVE 1E7UA 2MP2B 2KC1A 1GPXA 4OVUA 1T0QC 3BWUD 5J18A 1PGAA 1T6BX 4PK1A 4FULA 2V4IB 1EWYC 4NPNA 2JQRB 3QIJA 3RNAC 2EKEC 2JZ3B 2BKFA 2DZKA 4URKA 1J7AA 3WIMA 5C1ZA 5I4DA 3C8YA 3P63A 2Q5WD 3IAS1 4ZHOA 1E90A 5D7GA 3SFDB 2CHWA 3VH4B 2NBVB 4W9FA 2IZVB 3CWIA 1UWMA 2KJHB 2EKIA 4ITKA 1OEYJ 2Y5BB 2HDEA 2L0TA 2HJ1A 4W9IA 2R61A 2LHEA 3NZ3A 3SFEB 1TS3A 1M94A 2DWQA 4RF1A 2NMQA 5CHFA 2JZZA 1OGWA 2DYOA 2JYTA 1A5RA 2DZJA 1T3QA 1E7VA 3H7PA 3A4SC 3A9JB 4AQ7A 1C1YB 2BS3B 3A1QA 1VJKA 1B1ZA 3KUZA 1L6VA 4FN2A 1LFDA 2QCZA 4FJZA 5AZHA 3NVYA 1C4PA 1J8CA 2E6XA 2PKOA 2RR9A 3BVGA 1D5XC 2MSED 3AH7A 5FKAC 3ZNZB 2QHOA 5L95C 3HM3A 1JW9D 2FIFA 1HZ6A 5AUKA 4JIOU 2INDC 3B9JA 2FCSA 1BXTA 4FJYA 4HKQA 2CKHB 3PVLA 3L17A 5H92C 3CMMB 1G6JA 4EOYA 1K50A 2AQ3B 1K52A 2ON8A 2V9HA 4M0WA 5D3IB 3SDLC 2HTHA 5GXGB 1KH0A 5KHOA 3KYCD 2D3AA 2WP9B 4IM0A 4DWFA 2N1VA 1JRUA 2M17A 4IW0A 4IG7B 3ONSA 5HKHA 2LRUA 4AJWA 2D11A 2IY0B 3UINB 4GU2A 1R4NI 2KFJA 3L10B 2DYMA 1F52A 3VTVA 5LXIB 2ZJDA 1WXSA 4W9HA 4YSZB 1WRDB 2BTEA 1FXAA 4I6LB 5AUIA 3NZSA 2G3QB 3NHEB 3IFWB 1VLBA 4S0RA 2C9WB 3V61A 4LLGM 2JXTA 2W55A 1SE4A 3V6CB 4IC7B 4P1BC 2FBWB 1FPYA 1GOZA 2BGFA 5LNK1 1ESFA 3H7PB 3PGEA 3ZRCA 2W9NA 1SIJA 2BB5A 3AEFB 3A1QB 2QMTA 4KDLB 1SBBB 3DWGC 2N7EA 2RPQA 2XN9C 4KZ0A 1N5XA 3NRZA 3P42A 4G11A 4PYUA 3W9CB 1YJ1A 4JWSC 2LXCA 3C0RB 2GI9A 4LJOB 4MSMB 2K8HA 3DVNV 4L23A 3RPFC 3H1UA 3Q8CA 4Q2JA 1WE7A 2MW5A 2MRPA 1NENB 1WWTA 1PYWD 2ZPYA 1SE2A 1I4XA 3U2SC 1FRRA 5IAAC 3PZDA 4KGRA 1S3SG 3I57A 3MHSD 2X8XX 2KTRA 2J4XA 2WU5B 3NJTA 3ZW3A 4EKUA 2UYZB 4NQLB 4DHJB 4YL8A 4KV2A 3KLSX 1I4GA 2LWPA 1EU4A 3NOBA 3ZQ4A 2M8SA 1OFFA 1FNWA 1UUPA 2D3GA 3ZJVA 1K53A 3KYDD 2NPTB 3E9SA 1E8XA 1RAXA 3BK1A 4BOZB 1EM7A 3P4PB 2J42A 5AZGA 3UI3A 4LNNA 3DQVA 2TSSA 4FXCA 2LHDA 2NTSA 2LGSA 1TKGA 2D2QA 1QLBB 4LDTB 2JUOA 1WX9A 1YQBA 3EGRA 3I9V1 2J0MA 1E7PB 3ML9A 3ABVB 3TSSA 4YTMB 3EECA 2IPKD 3D32A 1JQ4A 2GB1A 2FIDA 2PPHA 1SE9A 4RGOS 4EE2A 4IDIA 2LUEA 1BMLC 4JL9A 2LVOA 3V60A 4NAMA 1KTKA 4N9F4 3HRDD 3PTFC 1ROEA 3TL5A 4ARCA 5E6OA 2K25A 4LTUA 3U8ZA 5IN7A 2MH7A 1Y8RC 1V1OA 4YWGG 1X1MA 2NTTA 4ZYSA 3TEWA 5E6JA 4KGSA 3U7ZA 2JVCA 1TS2A 3T8MA 2AL6A 5CTRC 1F9JA 2LVPA 2KWDA 3DBLB 4W9GA 4ICUA 4MH0E 3R8BA 3GE3C 1PDXA 1ZPSA 2KTRB 3ZDTA 2QC8A 4GN1A 3A9KA 2I38A 3OJ4B 5G55A 2WDQB 3N3KB 4QAYA 5FR6A 1WM3A 5G5GA 4CO7A 1XLOA 1F1HA 4ANUA 2IO3B 3U7DA 4XE0A 4WWPA 2G9HD 1FXIA 5IO9A 3S2AA 2FCNA 1IP9A 4LCDE 1R7SA 1VDVA 2CHXA 2Y5PA 1V5TA 3LYYA 4MGKE 3VFKA 5IP4D 3URYA 3LB8C 2KWUB 1D5ZC 1XCTL 4MM3A 1V1PA 4RM8A 4WWMA 3HIZA 1D6EC 3CSTA 4EZJA 2PE9A 3EFCA 4BKGA 4EFOA 2NBWB 3MC0B 1GUAB 1PFDA 4GDKA 1SEBD 4XC2A 2KNBA 1SGHA 2LZ6A 2CU1A 2XBBC 3DWMA 2ZW1A 3RNBC 1LGRA 2GBKA 1KLGD 4ZOHC 3NVZA 4OW0A 5HFYA 5EE9A 1EF1A 5D2MB 2WXFA 3RUIB 2R2OA 2MBOA 2O6VD 2UWQA 4E74A 5KHQA 4BKTA 1JROA 5HG2A 3WCQA 3BVMA 3RD2A 1J19A 1TGZB 3ZRFA 3R7QA 4GMVA 1XLQA 1YOVB 2MJ3A 4C80A 3AN1A 2B3AA 3GP7A 4P1CC 4XDDA 2Z0DB 4FLHA 3DHHC 4DXGA 2CU3A 3KH0A 2K9XA 2RMMA 1FNUA 1WR1A 2IBIB 1L0YB 3NVWA 3AV8A 2KACA 2V0GA 3A9KB 1YN5A 3AE2B 2HD5B 4XX5A 2JRHA 2BF8B 2I2YA 4TQ0A 1WJNA 1UGJA 3GE8C 3IAM1 5JZEB 3TJPA 2QILA 2VZKB 2JT4B 2V4LA 4G50A 3RZWC 2BS4B 2GMIC 1UD7A 3AXCA 2WXNA 3R2TA 3A4RA 4HDQA 4J3OD 1XT9B 2UU7A 4HWIB 2WQYB 4MM3B 1LXDA 1T0RC 2L00B 3N1YC 4DXAB 1QQRA 5T8IA 3UQAA 4ZRQA 1VZ7A 2KQ7A 3L0WB 3SR6A 4I6PA 3Q3NC 1QT9A 4GDKB 3IT4B 1EU3A 3VRBB 1BUIC 2C60A 3ZGZA 2INPE 2MBBB 2PEAA 4BKSD 4RCOA 2KMMA 4BZAA 1T0YA 4ZRKA 2L76A 2DZMA 4HPMB 1WGYA 1I4QA 4K1RB 2KYWA 1VD2A 4KVGB 4UDUC 2C7MB 3H9DA 2XK5B 3SU8X 3PLVA 4S17A 2B76B 2L7RA 4HCNB 2V1YA 4C7ZA 1C4CA 3BYYB 1N62A 1QOGA 4A55A 1EF5A 3AEGB 1K8RB 4GDLB 4NAWB 1DOYA 2K22A 4B0MA 3HHMA 4MELA 3QCAA 2J53A 1U4AA 4DHZB 2N1WA 4YTNB 1ZE3D 1WIAA 4USAA 1WMHA 1PGBA 2KC2A 1FEHA 1UGMA 4L2YA 5LXHA 3ZJTA 2GBNA 3Q8AA 2V3NA 2WDRB 3PZ7A 1HA5A 1C78A 4PS3A 3M63B 2KWVB 2WS3B 1WRIA 3V05A 4HPPA 3RZFA 1E8WA 3W2DA 1SF0A 3VH3B 4HLEA 1WR6E 4TUUA 1P7FA 1UZXB 3Q8FA 4TSSA 3FILA 2LGXA 2WDVB 4MACA 1H8CA 1M4VA 4KIKA 4F8CB 2GLSA 3J9CA 2L52A 1HZ5A 3ZNGC 4M8NA 5C2TB 3TMPB 4CYEA 1C76A 2RDGA 4ICVA 4JPSA 3I63C 3NS8A 4A9AA 1UWXA 1KM7A 4ZDVA 3W5UB 2CS4A 5C3JB 3IT6B 3EA6A 1RM6C 3KVFB 2Z0EB 1LM8B 4FJVB 1AWDA 2WU2B 1YQ4B 2ACZB 3MJWA 4HKZE 2CHZA 4C56C 1WXMA 2BKRB 1IPGA 4ANVA 2PIAA 3AE4B 2K5PA 2BWES 4G0NB 4NNJB 2QDFA 3RCZA 2M0AA 4B95A 2N0SB 2W82A 4HRSA 4F1SA 1YX5B 4BKSA 1EO6A 2K39A 5BMIA 2NBUA 1MVKA 2BYFA 4RGMA 1QILA 3VR8B 4C00A 1OQRA 1TT5B 1VZ8A 3PPAA 4N6EB 3SHQA 1JALA 2FE8A 1WY8A 2N9XA 3AEEB 1WMHB 2GBMA 4RNAA 1PUTA 2GOWA 3ZDMC 4RGTA 4W9LA 3BIID 2KDIA 4FA6A 2OHFA 2WXMA 3APCA 4EUTA 2IGDA 1TZOA 1I42A 3H6NA 3O13A 4OZBA 2LRWA 1WX7A 3BVZA 2GBJA 2ZPNA 1UF0A 3FILB 3V3XA 1FCLA 3GZNB 1WZ3A 1SXTA 4KIKB 4NY0A 2JX5A 2KDMA 3QJZA 4BVUC 1ZDXA 1TKYA 1F2RC 1C9FA 1L2NA 3RFZB 3TEXA 2K6DB 2L8JA 1MJDA 2M56B 3VDZA 2V3SA 1HE8A 3V6EB 2WXJA 4M00A 1MI0A 4WWOA 1J0GA 2BS2B 1CQVA 2KO3A 1RFKA 1ZOYB 1S1QB 2ZEQA 1H4RA 1JWBD 2CJOA 1HQRD 5BMGA 3U4EG 4KGTA 2K8CA 2KJ6A 2K8BA 2LASA 1C77A 4F7ZA 4KDIC 2WX0A 2D10A 1EUVB 3R2IA 2L1AA 2DENB 4C4VA 2KVRA 2ZNVC 3DBHI 4ZRPA 5H8YE 4K81A 3ZXVA 3MTNB 4NJ6A 4O1NA 4M0WB 5BMHA 2Z8LA 3RNFC 4EEWA 4XGAB 4ANWA 2NR2A 2C7NB 1F77A 2MQJA 2D3CA 3WAOA 1WYWB 3V62A 1D3ZA 1LQBA 4NJ7A 4L1BA 1L0VB 1IUEA 1STEA 2JZPA 3BY4B 1MG8A 2G45B 2A5UA 1KRHA 4GGQA 3DVNU 2VH1A 2AYOB 1V2YA 4K3CA 1Z5SB 3HVZA 1FCCC 3IVFA 5DPTA 2H88B 3ENEA 1YX6B 2LMCA 3P4SB 5GMVA 4LNFA 3L54A 1RYJA 3VXWA 4HJGE 3DBHB 5BYQA 2R2QA 3AU5A 1V86A 3DBLI 3TEZA 4XZ4A 3R7RA 4AP4C 4DXFA 2KD0A 3N1ZC 3TCAA 4BFRA 2WXQA 1F2RI 2BVCA 1D5MC 1FD6A 4LK0M 2RGFA 2N7DA 4B9KA 1SJED 1F0ZA 3PV1A 1P0RA 2QIEB 1PQSA 1QOBA 1YQ3B 4R3DA 3APFA 4W9JA 4X57B 1DOXA 1CJEA 2OJRA 1V49A 5G5HA 5EE3A 3EUB2 1TBEA 5JXVA 1UBIA 3PSEB 1HTOA 3DHIC 3LXFA 2MWSB 3AE9B 2DHZA 3P1MA 3AB5A 3UIPB 2OJWA 4MGIE 4C4VB 1VRAB 4OVZA 2KLCA 1L4DB 1XCQL 1E6EB 3T3OA 2MX2A 3MFGA 3ALBA 4XWTA 3AE3B 1AARA 2H89B 2J7QB 3IBEA 2LJIA 3Q69A 4N59A 3R3MA 3IHPC 5AZFA 4IKGA 2ZCCA 1QKZA 2QEJC 2ZVOA 2JWUA 1LO5D 2N4FA 2N9LA 2ZZPB 2MA9B 4A6QA 2K0PA 1R4MB 2VRRB 3AEDB 1I7HA 1TS4A 2PE6B 1VCBA 4OVVA 3ZO5B 2BPSA 2LVQA 3OWEB 3KWVA 1T0SC 3VVWB 4ZRIA 5DPWA 1WX8A 2ZNVB 2CR5A 2L32A 4BOSC 1P9DU 2IO0B 4A3OA 1V97A 4DHZE 1GC7A 5DCNA 3BINA 1WXAA 3APDA 2G4SA 3NZUA 2JSVX 5JHBA 3FAHA 4E71A 1D4BA 1SB3C 1ZXHA 2KFKA 4C7YA 1WXQA 3M95A 3VTWA 4TV3A 3C19A 4HJKA 4E3CA 2EELA 4XYCA 5E6NA 1TZ1A 3OG5A 2WWZA 5DPSA 3QQ8B 3ZYYX 2D5GA 1WGRA 4RFBA
chains in the Genus database with same CATH topology
1UGMA 5LXHA 2ZJDA 2GBNA 2KX0A 1WXSA 2J0KA 4LJPB 1WRDB 4MGYE 4W9HA 1R4MI 1YD8U 4BBNF 4I6LB 2MLBA 3N30A 2G4DB 3NZSA 2G3QB 3NHEB 3Q3FA 3IFWB 4PS3A 5EDSA 3M63B 3WALA 3QHTA 2C9WB 4WJPA 3V61A 2KQSA 3GOEA 2KWVB 3QX1A 2K6QA 2LD9A 3VQIA 4GIVA 3JW0X 4KSLC 3V6CB 2IYDB 4IC7B 3ZKJC 3L08A 3RZFA 3UGBB 1WGGA 1E8WA 3PLUA 4W9CA 2BGFA 3VH3B 1Z2MA 3DOWA 1WJ6A 4HLEA 1WR6E 4TUUA 1UZXB 3H7PB 3PGEA 4RMAA 3ZRCA 4FBJB 2KANA 3QA8A 1XQQA 4KZCA 2W9NA 2LGXA 1P98A 1H8CA 2KOXA 3A1QB 4KDLB 4ASWC 3JSVB 4GSWA 2KWCA 2KDBA 2N7EA 2L3ZA 4MEMA 2RPQA 3UF8A 4ZRJA 4KIKA 3VUXA 4F8CB 2YLMA 4KZ0A 1V9JA 4FHJA 3OLMD 4J6IA 4G11A 2ASQA 3VHTC 3ZNGC 4M8NA 3PS6A 1XD3B 1FXTB 4MGZE 4PYUA 3TMPB 4A20A 4CYEA 3W1SC 1ZKHA 1WE6A 4ICVA 2NVUI 4MJSB 3NS8A 1YJ1A 4WJOA 2ZCBA 2LXCA 3A33B 2EMSA 3RULA 1GJZA 2C5LC 1KM7A 5E6PA 3C0RB 1P1AA 1E5WA 2MBQA 2CS4A 4ZDVA 3KW5B 2FCQA 2JRIB 4LJOB 3KVFB 2Z0EB 1LM8B 4MSMB 2K8HA 4FJVB 3DVNV 3M62B 2REXA 5DPRA 3K9OB 3DCGA 3H1UA 1CMXB 1WE7A 3MJWA 3ZTCA 2CHZA 2MW5A 1WXMA 2MRPA 1RRBA 1V6EA 2BKRB 2ZPYA 2I1KA 1IPGA 5IAAC 4ANVA 3PZDA 1S3SG 3MHSD 2JWZA 2KLGA 2WX1A 2KTRA 2BWES 1RFAA 4G0NB 1KJTA 1UBQA 3ZW3A 4EKUA 4JQWC 4NNJB 2LJ5A 5G2NA 3RCZA 2OOBB 2KFKB 2UYZB 4NQLB 1V5OA 4DHJB 4YL8A 3P2BA 2ZVNA 3DPDA 5AEKB 4KV2A 4M8MA 1Q1OA 5CX3A 4B95A 4F1SA 2DAFA 1YX5B 3HM6X 4BKSA 1EO6A 2K39A 2LWPA 2FNJB 5IA7A 3NOBA 2NBUA 2M8SA 2BYFA 3W1SA 3PRMB 2D3GA 3KYDD 1UELA 2NPTB 3PPAA 1E8XA 3QWZB 4DK5A 1RAXA 2M0XA 2L05A 1GG3A 3PRPB 3SHQA 4BOZB 3TIXA 2N9PC 3ZLZA 1V80A 1P3QU 5AZGA 5JHAA 1WY8A 3DQVA 2N9XA 1WMHB 1OQYA 2GBMA 4DHJD 2I1JA 1WF9A 2GOWA 3ZDMC 4MSQB 3ZTDA 2D2QA 1NI2A 4DDID 3EHVA 5CHWA 1V81A 1ZGUB 3X23A 4LDTB 2JUOA 1WX9A 4W9KA 3TBLD 3ZUNA 1YQBA 4W9LA 2KDIA 4FA6A 2J0MA 2O2VA 2FAZA 2FUHB 3APCA 4EUTA 4AWJA 1E8ZA 3ML9A 3Q3JA 3JVZX 2YVCA 1I42A 1NBFC 3H6NA 1TTNA 3QK0A 3AULA 2O6VA 2KZRA 3EECA 1WI0A 2DZIA 2XK5A 1GC6A 2JF5A 2LRWA 4IM2A 3D32A 3KUDB 1WX7A 1C3TA 2GBJA 2ZPNA 3EFUA 3H7SA 3UQBA 1WFYA 2FIDA 2PPHA 1SE9A 4RM9A 2KDFB 2AEHA 2C7HA 2LUEA 4LDTD 4JL9A 2LVOA 3I3TB 1WZ3A 4KIKB 3V60A 4NY0A 4PS8A 4K7UA 4N9F4 4HK2A 1SIFA 2BWFA 2MP2A 1WJUA 3CF6E 3PTFC 3QJZA 4GDLA 4NAWA 4BVUC 4BBNC 1Q0WB 1Q5WB 2K1FA 4W9EA 2LI5A 4IWQA 3TL5A 1L2NA 1QZEA 3QC8B 5D94A 2IY1B 4NQKE 5E6OA 5C23A 2K25A 2K6DB 3U8ZA 3VAWA 3UIOB 1Y8RC 2L8JA 3NY5A 4P7IA 3CSFA 5BO4B 2DYBA 1X1MA 3VDZA 3B1LX 2KMAA 2V3SA 4A3PA 1WZ0A 2JXXA 1HE8A 2KTFA 2RD0A 3V6EB 1RLFA 2JVCA 4AOFA 1ZW7A 3T8MA 2AL6A 5CTRC 3WA0A 1NDDA 4WWOA 1J0GA 2N9EB 1F9JA 2IO2B 2EMTA 2L0FA 2LVPA 2KDEB 2KO3A 5LLIA 1S1QB 2ZEQA 4W9GA 1H4RA 4EZLA 4ICUA 4MH0E 4G3XB 1ISNA 1KOTA 2K8CA 3KUCB 2KJ6A 2K8BA 1IYFA 4IM3A 2KTRB 2LASA 4I6NB 4F7ZA 4KDIC 4B6WA 2WX0A 3R66C 3M3JA 3ZDTA 1OTRB 2D10A 1EUVB 3DBRI 3A9KA 4GN1A 4WQOB 3OJ4B 5G55A 2DENB 3N3KB 2KVRA 2ZNVC 3DBHI 1WM3A 5FR6A 2WYQA 4CO7A 4K81A 2BYEA 4ZYNA 3MTNB 3T9LA 4NJ6A 3QARA 3WAMA 1WJ4A 2JPHA 4M0WB 5D6JB 4ANUA 2MBHA 2IO3B 3U7DA 4HCPB 4JLCA 4EEWA 3ZVVA 3ZIMA 4WWPA 4IWOA 4ANWA 2NR2A 2C7NB 3S2AA 2M1MA 1UH6A 2FCNA 2MQJA 1IP9A 3DVGY 1WYWB 4LCDE 3WAOA 3AI5A 3X0WA 3DBSA 3A9JA 2CHXA 2XEWA 3V62A 3ZNHB 1V5TA 1D3ZA 1LQBA 2Z59B 4NJ7A 4MGKE 3VFKA 3BY4B 4AUQC 2A4ZA 2KWUB 1MG8A 3GZNI 1I35A 2G45B 2KJRA 4MM3A 4RM8A 3OAWA 3PHWB 2A5UA 3HIZA 4GGQA 3WAPA 3CSTA 4WAAA 3DVNU 3RT3B 2M4NA 2PE9A 4IUMB 3OJ3A 4FHKA 4IWPA 3ZNID 4EZJA 2WDTB 2AYOB 5L83A 2O2VB 2AWTA 4BKGA 1V2YA 3JYUA 4EFOA 2NBWB 3O65B 1Z5SB 1GUAB 4II2B 3IVFA 3LJ3A 4GDKA 4GOCA 4PYZA 1WM2A 2PJHA 2LXAA 5DPTA 2NCNA 2O6VB 3PT2B 1YIWA 1YX6B 3ENEA 2KK8A 2KKCA 4EZKA 2KHWB 5GMVA 4FADA 4XC2A 2KNBA 2GBRA 3L54A 3VXWA 1KLVA 3B0AA 4HDOA 1SGHA 3W1YA 2R2QA 3AU5A 2LZ6A 1V86A 2NS5A 4HVBA 2CU1A 2XBBC 1WH3A 3DBLI 2HE7A 4XZ4A 2GBKA 3R7RA 4AP4C 2RSUA 2BYVE 2KD0A 4HPLB 4KSKC 5J2RA 3IG3A 3TCAA 4HXDA 2LGYA 4BFRA 1E7UA 2MP2B 1EF1A 5D2MB 2KC1A 3RUIB 4OVUA 5J18A 2R2OA 2MBOA 2O6VD 2UWQA 2NPTA 3RYTA 5JH5C 2RGFA 4E74A 5KHQA 4FULA 4DDGD 2N7DA 4B9KA 3AU4A 4BKTA 4NPNA 3WANA 3PV1A 3QIJA 1P0RA 3HK0A 4II3B 3N32A 3RD2A 4TKNA 1E8YA 1PQSA 2EKEC 1J19A 1TGZB 2JZ3B 2BKFA 3ZRFA 3R7QA 2DZKA 4GMVA 3APFA 4W9JA 5CHVC 4X57B 4WJQA 4URKA 2DX5B 2B3AA 4WJNA 2IO1B 3WIMA 2OJRA 3ECIA 1V49A 5C1ZA 4JGHB 1TBEA 2Z0DB 4FLHA 1UBIA 3PSEB 1E90A 5D7GA 3KH0A 2CHWA 3VH4B 2MWSB 2NBVB 2IBIB 1WR1A 4W9FA 2DHZA 2IZVB 3A9KB 2KMCA 2KJHB 3UIPB 4MGIE 1OEYJ 2Y5BB 2HD5B 4XX5A 4MDKE 2JRHA 2L0TA 2BF8B 4W9IA 4TQ0A 2KLCA 3QAQA 4WWNA 1WJNA 4GB9A 3VUWA 3EC8A 3PRZA 4TQ1A 5J17A 1M94A 1WXVA 5JZEB 3LDZE 3TJPA 2MX2A 3ALBA 2JT4B 2V4LA 4G50A 5CHFA 3RZWC 1AARA 2JZZA 1OGWA 2DYOA 2GMIC 2J7QB 1A5RA 2DZJA 1UD7A 3AXCA 3IBEA 1E7VA 3H7PA 3A4SC 3IHPC 3A4RA 3A9JB 3R3MA 4HDQA 5AZFA 1C1YB 2ZCCA 1XT9B 2ZVOA 3A1QA 2D07B 4HWIB 2N4FA 2ZZPB 3JSVA 4GXBA 1LXDA 2L00B 3KUZA 2HJ8A 4FN2A 2MA9B 1LFDA 4DXAB 3UQAA 4FJZA 2VRRB 2KQ7A 5AZHA 3L0WB 4CHKA 2MBEA 1J8CA 2DAJA 1OEYA 2PE6B 4I6PA 2RR9A 1VCBA 4MJSA 1WGHA 4OVVA 3ZO5B 2BPSA 2MSED 3ZNZB 2KN5A 2LVQA 2J0JA 2QHOA 4GDKB 5L95C 3L13A 2KXJA 3HM3A 2FIFA 3VVWB 2C60A 3VUYA 4JIOU 4ZRIA 2MBBB 5DPWA 1WX8A 4PS7A 2PEAA 4BKSD 2FCSA 2ZNVB 2CR5A 4ANXA 4BOSC 1P9DU 1T0YA 4ZRKA 2L76A 2DZMA 4FJYA 4HPMB 1WGYA 2CKHB 2IO0B 2AL3A 3L17A 3PVLA 3U30A 3B08A 1GNUA 2KX3A 4K1RB 4W9DA 2MCNB 4A3OA 3CMMB 1G6JA 1VD2A 4KVGB 4DHZE 4EOYA 3PREA 1GC7A 5DCNA 2C7MB 3BINA 1L7YA 3H9DA 1WXAA 2FCMA 2XK5B 3K9PB 3APDA 2G4SA 3NZUA 3SU8X 4DBGA 5JHBA 5TR5A 3SDLC 2HTHA 3PLVA 4E71A 2LGDA 5KHOA 2L7RA 2KFKA 3KYCD 3DDCB 4HCNB 2V1YA 1BT0A 4IM0A 4DWFA 2N1VA 1JRUA 3M95A 2M17A 3ML8A 3DVGX 4IW0A 3VTWA 1EF5A 4IG7B 3PHXB 1K8RB 4TV3A 3ONSA 5HKHA 2LRUA 4AJWA 4GDLB 4NAWB 2D11A 3HHMA 4HJKA 4MELA 2IY0B 4K7WA 4E3CA 3L16A 3QCAA 3UINB 5E6NA 1TZ1A 1U4AA 2WWZA 3VTUA 4DHZB 2N1WA 5DPSA 4AJYB 4GU2A 1R4NI 2KFJA 1WGDA 3L10B 3SD5A 1WIAA 2DYMA 2JY6A 3QQ8B 1WGRA 1WMHA 4K7SA 3VTVA 2KC2A 5LXIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGM A;  5LXH A;  2ZJD A;  2GBN A;  2KX0 A;  1WXS A;  2J0K A;  4LJP B;  1WRD B;  4MGY E;  4W9H A;  1R4M I;  1YD8 U;  4BBN F;  4I6L B;  2MLB A;  3N30 A;  2G4D B;  3NZS A;  2G3Q B;  3NHE B;  3Q3F A;  3IFW B;  4PS3 A;  5EDS A;  3M63 B;  3WAL A;  3QHT A;  2C9W B;  4WJP A;  3V61 A;  2KQS A;  3GOE A;  2KWV B;  3QX1 A;  2K6Q A;  2LD9 A;  3VQI A;  4GIV A;  3JW0 X;  4KSL C;  3V6C B;  2IYD B;  4IC7 B;  3ZKJ C;  3L08 A;  3RZF A;  3UGB B;  1WGG A;  1E8W A;  3PLU A;  4W9C A;  2BGF A;  3VH3 B;  1Z2M A;  3DOW A;  1WJ6 A;  4HLE A;  1WR6 E;  4TUU A;  1UZX B;  3H7P B;  3PGE A;  4RMA A;  3ZRC A;  4FBJ B;  2KAN A;  3QA8 A;  1XQQ A;  4KZC A;  2W9N A;  2LGX A;  1P98 A;  1H8C A;  2KOX A;  3A1Q B;  4KDL B;  4ASW C;  3JSV B;  4GSW A;  2KWC A;  2KDB A;  2N7E A;  2L3Z A;  4MEM A;  2RPQ A;  3UF8 A;  4ZRJ A;  4KIK A;  3VUX A;  4F8C B;  2YLM A;  4KZ0 A;  1V9J A;  4FHJ A;  3OLM D;  4J6I A;  4G11 A;  2ASQ A;  3VHT C;  3ZNG C;  4M8N A;  3PS6 A;  1XD3 B;  1FXT B;  4MGZ E;  4PYU A;  3TMP B;  4A20 A;  4CYE A;  3W1S C;  1ZKH A;  1WE6 A;  4ICV A;  2NVU I;  4MJS B;  3NS8 A;  1YJ1 A;  4WJO A;  2ZCB A;  2LXC A;  3A33 B;  2EMS A;  3RUL A;  1GJZ A;  2C5L C;  1KM7 A;  5E6P A;  3C0R B;  1P1A A;  1E5W A;  2MBQ A;  2CS4 A;  4ZDV A;  3KW5 B;  2FCQ A;  2JRI B;  4LJO B;  3KVF B;  2Z0E B;  1LM8 B;  4MSM B;  2K8H A;  4FJV B;  3DVN V;  3M62 B;  2REX A;  5DPR A;  3K9O B;  3DCG A;  3H1U A;  1CMX B;  1WE7 A;  3MJW A;  3ZTC A;  2CHZ A;  2MW5 A;  1WXM A;  2MRP A;  1RRB A;  1V6E A;  2BKR B;  2ZPY A;  2I1K A;  1IPG A;  5IAA C;  4ANV A;  3PZD A;  1S3S G;  3MHS D;  2JWZ A;  2KLG A;  2WX1 A;  2KTR A;  2BWE S;  1RFA A;  4G0N B;  1KJT A;  1UBQ A;  3ZW3 A;  4EKU A;  4JQW C;  4NNJ B;  2LJ5 A;  5G2N A;  3RCZ A;  2OOB B;  2KFK B;  2UYZ B;  4NQL B;  1V5O A;  4DHJ B;  4YL8 A;  3P2B A;  2ZVN A;  3DPD A;  5AEK B;  4KV2 A;  4M8M A;  1Q1O A;  5CX3 A;  4B95 A;  4F1S A;  2DAF A;  1YX5 B;  3HM6 X;  4BKS A;  1EO6 A;  2K39 A;  2LWP A;  2FNJ B;  5IA7 A;  3NOB A;  2NBU A;  2M8S A;  2BYF A;  3W1S A;  3PRM B;  2D3G A;  3KYD D;  1UEL A;  2NPT B;  3PPA A;  1E8X A;  3QWZ B;  4DK5 A;  1RAX A;  2M0X A;  2L05 A;  1GG3 A;  3PRP B;  3SHQ A;  4BOZ B;  3TIX A;  2N9P C;  3ZLZ A;  1V80 A;  1P3Q U;  5AZG A;  5JHA A;  1WY8 A;  3DQV A;  2N9X A;  1WMH B;  1OQY A;  2GBM A;  4DHJ D;  2I1J A;  1WF9 A;  2GOW A;  3ZDM C;  4MSQ B;  3ZTD A;  2D2Q A;  1NI2 A;  4DDI D;  3EHV A;  5CHW A;  1V81 A;  1ZGU B;  3X23 A;  4LDT B;  2JUO A;  1WX9 A;  4W9K A;  3TBL D;  3ZUN A;  1YQB A;  4W9L A;  2KDI A;  4FA6 A;  2J0M A;  2O2V A;  2FAZ A;  2FUH B;  3APC A;  4EUT A;  4AWJ A;  1E8Z A;  3ML9 A;  3Q3J A;  3JVZ X;  2YVC A;  1I42 A;  1NBF C;  3H6N A;  1TTN A;  3QK0 A;  3AUL A;  2O6V A;  2KZR A;  3EEC A;  1WI0 A;  2DZI A;  2XK5 A;  1GC6 A;  2JF5 A;  2LRW A;  4IM2 A;  3D32 A;  3KUD B;  1WX7 A;  1C3T A;  2GBJ A;  2ZPN A;  3EFU A;  3H7S A;  3UQB A;  1WFY A;  2FID A;  2PPH A;  1SE9 A;  4RM9 A;  2KDF B;  2AEH A;  2C7H A;  2LUE A;  4LDT D;  4JL9 A;  2LVO A;  3I3T B;  1WZ3 A;  4KIK B;  3V60 A;  4NY0 A;  4PS8 A;  4K7U A;  4N9F 4;  4HK2 A;  1SIF A;  2BWF A;  2MP2 A;  1WJU A;  3CF6 E;  3PTF C;  3QJZ A;  4GDL A;  4NAW A;  4BVU C;  4BBN C;  1Q0W B;  1Q5W B;  2K1F A;  4W9E A;  2LI5 A;  4IWQ A;  3TL5 A;  1L2N A;  1QZE A;  3QC8 B;  5D94 A;  2IY1 B;  4NQK E;  5E6O A;  5C23 A;  2K25 A;  2K6D B;  3U8Z A;  3VAW A;  3UIO B;  1Y8R C;  2L8J A;  3NY5 A;  4P7I A;  3CSF A;  5BO4 B;  2DYB A;  1X1M A;  3VDZ A;  3B1L X;  2KMA A;  2V3S A;  4A3P A;  1WZ0 A;  2JXX A;  1HE8 A;  2KTF A;  2RD0 A;  3V6E B;  1RLF A;  2JVC A;  4AOF A;  1ZW7 A;  3T8M A;  2AL6 A;  5CTR C;  3WA0 A;  1NDD A;  4WWO A;  1J0G A;  2N9E B;  1F9J A;  2IO2 B;  2EMT A;  2L0F A;  2LVP A;  2KDE B;  2KO3 A;  5LLI A;  1S1Q B;  2ZEQ A;  4W9G A;  1H4R A;  4EZL A;  4ICU A;  4MH0 E;  4G3X B;  1ISN A;  1KOT A;  2K8C A;  3KUC B;  2KJ6 A;  2K8B A;  1IYF A;  4IM3 A;  2KTR B;  2LAS A;  4I6N B;  4F7Z A;  4KDI C;  4B6W A;  2WX0 A;  3R66 C;  3M3J A;  3ZDT A;  1OTR B;  2D10 A;  1EUV B;  3DBR I;  3A9K A;  4GN1 A;  4WQO B;  3OJ4 B;  5G55 A;  2DEN B;  3N3K B;  2KVR A;  2ZNV C;  3DBH I;  1WM3 A;  5FR6 A;  2WYQ A;  4CO7 A;  4K81 A;  2BYE A;  4ZYN A;  3MTN B;  3T9L A;  4NJ6 A;  3QAR A;  3WAM A;  1WJ4 A;  2JPH A;  4M0W B;  5D6J B;  4ANU A;  2MBH A;  2IO3 B;  3U7D A;  4HCP B;  4JLC A;  4EEW A;  3ZVV A;  3ZIM A;  4WWP A;  4IWO A;  4ANW A;  2NR2 A;  2C7N B;  3S2A A;  2M1M A;  1UH6 A;  2FCN A;  2MQJ A;  1IP9 A;  3DVG Y;  1WYW B;  4LCD E;  3WAO A;  3AI5 A;  3X0W A;  3DBS A;  3A9J A;  2CHX A;  2XEW A;  3V62 A;  3ZNH B;  1V5T A;  1D3Z A;  1LQB A;  2Z59 B;  4NJ7 A;  4MGK E;  3VFK A;  3BY4 B;  4AUQ C;  2A4Z A;  2KWU B;  1MG8 A;  3GZN I;  1I35 A;  2G45 B;  2KJR A;  4MM3 A;  4RM8 A;  3OAW A;  3PHW B;  2A5U A;  3HIZ A;  4GGQ A;  3WAP A;  3CST A;  4WAA A;  3DVN U;  3RT3 B;  2M4N A;  2PE9 A;  4IUM B;  3OJ3 A;  4FHK A;  4IWP A;  3ZNI D;  4EZJ A;  2WDT B;  2AYO B;  5L83 A;  2O2V B;  2AWT A;  4BKG A;  1V2Y A;  3JYU A;  4EFO A;  2NBW B;  3O65 B;  1Z5S B;  1GUA B;  4II2 B;  3IVF A;  3LJ3 A;  4GDK A;  4GOC A;  4PYZ A;  1WM2 A;  2PJH A;  2LXA A;  5DPT A;  2NCN A;  2O6V B;  3PT2 B;  1YIW A;  1YX6 B;  3ENE A;  2KK8 A;  2KKC A;  4EZK A;  2KHW B;  5GMV A;  4FAD A;  4XC2 A;  2KNB A;  2GBR A;  3L54 A;  3VXW A;  1KLV A;  3B0A A;  4HDO A;  1SGH A;  3W1Y A;  2R2Q A;  3AU5 A;  2LZ6 A;  1V86 A;  2NS5 A;  4HVB A;  2CU1 A;  2XBB C;  1WH3 A;  3DBL I;  2HE7 A;  4XZ4 A;  2GBK A;  3R7R A;  4AP4 C;  2RSU A;  2BYV E;  2KD0 A;  4HPL B;  4KSK C;  5J2R A;  3IG3 A;  3TCA A;  4HXD A;  2LGY A;  4BFR A;  1E7U A;  2MP2 B;  1EF1 A;  5D2M B;  2KC1 A;  3RUI B;  4OVU A;  5J18 A;  2R2O A;  2MBO A;  2O6V D;  2UWQ A;  2NPT A;  3RYT A;  5JH5 C;  2RGF A;  4E74 A;  5KHQ A;  4FUL A;  4DDG D;  2N7D A;  4B9K A;  3AU4 A;  4BKT A;  4NPN A;  3WAN A;  3PV1 A;  3QIJ A;  1P0R A;  3HK0 A;  4II3 B;  3N32 A;  3RD2 A;  4TKN A;  1E8Y A;  1PQS A;  2EKE C;  1J19 A;  1TGZ B;  2JZ3 B;  2BKF A;  3ZRF A;  3R7Q A;  2DZK A;  4GMV A;  3APF A;  4W9J A;  5CHV C;  4X57 B;  4WJQ A;  4URK A;  2DX5 B;  2B3A A;  4WJN A;  2IO1 B;  3WIM A;  2OJR A;  3ECI A;  1V49 A;  5C1Z A;  4JGH B;  1TBE A;  2Z0D B;  4FLH A;  1UBI A;  3PSE B;  1E90 A;  5D7G A;  3KH0 A;  2CHW A;  3VH4 B;  2MWS B;  2NBV B;  2IBI B;  1WR1 A;  4W9F A;  2DHZ A;  2IZV B;  3A9K B;  2KMC A;  2KJH B;  3UIP B;  4MGI E;  1OEY J;  2Y5B B;  2HD5 B;  4XX5 A;  4MDK E;  2JRH A;  2L0T A;  2BF8 B;  4W9I A;  4TQ0 A;  2KLC A;  3QAQ A;  4WWN A;  1WJN A;  4GB9 A;  3VUW A;  3EC8 A;  3PRZ A;  4TQ1 A;  5J17 A;  1M94 A;  1WXV A;  5JZE B;  3LDZ E;  3TJP A;  2MX2 A;  3ALB A;  2JT4 B;  2V4L A;  4G50 A;  5CHF A;  3RZW C;  1AAR A;  2JZZ A;  1OGW A;  2DYO A;  2GMI C;  2J7Q B;  1A5R A;  2DZJ A;  1UD7 A;  3AXC A;  3IBE A;  1E7V A;  3H7P A;  3A4S C;  3IHP C;  3A4R A;  3A9J B;  3R3M A;  4HDQ A;  5AZF A;  1C1Y B;  2ZCC A;  1XT9 B;  2ZVO A;  3A1Q A;  2D07 B;  4HWI B;  2N4F A;  2ZZP B;  3JSV A;  4GXB A;  1LXD A;  2L00 B;  3KUZ A;  2HJ8 A;  4FN2 A;  2MA9 B;  1LFD A;  4DXA B;  3UQA A;  4FJZ A;  2VRR B;  2KQ7 A;  5AZH A;  3L0W B;  4CHK A;  2MBE A;  1J8C A;  2DAJ A;  1OEY A;  2PE6 B;  4I6P A;  2RR9 A;  1VCB A;  4MJS A;  1WGH A;  4OVV A;  3ZO5 B;  2BPS A;  2MSE D;  3ZNZ B;  2KN5 A;  2LVQ A;  2J0J A;  2QHO A;  4GDK B;  5L95 C;  3L13 A;  2KXJ A;  3HM3 A;  2FIF A;  3VVW B;  2C60 A;  3VUY A;  4JIO U;  4ZRI A;  2MBB B;  5DPW A;  1WX8 A;  4PS7 A;  2PEA A;  4BKS D;  2FCS A;  2ZNV B;  2CR5 A;  4ANX A;  4BOS C;  1P9D U;  1T0Y A;  4ZRK A;  2L76 A;  2DZM A;  4FJY A;  4HPM B;  1WGY A;  2CKH B;  2IO0 B;  2AL3 A;  3L17 A;  3PVL A;  3U30 A;  3B08 A;  1GNU A;  2KX3 A;  4K1R B;  4W9D A;  2MCN B;  4A3O A;  3CMM B;  1G6J A;  1VD2 A;  4KVG B;  4DHZ E;  4EOY A;  3PRE A;  1GC7 A;  5DCN A;  2C7M B;  3BIN A;  1L7Y A;  3H9D A;  1WXA A;  2FCM A;  2XK5 B;  3K9P B;  3APD A;  2G4S A;  3NZU A;  3SU8 X;  4DBG A;  5JHB A;  5TR5 A;  3SDL C;  2HTH A;  3PLV A;  4E71 A;  2LGD A;  5KHO A;  2L7R A;  2KFK A;  3KYC D;  3DDC B;  4HCN B;  2V1Y A;  1BT0 A;  4IM0 A;  4DWF A;  2N1V A;  1JRU A;  3M95 A;  2M17 A;  3ML8 A;  3DVG X;  4IW0 A;  3VTW A;  1EF5 A;  4IG7 B;  3PHX B;  1K8R B;  4TV3 A;  3ONS A;  5HKH A;  2LRU A;  4AJW A;  4GDL B;  4NAW B;  2D11 A;  3HHM A;  4HJK A;  4MEL A;  2IY0 B;  4K7W A;  4E3C A;  3L16 A;  3QCA A;  3UIN B;  5E6N A;  1TZ1 A;  1U4A A;  2WWZ A;  3VTU A;  4DHZ B;  2N1W A;  5DPS A;  4AJY B;  4GU2 A;  1R4N I;  2KFJ A;  1WGD A;  3L10 B;  3SD5 A;  1WIA A;  2DYM A;  2JY6 A;  3QQ8 B;  1WGR A;  1WMH A;  4K7S A;  3VTV A;  2KC2 A;  5LXI B; 
#chains in the Genus database with same CATH topology
 1AN8 A;  2J0K A;  4MGY E;  2WXK A;  1YD8 U;  2MLB A;  3N30 A;  2G4D B;  1J7C A;  3AE6 B;  3Q3F A;  5EDS A;  3WAL A;  3QHT A;  4WJP A;  2WXI A;  3GOE A;  1VR9 A;  3QX1 A;  2K6Q A;  3VQI A;  4GIV A;  1NI3 A;  3UGB B;  1WGG A;  2M19 A;  1Z2M A;  1WJ6 A;  4RMA A;  2KAN A;  3QA8 A;  1P98 A;  4OZA A;  2KOX A;  3NG0 A;  1AYF A;  4ASW C;  5MPO A;  2IGH A;  4MEM A;  2L3Z A;  5FR3 A;  2DBY A;  3KQ4 A;  1V9J A;  1EWC A;  4J6I A;  4NZL B;  3PS6 A;  2YEP B;  1FXT B;  4A20 A;  2W3S A;  1WE6 A;  2NVU I;  2INN E;  4WJO A;  3FKY A;  2ZCB A;  3A33 B;  2EMS A;  1E0Z A;  3SEB A;  3AE1 B;  2WXR A;  5E6P A;  1V1P B;  1P1A A;  1E5W A;  2MBQ A;  3E56 A;  4A90 A;  3TEY A;  3NVV A;  3Q2A C;  3ETR A;  1CMX B;  3ZTC A;  3L4P A;  1V6E A;  1IBX A;  2I1K A;  1FO4 A;  1DGJ A;  2KLG A;  1RFA A;  1TIF A;  4RH6 A;  4JQW C;  2LJ5 A;  2KFK B;  1V5O A;  3Q3M C;  4ARI A;  2ZVN A;  5AEK B;  3FC4 A;  5IOI A;  1Q1O A;  2DAF A;  4MH8 A;  3HM6 X;  4KKJ A;  1NVI D;  3PRM B;  1B9R A;  4WUR A;  3CIR B;  2FUG 1;  1UEL A;  1E9M A;  3MC9 A;  2M0X A;  2L05 A;  2PMV A;  3PRP B;  2KT7 A;  3HUI A;  1P3Q U;  5JHA A;  2KQ4 X;  4K3B A;  4DHJ D;  1YMH E;  1WF9 A;  2PVO D;  2W54 A;  4DDI D;  5CHW A;  1IGC A;  4REZ A;  4BAX A;  4W9K A;  1TYG B;  3ZUN A;  2PTL A;  3GB1 A;  2ONQ A;  4TMA B;  4AWJ A;  1NBF C;  1MG4 A;  1TTN A;  2BB6 A;  3AUL A;  2O6V A;  2KZR A;  1GC6 A;  4IM2 A;  2WHI A;  3KUD B;  3UQB A;  1WFY A;  1KFY B;  4RM9 A;  2KDF B;  1MPE A;  4LDT D;  3PZ8 A;  1TY0 A;  3AE8 B;  2X38 A;  4PS8 A;  4HK2 A;  1SIF A;  4JWU C;  3T3N A;  5FK9 C;  4W9E A;  1QZE A;  5D94 A;  2IY1 B;  4NQK E;  5C23 A;  1GB1 A;  3VAW A;  3UIO B;  4LNK A;  3NY5 A;  4A3P A;  3RN9 C;  2JXX A;  2LUM A;  1NEK B;  1WYG A;  2RD0 A;  1ET9 A;  1ZW7 A;  3AEA B;  1XXG A;  3WA0 A;  2N9E B;  2L0F A;  4OHJ A;  1IBX B;  4G3X B;  2BW2 A;  1FFV A;  3Q14 C;  3KUC B;  1IYF A;  4IM3 A;  3MP9 A;  4I6N B;  4B6W A;  3R66 C;  1OTR B;  3DBR I;  3N9Y C;  4YXD B;  3BK2 A;  4WQO B;  2RDB C;  2MJD A;  2LGI A;  2GRI A;  1FM0 D;  2WYQ A;  4M02 A;  2BYE A;  4ZYN A;  3T9L A;  3QAR A;  3WAM A;  5D6J B;  1KF6 B;  2M1M A;  1XO3 A;  1UH6 A;  2KVZ A;  4H2A A;  3AI5 A;  1JWS D;  4GLS C;  4KX6 B;  2A4Z A;  3GZN I;  4M01 A;  1FMA D;  3WAP A;  4YTP B;  4DQO C;  2M4N A;  2AQ1 B;  4IUM B;  4FHK A;  2WDT B;  5L83 A;  2AWT A;  3JYU A;  2MEK A;  1SJH D;  3LJ3 A;  4GOC A;  4PYZ A;  1WM2 A;  5EE0 A;  3Q8E A;  2O6V B;  3PT2 B;  1YIW A;  2QSD A;  3MHZ A;  2KK8 A;  3DBR B;  4WH4 A;  4EZK A;  4FAD A;  1N60 A;  3MC8 A;  2GBR A;  5BYS A;  1KLV A;  2LFI A;  3W1Y A;  4ZHP A;  1Q10 A;  1YNT E;  1WH3 A;  3AEC B;  4JE3 B;  3N1X C;  2BQQ A;  4HPL B;  4KSK C;  5J2R A;  3IG3 A;  3AE7 B;  4HXD A;  2LGY A;  1FIQ A;  5BYR A;  1KLU D;  5JH5 C;  2NPT A;  3RYT A;  2YEP F;  1FFU A;  4DDG D;  3RNG C;  2JYE A;  2V3P A;  3AU4 A;  5D3D A;  3WAN A;  3HK0 A;  1JWA D;  3N32 A;  4II3 B;  4TKN A;  1E8Y A;  5CHV C;  4WJQ A;  1NYQ A;  2DX5 B;  4WJN A;  2IO1 B;  1ZDV A;  3NS1 A;  3ECI A;  4JGH B;  2BT6 A;  4RF0 A;  1GAQ B;  1T5X D;  1I4H A;  1YJI A;  1QOF A;  1YN4 A;  2KMC A;  2WXH A;  3P4Q B;  3RNC C;  4MDK E;  5EE1 A;  1HEZ E;  3QAQ A;  4WWN A;  4GB9 A;  3VUW A;  3EC8 A;  3PRZ A;  4TQ1 A;  3AEB B;  5J17 A;  1WXV A;  3LDZ E;  1AW7 A;  1P7E A;  2E3T A;  3Q6B A;  2G1E A;  1R4N B;  4AS1 A;  1XLP A;  2D07 B;  2INC C;  1Y56 A;  3JSV A;  4GXB A;  3RI7 C;  2HJ8 A;  2IDY A;  4CHK A;  2MBE A;  1MHX A;  2DAJ A;  1OEY A;  4MJS A;  1WGH A;  1SSN A;  2VZK D;  2KN5 A;  2J0J A;  3DHG C;  3L13 A;  2KXJ A;  3BYT B;  2KAJ A;  3VUY A;  1TS5 A;  2LEK A;  4PS7 A;  1CK1 A;  1MFW A;  1L0X B;  4ANX A;  2AX5 A;  2MHJ A;  4JX1 C;  1QF6 A;  1N61 A;  2AL3 A;  2D3B A;  3U30 A;  3B08 A;  1GNU A;  2KX3 A;  4W9D A;  2MCN B;  3PRE A;  1L7Y A;  3U52 E;  2N9K A;  2FCM A;  3K9P B;  4DBG A;  5TR5 A;  1ZUD 2;  2LGD A;  4US8 A;  2WXO A;  3DDC B;  1BT0 A;  1L6U A;  2IGG A;  3ML8 A;  3DVG X;  3GS2 A;  4ACF A;  3PHX B;  4K7W A;  3L16 A;  3VTU A;  2ZW0 A;  3IXS A;  4AJY B;  1WGD A;  3SD5 A;  2JY6 A;  4RGN A;  4K7S A;  3VR9 B;  3RMK C;  3BZD B;  2KX0 A;  4LJP B;  1XEE A;  1RWS A;  1R4M I;  4BBN F;  5HI1 A;  1ZP0 B;  1ACC A;  2WGS A;  4HRO A;  2KQS A;  4LNI A;  2LD9 A;  1IGD A;  3JW0 X;  1K51 A;  4KSL C;  1JCK B;  2IYD B;  4IOI E;  3ZKJ C;  3L08 A;  1XF5 L;  3PLU A;  4W9C A;  1I4P A;  3DOW A;  3ZXR A;  4FBJ B;  1CZP A;  1XQQ A;  4KZC A;  1C4A A;  3AMZ A;  2W3R A;  2PVG C;  3JSV B;  2WXL A;  2KWC A;  2KDB A;  4GSW A;  1ET6 A;  4NJC A;  1WGK A;  1YN3 A;  4ZRJ A;  3UF8 A;  3VUX A;  5HHD G;  2YLM A;  4FHJ A;  3OLM D;  2ASQ A;  3VHT C;  1XD3 B;  4MGZ E;  3W1S C;  1ZKH A;  4MJS B;  3H8H A;  1YJJ A;  3RUL A;  4A8X C;  4CQN A;  1GJZ A;  2C5L C;  3KW5 B;  2FCQ A;  2JRI B;  3M62 B;  2REX A;  5DPR A;  3K9O B;  3DCG A;  4B0E A;  1RRB A;  1C79 A;  4US9 A;  4D2K A;  2JWZ A;  2WX1 A;  1WSP A;  5IKC M;  1N6Z A;  1KJT A;  1UBQ A;  2IJ0 A;  5G2N A;  2OOB B;  3P2B A;  3DPD A;  2KN4 A;  3TUO A;  2WXG A;  4M8M A;  5CX3 A;  2L83 A;  2FNJ B;  5IA7 A;  1OQQ A;  3W1S A;  1UNS A;  4KKI A;  3QWZ B;  2MJE A;  4DK5 A;  2PLP A;  3NUH B;  1GG3 A;  4N58 A;  3TIX A;  2N9P C;  3ZLZ A;  1V80 A;  1E10 A;  1OQY A;  2DNF A;  2I1J A;  2JU6 X;  4MSQ B;  3ZTD A;  1NI2 A;  1XLN A;  3EHV A;  1V81 A;  1ZGU B;  2XNA C;  3VRA B;  3X23 A;  2BYT A;  3HVD A;  3TBL D;  2HTM E;  1V8C A;  3RNE C;  2O2V A;  2FAZ A;  2FUH B;  3N20 C;  1E8Z A;  2WLB A;  3Q3J A;  3JVZ X;  2YVC A;  1MHH E;  2AQ2 B;  3AM9 A;  3QK0 A;  3Q8B A;  1DYQ A;  1WI0 A;  2DZI A;  2XK5 A;  2SEB D;  2JF5 A;  3B2F A;  2RDH A;  1C3T A;  3EFU A;  3H7S A;  2OED A;  2PW9 A;  1L5P A;  2AEH A;  2C7H A;  1TY2 A;  1VZ6 A;  3I3T B;  4YT0 B;  4K7U A;  1QOA A;  2BWF A;  2MP2 A;  1WJU A;  2WNM A;  3CF6 E;  4GDL A;  4NAW A;  1JWU D;  4BBN C;  1Q0W B;  1Q5W B;  1NYR A;  2K1F A;  1J7B A;  2LI5 A;  2J52 A;  4IWQ A;  3QC8 B;  2K3U A;  3ZJU A;  4P7I A;  4P6V F;  3CSF A;  5BO4 B;  2DYB A;  3B1L X;  2KMA A;  2SAK A;  1WZ0 A;  2KTF A;  4AOF A;  1RLF A;  1ZXI A;  4HEA 1;  1NDD A;  1FNV A;  3W5V B;  2IO2 B;  2EMT A;  2BBC A;  2KDE B;  5LLI A;  4YSX B;  4EZL A;  1DOI A;  1ISN A;  2RPV A;  1KOT A;  1JML A;  4XDC A;  3M3J A;  4P16 A;  1PGX A;  3B2G A;  1N63 A;  1A70 A;  1SE3 A;  2Y3A A;  4WQM A;  1WJ4 A;  2JPH A;  2N7J A;  2MBH A;  2DLB A;  4WIP A;  1L4Z B;  4HCP B;  4JLC A;  3ZVV A;  3ZIM A;  4IWO A;  1GB4 A;  3KWL A;  1HTQ A;  3I5J C;  1JWM D;  2WXP A;  3DVG Y;  3X0W A;  2CJN A;  3DBS A;  1TJE A;  3A9J A;  3ZNH B;  2XEW A;  2ICI A;  2Z59 B;  4PT5 A;  4AUQ C;  1I35 A;  2KJR A;  2VH2 A;  3OAW A;  3PHW B;  4WAF A;  2QJL A;  4WAA A;  2Y5C A;  3RT3 B;  3ZNI D;  3OJ3 A;  4IWP A;  2O2V B;  1N5W A;  1HXY D;  3O65 B;  4MT5 A;  4II2 B;  2PJH A;  2LXA A;  2NCN A;  5TSS A;  2KKC A;  2KHW B;  3AE5 B;  3Q3O C;  1TKE A;  3B0A A;  4HDO A;  2NS5 A;  4HVB A;  1FRD A;  3PO0 A;  3P4R B;  1I4R A;  3MJ5 A;  1JRP A;  2HE7 A;  4OZC A;  4XWW A;  4LNO A;  4YSY B;  1ENF A;  2RSU A;  2BYV E;  1E7U A;  2MP2 B;  2KC1 A;  1GPX A;  4OVU A;  1T0Q C;  3BWU D;  5J18 A;  1PGA A;  1T6B X;  4PK1 A;  4FUL A;  2V4I B;  1EWY C;  4NPN A;  2JQR B;  3QIJ A;  3RNA C;  2EKE C;  2JZ3 B;  2BKF A;  2DZK A;  4URK A;  1J7A A;  3WIM A;  5C1Z A;  5I4D A;  3C8Y A;  3P63 A;  2Q5W D;  3IAS 1;  4ZHO A;  1E90 A;  5D7G A;  3SFD B;  2CHW A;  3VH4 B;  2NBV B;  4W9F A;  2IZV B;  3CWI A;  1UWM A;  2KJH B;  2EKI A;  4ITK A;  1OEY J;  2Y5B B;  2HDE A;  2L0T A;  2HJ1 A;  4W9I A;  2R61 A;  2LHE A;  3NZ3 A;  3SFE B;  1TS3 A;  1M94 A;  2DWQ A;  4RF1 A;  2NMQ A;  5CHF A;  2JZZ A;  1OGW A;  2DYO A;  2JYT A;  1A5R A;  2DZJ A;  1T3Q A;  1E7V A;  3H7P A;  3A4S C;  3A9J B;  4AQ7 A;  1C1Y B;  2BS3 B;  3A1Q A;  1VJK A;  1B1Z A;  3KUZ A;  1L6V A;  4FN2 A;  1LFD A;  2QCZ A;  4FJZ A;  5AZH A;  3NVY A;  1C4P A;  1J8C A;  2E6X A;  2PKO A;  2RR9 A;  3BVG A;  1D5X C;  2MSE D;  3AH7 A;  5FKA C;  3ZNZ B;  2QHO A;  5L95 C;  3HM3 A;  1JW9 D;  2FIF A;  1HZ6 A;  5AUK A;  4JIO U;  2IND C;  3B9J A;  2FCS A;  1BXT A;  4FJY A;  4HKQ A;  2CKH B;  3PVL A;  3L17 A;  5H92 C;  3CMM B;  1G6J A;  4EOY A;  1K50 A;  2AQ3 B;  1K52 A;  2ON8 A;  2V9H A;  4M0W A;  5D3I B;  3SDL C;  2HTH A;  5GXG B;  1KH0 A;  5KHO A;  3KYC D;  2D3A A;  2WP9 B;  4IM0 A;  4DWF A;  2N1V A;  1JRU A;  2M17 A;  4IW0 A;  4IG7 B;  3ONS A;  5HKH A;  2LRU A;  4AJW A;  2D11 A;  2IY0 B;  3UIN B;  4GU2 A;  1R4N I;  2KFJ A;  3L10 B;  2DYM A;  1F52 A;  3VTV A;  5LXI B;  2ZJD A;  1WXS A;  4W9H A;  4YSZ B;  1WRD B;  2BTE A;  1FXA A;  4I6L B;  5AUI A;  3NZS A;  2G3Q B;  3NHE B;  3IFW B;  1VLB A;  4S0R A;  2C9W B;  3V61 A;  4LLG M;  2JXT A;  2W55 A;  1SE4 A;  3V6C B;  4IC7 B;  4P1B C;  2FBW B;  1FPY A;  1GOZ A;  2BGF A;  5LNK 1;  1ESF A;  3H7P B;  3PGE A;  3ZRC A;  2W9N A;  1SIJ A;  2BB5 A;  3AEF B;  3A1Q B;  2QMT A;  4KDL B;  1SBB B;  3DWG C;  2N7E A;  2RPQ A;  2XN9 C;  4KZ0 A;  1N5X A;  3NRZ A;  3P42 A;  4G11 A;  4PYU A;  3W9C B;  1YJ1 A;  4JWS C;  2LXC A;  3C0R B;  2GI9 A;  4LJO B;  4MSM B;  2K8H A;  3DVN V;  4L23 A;  3RPF C;  3H1U A;  3Q8C A;  4Q2J A;  1WE7 A;  2MW5 A;  2MRP A;  1NEN B;  1WWT A;  1PYW D;  2ZPY A;  1SE2 A;  1I4X A;  3U2S C;  1FRR A;  5IAA C;  3PZD A;  4KGR A;  1S3S G;  3I57 A;  3MHS D;  2X8X X;  2KTR A;  2J4X A;  2WU5 B;  3NJT A;  3ZW3 A;  4EKU A;  2UYZ B;  4NQL B;  4DHJ B;  4YL8 A;  4KV2 A;  3KLS X;  1I4G A;  2LWP A;  1EU4 A;  3NOB A;  3ZQ4 A;  2M8S A;  1OFF A;  1FNW A;  1UUP A;  2D3G A;  3ZJV A;  1K53 A;  3KYD D;  2NPT B;  3E9S A;  1E8X A;  1RAX A;  3BK1 A;  4BOZ B;  1EM7 A;  3P4P B;  2J42 A;  5AZG A;  3UI3 A;  4LNN A;  3DQV A;  2TSS A;  4FXC A;  2LHD A;  2NTS A;  2LGS A;  1TKG A;  2D2Q A;  1QLB B;  4LDT B;  2JUO A;  1WX9 A;  1YQB A;  3EGR A;  3I9V 1;  2J0M A;  1E7P B;  3ML9 A;  3ABV B;  3TSS A;  4YTM B;  3EEC A;  2IPK D;  3D32 A;  1JQ4 A;  2GB1 A;  2FID A;  2PPH A;  1SE9 A;  4RGO S;  4EE2 A;  4IDI A;  2LUE A;  1BML C;  4JL9 A;  2LVO A;  3V60 A;  4NAM A;  1KTK A;  4N9F 4;  3HRD D;  3PTF C;  1ROE A;  3TL5 A;  4ARC A;  5E6O A;  2K25 A;  4LTU A;  3U8Z A;  5IN7 A;  2MH7 A;  1Y8R C;  1V1O A;  4YWG G;  1X1M A;  2NTT A;  4ZYS A;  3TEW A;  5E6J A;  4KGS A;  3U7Z A;  2JVC A;  1TS2 A;  3T8M A;  2AL6 A;  5CTR C;  1F9J A;  2LVP A;  2KWD A;  3DBL B;  4W9G A;  4ICU A;  4MH0 E;  3R8B A;  3GE3 C;  1PDX A;  1ZPS A;  2KTR B;  3ZDT A;  2QC8 A;  4GN1 A;  3A9K A;  2I38 A;  3OJ4 B;  5G55 A;  2WDQ B;  3N3K B;  4QAY A;  5FR6 A;  1WM3 A;  5G5G A;  4CO7 A;  1XLO A;  1F1H A;  4ANU A;  2IO3 B;  3U7D A;  4XE0 A;  4WWP A;  2G9H D;  1FXI A;  5IO9 A;  3S2A A;  2FCN A;  1IP9 A;  4LCD E;  1R7S A;  1VDV A;  2CHX A;  2Y5P A;  1V5T A;  3LYY A;  4MGK E;  3VFK A;  5IP4 D;  3URY A;  3LB8 C;  2KWU B;  1D5Z C;  1XCT L;  4MM3 A;  1V1P A;  4RM8 A;  4WWM A;  3HIZ A;  1D6E C;  3CST A;  4EZJ A;  2PE9 A;  3EFC A;  4BKG A;  4EFO A;  2NBW B;  3MC0 B;  1GUA B;  1PFD A;  4GDK A;  1SEB D;  4XC2 A;  2KNB A;  1SGH A;  2LZ6 A;  2CU1 A;  2XBB C;  3DWM A;  2ZW1 A;  3RNB C;  1LGR A;  2GBK A;  1KLG D;  4ZOH C;  3NVZ A;  4OW0 A;  5HFY A;  5EE9 A;  1EF1 A;  5D2M B;  2WXF A;  3RUI B;  2R2O A;  2MBO A;  2O6V D;  2UWQ A;  4E74 A;  5KHQ A;  4BKT A;  1JRO A;  5HG2 A;  3WCQ A;  3BVM A;  3RD2 A;  1J19 A;  1TGZ B;  3ZRF A;  3R7Q A;  4GMV A;  1XLQ A;  1YOV B;  2MJ3 A;  4C80 A;  3AN1 A;  2B3A A;  3GP7 A;  4P1C C;  4XDD A;  2Z0D B;  4FLH A;  3DHH C;  4DXG A;  2CU3 A;  3KH0 A;  2K9X A;  2RMM A;  1FNU A;  1WR1 A;  2IBI B;  1L0Y B;  3NVW A;  3AV8 A;  2KAC A;  2V0G A;  3A9K B;  1YN5 A;  3AE2 B;  2HD5 B;  4XX5 A;  2JRH A;  2BF8 B;  2I2Y A;  4TQ0 A;  1WJN A;  1UGJ A;  3GE8 C;  3IAM 1;  5JZE B;  3TJP A;  2QIL A;  2VZK B;  2JT4 B;  2V4L A;  4G50 A;  3RZW C;  2BS4 B;  2GMI C;  1UD7 A;  3AXC A;  2WXN A;  3R2T A;  3A4R A;  4HDQ A;  4J3O D;  1XT9 B;  2UU7 A;  4HWI B;  2WQY B;  4MM3 B;  1LXD A;  1T0R C;  2L00 B;  3N1Y C;  4DXA B;  1QQR A;  5T8I A;  3UQA A;  4ZRQ A;  1VZ7 A;  2KQ7 A;  3L0W B;  3SR6 A;  4I6P A;  3Q3N C;  1QT9 A;  4GDK B;  3IT4 B;  1EU3 A;  3VRB B;  1BUI C;  2C60 A;  3ZGZ A;  2INP E;  2MBB B;  2PEA A;  4BKS D;  4RCO A;  2KMM A;  4BZA A;  1T0Y A;  4ZRK A;  2L76 A;  2DZM A;  4HPM B;  1WGY A;  1I4Q A;  4K1R B;  2KYW A;  1VD2 A;  4KVG B;  4UDU C;  2C7M B;  3H9D A;  2XK5 B;  3SU8 X;  3PLV A;  4S17 A;  2B76 B;  2L7R A;  4HCN B;  2V1Y A;  4C7Z A;  1C4C A;  3BYY B;  1N62 A;  1QOG A;  4A55 A;  1EF5 A;  3AEG B;  1K8R B;  4GDL B;  4NAW B;  1DOY A;  2K22 A;  4B0M A;  3HHM A;  4MEL A;  3QCA A;  2J53 A;  1U4A A;  4DHZ B;  2N1W A;  4YTN B;  1ZE3 D;  1WIA A;  4USA A;  1WMH A;  1PGB A;  2KC2 A;  1FEH A;  1UGM A;  4L2Y A;  5LXH A;  3ZJT A;  2GBN A;  3Q8A A;  2V3N A;  2WDR B;  3PZ7 A;  1HA5 A;  1C78 A;  4PS3 A;  3M63 B;  2KWV B;  2WS3 B;  1WRI A;  3V05 A;  4HPP A;  3RZF A;  1E8W A;  3W2D A;  1SF0 A;  3VH3 B;  4HLE A;  1WR6 E;  4TUU A;  1P7F A;  1UZX B;  3Q8F A;  4TSS A;  3FIL A;  2LGX A;  2WDV B;  4MAC A;  1H8C A;  1M4V A;  4KIK A;  4F8C B;  2GLS A;  3J9C A;  2L52 A;  1HZ5 A;  3ZNG C;  4M8N A;  5C2T B;  3TMP B;  4CYE A;  1C76 A;  2RDG A;  4ICV A;  4JPS A;  3I63 C;  3NS8 A;  4A9A A;  1UWX A;  1KM7 A;  4ZDV A;  3W5U B;  2CS4 A;  5C3J B;  3IT6 B;  3EA6 A;  1RM6 C;  3KVF B;  2Z0E B;  1LM8 B;  4FJV B;  1AWD A;  2WU2 B;  1YQ4 B;  2ACZ B;  3MJW A;  4HKZ E;  2CHZ A;  4C56 C;  1WXM A;  2BKR B;  1IPG A;  4ANV A;  2PIA A;  3AE4 B;  2K5P A;  2BWE S;  4G0N B;  4NNJ B;  2QDF A;  3RCZ A;  2M0A A;  4B95 A;  2N0S B;  2W82 A;  4HRS A;  4F1S A;  1YX5 B;  4BKS A;  1EO6 A;  2K39 A;  5BMI A;  2NBU A;  1MVK A;  2BYF A;  4RGM A;  1QIL A;  3VR8 B;  4C00 A;  1OQR A;  1TT5 B;  1VZ8 A;  3PPA A;  4N6E B;  3SHQ A;  1JAL A;  2FE8 A;  1WY8 A;  2N9X A;  3AEE B;  1WMH B;  2GBM A;  4RNA A;  1PUT A;  2GOW A;  3ZDM C;  4RGT A;  4W9L A;  3BII D;  2KDI A;  4FA6 A;  2OHF A;  2WXM A;  3APC A;  4EUT A;  2IGD A;  1TZO A;  1I42 A;  3H6N A;  3O13 A;  4OZB A;  2LRW A;  1WX7 A;  3BVZ A;  2GBJ A;  2ZPN A;  1UF0 A;  3FIL B;  3V3X A;  1FCL A;  3GZN B;  1WZ3 A;  1SXT A;  4KIK B;  4NY0 A;  2JX5 A;  2KDM A;  3QJZ A;  4BVU C;  1ZDX A;  1TKY A;  1F2R C;  1C9F A;  1L2N A;  3RFZ B;  3TEX A;  2K6D B;  2L8J A;  1MJD A;  2M56 B;  3VDZ A;  2V3S A;  1HE8 A;  3V6E B;  2WXJ A;  4M00 A;  1MI0 A;  4WWO A;  1J0G A;  2BS2 B;  1CQV A;  2KO3 A;  1RFK A;  1ZOY B;  1S1Q B;  2ZEQ A;  1H4R A;  1JWB D;  2CJO A;  1HQR D;  5BMG A;  3U4E G;  4KGT A;  2K8C A;  2KJ6 A;  2K8B A;  2LAS A;  1C77 A;  4F7Z A;  4KDI C;  2WX0 A;  2D10 A;  1EUV B;  3R2I A;  2L1A A;  2DEN B;  4C4V A;  2KVR A;  2ZNV C;  3DBH I;  4ZRP A;  5H8Y E;  4K81 A;  3ZXV A;  3MTN B;  4NJ6 A;  4O1N A;  4M0W B;  5BMH A;  2Z8L A;  3RNF C;  4EEW A;  4XGA B;  4ANW A;  2NR2 A;  2C7N B;  1F77 A;  2MQJ A;  2D3C A;  3WAO A;  1WYW B;  3V62 A;  1D3Z A;  1LQB A;  4NJ7 A;  4L1B A;  1L0V B;  1IUE A;  1STE A;  2JZP A;  3BY4 B;  1MG8 A;  2G45 B;  2A5U A;  1KRH A;  4GGQ A;  3DVN U;  2VH1 A;  2AYO B;  1V2Y A;  4K3C A;  1Z5S B;  3HVZ A;  1FCC C;  3IVF A;  5DPT A;  2H88 B;  3ENE A;  1YX6 B;  2LMC A;  3P4S B;  5GMV A;  4LNF A;  3L54 A;  1RYJ A;  3VXW A;  4HJG E;  3DBH B;  5BYQ A;  2R2Q A;  3AU5 A;  1V86 A;  3DBL I;  3TEZ A;  4XZ4 A;  3R7R A;  4AP4 C;  4DXF A;  2KD0 A;  3N1Z C;  3TCA A;  4BFR A;  2WXQ A;  1F2R I;  2BVC A;  1D5M C;  1FD6 A;  4LK0 M;  2RGF A;  2N7D A;  4B9K A;  1SJE D;  1F0Z A;  3PV1 A;  1P0R A;  2QIE B;  1PQS A;  1QOB A;  1YQ3 B;  4R3D A;  3APF A;  4W9J A;  4X57 B;  1DOX A;  1CJE A;  2OJR A;  1V49 A;  5G5H A;  5EE3 A;  3EUB 2;  1TBE A;  5JXV A;  1UBI A;  3PSE B;  1HTO A;  3DHI C;  3LXF A;  2MWS B;  3AE9 B;  2DHZ A;  3P1M A;  3AB5 A;  3UIP B;  2OJW A;  4MGI E;  4C4V B;  1VRA B;  4OVZ A;  2KLC A;  1L4D B;  1XCQ L;  1E6E B;  3T3O A;  2MX2 A;  3MFG A;  3ALB A;  4XWT A;  3AE3 B;  1AAR A;  2H89 B;  2J7Q B;  3IBE A;  2LJI A;  3Q69 A;  4N59 A;  3R3M A;  3IHP C;  5AZF A;  4IKG A;  2ZCC A;  1QKZ A;  2QEJ C;  2ZVO A;  2JWU A;  1LO5 D;  2N4F A;  2N9L A;  2ZZP B;  2MA9 B;  4A6Q A;  2K0P A;  1R4M B;  2VRR B;  3AED B;  1I7H A;  1TS4 A;  2PE6 B;  1VCB A;  4OVV A;  3ZO5 B;  2BPS A;  2LVQ A;  3OWE B;  3KWV A;  1T0S C;  3VVW B;  4ZRI A;  5DPW A;  1WX8 A;  2ZNV B;  2CR5 A;  2L32 A;  4BOS C;  1P9D U;  2IO0 B;  4A3O A;  1V97 A;  4DHZ E;  1GC7 A;  5DCN A;  3BIN A;  1WXA A;  3APD A;  2G4S A;  3NZU A;  2JSV X;  5JHB A;  3FAH A;  4E71 A;  1D4B A;  1SB3 C;  1ZXH A;  2KFK A;  4C7Y A;  1WXQ A;  3M95 A;  3VTW A;  4TV3 A;  3C19 A;  4HJK A;  4E3C A;  2EEL A;  4XYC A;  5E6N A;  1TZ1 A;  3OG5 A;  2WWZ A;  5DPS A;  3QQ8 B;  3ZYY X;  2D5G A;  1WGR A;  4RFB A; 
#chains in the Genus database with same CATH homology
 1UGM A;  5LXH A;  2ZJD A;  2GBN A;  2KX0 A;  1WXS A;  2J0K A;  4LJP B;  1WRD B;  4MGY E;  4W9H A;  1R4M I;  1YD8 U;  4BBN F;  4I6L B;  2MLB A;  3N30 A;  2G4D B;  3NZS A;  2G3Q B;  3NHE B;  3Q3F A;  3IFW B;  4PS3 A;  5EDS A;  3M63 B;  3WAL A;  3QHT A;  2C9W B;  4WJP A;  3V61 A;  2KQS A;  3GOE A;  2KWV B;  3QX1 A;  2K6Q A;  2LD9 A;  3VQI A;  4GIV A;  3JW0 X;  4KSL C;  3V6C B;  2IYD B;  4IC7 B;  3ZKJ C;  3L08 A;  3RZF A;  3UGB B;  1WGG A;  1E8W A;  3PLU A;  4W9C A;  2BGF A;  3VH3 B;  1Z2M A;  3DOW A;  1WJ6 A;  4HLE A;  1WR6 E;  4TUU A;  1UZX B;  3H7P B;  3PGE A;  4RMA A;  3ZRC A;  4FBJ B;  2KAN A;  3QA8 A;  1XQQ A;  4KZC A;  2W9N A;  2LGX A;  1P98 A;  1H8C A;  2KOX A;  3A1Q B;  4KDL B;  4ASW C;  3JSV B;  4GSW A;  2KWC A;  2KDB A;  2N7E A;  2L3Z A;  4MEM A;  2RPQ A;  3UF8 A;  4ZRJ A;  4KIK A;  3VUX A;  4F8C B;  2YLM A;  4KZ0 A;  1V9J A;  4FHJ A;  3OLM D;  4J6I A;  4G11 A;  2ASQ A;  3VHT C;  3ZNG C;  4M8N A;  3PS6 A;  1XD3 B;  1FXT B;  4MGZ E;  4PYU A;  3TMP B;  4A20 A;  4CYE A;  3W1S C;  1ZKH A;  1WE6 A;  4ICV A;  2NVU I;  4MJS B;  3NS8 A;  1YJ1 A;  4WJO A;  2ZCB A;  2LXC A;  3A33 B;  2EMS A;  3RUL A;  1GJZ A;  2C5L C;  1KM7 A;  5E6P A;  3C0R B;  1P1A A;  1E5W A;  2MBQ A;  2CS4 A;  4ZDV A;  3KW5 B;  2FCQ A;  2JRI B;  4LJO B;  3KVF B;  2Z0E B;  1LM8 B;  4MSM B;  2K8H A;  4FJV B;  3DVN V;  3M62 B;  2REX A;  5DPR A;  3K9O B;  3DCG A;  3H1U A;  1CMX B;  1WE7 A;  3MJW A;  3ZTC A;  2CHZ A;  2MW5 A;  1WXM A;  2MRP A;  1RRB A;  1V6E A;  2BKR B;  2ZPY A;  2I1K A;  1IPG A;  5IAA C;  4ANV A;  3PZD A;  1S3S G;  3MHS D;  2JWZ A;  2KLG A;  2WX1 A;  2KTR A;  2BWE S;  1RFA A;  4G0N B;  1KJT A;  1UBQ A;  3ZW3 A;  4EKU A;  4JQW C;  4NNJ B;  2LJ5 A;  5G2N A;  3RCZ A;  2OOB B;  2KFK B;  2UYZ B;  4NQL B;  1V5O A;  4DHJ B;  4YL8 A;  3P2B A;  2ZVN A;  3DPD A;  5AEK B;  4KV2 A;  4M8M A;  1Q1O A;  5CX3 A;  4B95 A;  4F1S A;  2DAF A;  1YX5 B;  3HM6 X;  4BKS A;  1EO6 A;  2K39 A;  2LWP A;  2FNJ B;  5IA7 A;  3NOB A;  2NBU A;  2M8S A;  2BYF A;  3W1S A;  3PRM B;  2D3G A;  3KYD D;  1UEL A;  2NPT B;  3PPA A;  1E8X A;  3QWZ B;  4DK5 A;  1RAX A;  2M0X A;  2L05 A;  1GG3 A;  3PRP B;  3SHQ A;  4BOZ B;  3TIX A;  2N9P C;  3ZLZ A;  1V80 A;  1P3Q U;  5AZG A;  5JHA A;  1WY8 A;  3DQV A;  2N9X A;  1WMH B;  1OQY A;  2GBM A;  4DHJ D;  2I1J A;  1WF9 A;  2GOW A;  3ZDM C;  4MSQ B;  3ZTD A;  2D2Q A;  1NI2 A;  4DDI D;  3EHV A;  5CHW A;  1V81 A;  1ZGU B;  3X23 A;  4LDT B;  2JUO A;  1WX9 A;  4W9K A;  3TBL D;  3ZUN A;  1YQB A;  4W9L A;  2KDI A;  4FA6 A;  2J0M A;  2O2V A;  2FAZ A;  2FUH B;  3APC A;  4EUT A;  4AWJ A;  1E8Z A;  3ML9 A;  3Q3J A;  3JVZ X;  2YVC A;  1I42 A;  1NBF C;  3H6N A;  1TTN A;  3QK0 A;  3AUL A;  2O6V A;  2KZR A;  3EEC A;  1WI0 A;  2DZI A;  2XK5 A;  1GC6 A;  2JF5 A;  2LRW A;  4IM2 A;  3D32 A;  3KUD B;  1WX7 A;  1C3T A;  2GBJ A;  2ZPN A;  3EFU A;  3H7S A;  3UQB A;  1WFY A;  2FID A;  2PPH A;  1SE9 A;  4RM9 A;  2KDF B;  2AEH A;  2C7H A;  2LUE A;  4LDT D;  4JL9 A;  2LVO A;  3I3T B;  1WZ3 A;  4KIK B;  3V60 A;  4NY0 A;  4PS8 A;  4K7U A;  4N9F 4;  4HK2 A;  1SIF A;  2BWF A;  2MP2 A;  1WJU A;  3CF6 E;  3PTF C;  3QJZ A;  4GDL A;  4NAW A;  4BVU C;  4BBN C;  1Q0W B;  1Q5W B;  2K1F A;  4W9E A;  2LI5 A;  4IWQ A;  3TL5 A;  1L2N A;  1QZE A;  3QC8 B;  5D94 A;  2IY1 B;  4NQK E;  5E6O A;  5C23 A;  2K25 A;  2K6D B;  3U8Z A;  3VAW A;  3UIO B;  1Y8R C;  2L8J A;  3NY5 A;  4P7I A;  3CSF A;  5BO4 B;  2DYB A;  1X1M A;  3VDZ A;  3B1L X;  2KMA A;  2V3S A;  4A3P A;  1WZ0 A;  2JXX A;  1HE8 A;  2KTF A;  2RD0 A;  3V6E B;  1RLF A;  2JVC A;  4AOF A;  1ZW7 A;  3T8M A;  2AL6 A;  5CTR C;  3WA0 A;  1NDD A;  4WWO A;  1J0G A;  2N9E B;  1F9J A;  2IO2 B;  2EMT A;  2L0F A;  2LVP A;  2KDE B;  2KO3 A;  5LLI A;  1S1Q B;  2ZEQ A;  4W9G A;  1H4R A;  4EZL A;  4ICU A;  4MH0 E;  4G3X B;  1ISN A;  1KOT A;  2K8C A;  3KUC B;  2KJ6 A;  2K8B A;  1IYF A;  4IM3 A;  2KTR B;  2LAS A;  4I6N B;  4F7Z A;  4KDI C;  4B6W A;  2WX0 A;  3R66 C;  3M3J A;  3ZDT A;  1OTR B;  2D10 A;  1EUV B;  3DBR I;  3A9K A;  4GN1 A;  4WQO B;  3OJ4 B;  5G55 A;  2DEN B;  3N3K B;  2KVR A;  2ZNV C;  3DBH I;  1WM3 A;  5FR6 A;  2WYQ A;  4CO7 A;  4K81 A;  2BYE A;  4ZYN A;  3MTN B;  3T9L A;  4NJ6 A;  3QAR A;  3WAM A;  1WJ4 A;  2JPH A;  4M0W B;  5D6J B;  4ANU A;  2MBH A;  2IO3 B;  3U7D A;  4HCP B;  4JLC A;  4EEW A;  3ZVV A;  3ZIM A;  4WWP A;  4IWO A;  4ANW A;  2NR2 A;  2C7N B;  3S2A A;  2M1M A;  1UH6 A;  2FCN A;  2MQJ A;  1IP9 A;  3DVG Y;  1WYW B;  4LCD E;  3WAO A;  3AI5 A;  3X0W A;  3DBS A;  3A9J A;  2CHX A;  2XEW A;  3V62 A;  3ZNH B;  1V5T A;  1D3Z A;  1LQB A;  2Z59 B;  4NJ7 A;  4MGK E;  3VFK A;  3BY4 B;  4AUQ C;  2A4Z A;  2KWU B;  1MG8 A;  3GZN I;  1I35 A;  2G45 B;  2KJR A;  4MM3 A;  4RM8 A;  3OAW A;  3PHW B;  2A5U A;  3HIZ A;  4GGQ A;  3WAP A;  3CST A;  4WAA A;  3DVN U;  3RT3 B;  2M4N A;  2PE9 A;  4IUM B;  3OJ3 A;  4FHK A;  4IWP A;  3ZNI D;  4EZJ A;  2WDT B;  2AYO B;  5L83 A;  2O2V B;  2AWT A;  4BKG A;  1V2Y A;  3JYU A;  4EFO A;  2NBW B;  3O65 B;  1Z5S B;  1GUA B;  4II2 B;  3IVF A;  3LJ3 A;  4GDK A;  4GOC A;  4PYZ A;  1WM2 A;  2PJH A;  2LXA A;  5DPT A;  2NCN A;  2O6V B;  3PT2 B;  1YIW A;  1YX6 B;  3ENE A;  2KK8 A;  2KKC A;  4EZK A;  2KHW B;  5GMV A;  4FAD A;  4XC2 A;  2KNB A;  2GBR A;  3L54 A;  3VXW A;  1KLV A;  3B0A A;  4HDO A;  1SGH A;  3W1Y A;  2R2Q A;  3AU5 A;  2LZ6 A;  1V86 A;  2NS5 A;  4HVB A;  2CU1 A;  2XBB C;  1WH3 A;  3DBL I;  2HE7 A;  4XZ4 A;  2GBK A;  3R7R A;  4AP4 C;  2RSU A;  2BYV E;  2KD0 A;  4HPL B;  4KSK C;  5J2R A;  3IG3 A;  3TCA A;  4HXD A;  2LGY A;  4BFR A;  1E7U A;  2MP2 B;  1EF1 A;  5D2M B;  2KC1 A;  3RUI B;  4OVU A;  5J18 A;  2R2O A;  2MBO A;  2O6V D;  2UWQ A;  2NPT A;  3RYT A;  5JH5 C;  2RGF A;  4E74 A;  5KHQ A;  4FUL A;  4DDG D;  2N7D A;  4B9K A;  3AU4 A;  4BKT A;  4NPN A;  3WAN A;  3PV1 A;  3QIJ A;  1P0R A;  3HK0 A;  4II3 B;  3N32 A;  3RD2 A;  4TKN A;  1E8Y A;  1PQS A;  2EKE C;  1J19 A;  1TGZ B;  2JZ3 B;  2BKF A;  3ZRF A;  3R7Q A;  2DZK A;  4GMV A;  3APF A;  4W9J A;  5CHV C;  4X57 B;  4WJQ A;  4URK A;  2DX5 B;  2B3A A;  4WJN A;  2IO1 B;  3WIM A;  2OJR A;  3ECI A;  1V49 A;  5C1Z A;  4JGH B;  1TBE A;  2Z0D B;  4FLH A;  1UBI A;  3PSE B;  1E90 A;  5D7G A;  3KH0 A;  2CHW A;  3VH4 B;  2MWS B;  2NBV B;  2IBI B;  1WR1 A;  4W9F A;  2DHZ A;  2IZV B;  3A9K B;  2KMC A;  2KJH B;  3UIP B;  4MGI E;  1OEY J;  2Y5B B;  2HD5 B;  4XX5 A;  4MDK E;  2JRH A;  2L0T A;  2BF8 B;  4W9I A;  4TQ0 A;  2KLC A;  3QAQ A;  4WWN A;  1WJN A;  4GB9 A;  3VUW A;  3EC8 A;  3PRZ A;  4TQ1 A;  5J17 A;  1M94 A;  1WXV A;  5JZE B;  3LDZ E;  3TJP A;  2MX2 A;  3ALB A;  2JT4 B;  2V4L A;  4G50 A;  5CHF A;  3RZW C;  1AAR A;  2JZZ A;  1OGW A;  2DYO A;  2GMI C;  2J7Q B;  1A5R A;  2DZJ A;  1UD7 A;  3AXC A;  3IBE A;  1E7V A;  3H7P A;  3A4S C;  3IHP C;  3A4R A;  3A9J B;  3R3M A;  4HDQ A;  5AZF A;  1C1Y B;  2ZCC A;  1XT9 B;  2ZVO A;  3A1Q A;  2D07 B;  4HWI B;  2N4F A;  2ZZP B;  3JSV A;  4GXB A;  1LXD A;  2L00 B;  3KUZ A;  2HJ8 A;  4FN2 A;  2MA9 B;  1LFD A;  4DXA B;  3UQA A;  4FJZ A;  2VRR B;  2KQ7 A;  5AZH A;  3L0W B;  4CHK A;  2MBE A;  1J8C A;  2DAJ A;  1OEY A;  2PE6 B;  4I6P A;  2RR9 A;  1VCB A;  4MJS A;  1WGH A;  4OVV A;  3ZO5 B;  2BPS A;  2MSE D;  3ZNZ B;  2KN5 A;  2LVQ A;  2J0J A;  2QHO A;  4GDK B;  5L95 C;  3L13 A;  2KXJ A;  3HM3 A;  2FIF A;  3VVW B;  2C60 A;  3VUY A;  4JIO U;  4ZRI A;  2MBB B;  5DPW A;  1WX8 A;  4PS7 A;  2PEA A;  4BKS D;  2FCS A;  2ZNV B;  2CR5 A;  4ANX A;  4BOS C;  1P9D U;  1T0Y A;  4ZRK A;  2L76 A;  2DZM A;  4FJY A;  4HPM B;  1WGY A;  2CKH B;  2IO0 B;  2AL3 A;  3L17 A;  3PVL A;  3U30 A;  3B08 A;  1GNU A;  2KX3 A;  4K1R B;  4W9D A;  2MCN B;  4A3O A;  3CMM B;  1G6J A;  1VD2 A;  4KVG B;  4DHZ E;  4EOY A;  3PRE A;  1GC7 A;  5DCN A;  2C7M B;  3BIN A;  1L7Y A;  3H9D A;  1WXA A;  2FCM A;  2XK5 B;  3K9P B;  3APD A;  2G4S A;  3NZU A;  3SU8 X;  4DBG A;  5JHB A;  5TR5 A;  3SDL C;  2HTH A;  3PLV A;  4E71 A;  2LGD A;  5KHO A;  2L7R A;  2KFK A;  3KYC D;  3DDC B;  4HCN B;  2V1Y A;  1BT0 A;  4IM0 A;  4DWF A;  2N1V A;  1JRU A;  3M95 A;  2M17 A;  3ML8 A;  3DVG X;  4IW0 A;  3VTW A;  1EF5 A;  4IG7 B;  3PHX B;  1K8R B;  4TV3 A;  3ONS A;  5HKH A;  2LRU A;  4AJW A;  4GDL B;  4NAW B;  2D11 A;  3HHM A;  4HJK A;  4MEL A;  2IY0 B;  4K7W A;  4E3C A;  3L16 A;  3QCA A;  3UIN B;  5E6N A;  1TZ1 A;  1U4A A;  2WWZ A;  3VTU A;  4DHZ B;  2N1W A;  5DPS A;  4AJY B;  4GU2 A;  1R4N I;  2KFJ A;  1WGD A;  3L10 B;  3SD5 A;  1WIA A;  2DYM A;  2JY6 A;  3QQ8 B;  1WGR A;  1WMH A;  4K7S A;  3VTV A;  2KC2 A;  5LXI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...