2MM0A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host-selective toxin protein
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Toxin
total genus 5
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm0A00
2MM0A 2MM2A
chains in the Genus database with same CATH superfamily
2YVLA 3HU2A 3BQBA 5CD1A 5EPPA 1I9GA 2MM0A 1QCSA 5D6XA 2PWYA 1CR5A 2GF7A 2YUJA 3ZJTA 5FTJA 4AQ7A 4AS1A 4KDLA 5FTMA 4RV0A 2LW6A 4FIBA 2PJHB 5D6WA 2Q19X 4ARIA 2Q18X 3QC8A 3HU3A 2MM2A 3ZJVA 5GLFA 2XDPA 3QQ7A 2Q1DX 3FPRA 5FTNA 5EQJB 4KDIA 2KY9A 5DYGA 4CQNA 1CZ4A 3MB5A 1ZC1A 2GFAA 1QDNA 2Q1CX 3FPTA 3QWZA 4KODA 4UC4A 3FPUA 2QQRA 3CF2A 5CCXA 3TIWA 5CCBA 2B25A 3LHDA 3LGAA 2Q1AX 5FTKA 3ZGZA 5C18A 5DYIA 3QQ8A 2JV2A 3ZJUA 1E32A 4KO8A 5D6YA 1R7RA 3HU1A 4KLNA 1CZ5A 1WLFA 4ARCA 5B6CA 1S3SA 2QQSA 5C1BA 1O54A 5ERGB 5FTLA
chains in the Genus database with same CATH topology
2YVLA 3HU2A 3BQBA 5CD1A 5EPPA 1I9GA 2MM0A 1QCSA 5D6XA 2PWYA 1CR5A 2GF7A 2YUJA 3ZJTA 5FTJA 4AQ7A 4AS1A 4KDLA 5FTMA 4RV0A 2LW6A 4FIBA 2PJHB 5D6WA 2Q19X 4ARIA 2Q18X 3QC8A 3HU3A 2MM2A 3ZJVA 5GLFA 2XDPA 3QQ7A 2Q1DX 3FPRA 5FTNA 5EQJB 4KDIA 2KY9A 5DYGA 4CQNA 1CZ4A 3MB5A 1ZC1A 2GFAA 1QDNA 2Q1CX 3FPTA 3QWZA 4KODA 4UC4A 3FPUA 2QQRA 3CF2A 5CCXA 3TIWA 5CCBA 2B25A 3LHDA 3LGAA 2Q1AX 5FTKA 3ZGZA 5C18A 5DYIA 3QQ8A 2JV2A 3ZJUA 1E32A 4KO8A 5D6YA 1R7RA 3HU1A 4KLNA 1CZ5A 1WLFA 4ARCA 5B6CA 1S3SA 2QQSA 5C1BA 1O54A 5ERGB 5FTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM0 A;  2MM2 A; 
#chains in the Genus database with same CATH topology
 2YVL A;  3HU2 A;  3BQB A;  5CD1 A;  5EPP A;  1I9G A;  2MM0 A;  1QCS A;  5D6X A;  2PWY A;  1CR5 A;  2GF7 A;  2YUJ A;  3ZJT A;  5FTJ A;  4AQ7 A;  4AS1 A;  4KDL A;  5FTM A;  4RV0 A;  2LW6 A;  4FIB A;  2PJH B;  5D6W A;  2Q19 X;  4ARI A;  2Q18 X;  3QC8 A;  3HU3 A;  2MM2 A;  3ZJV A;  5GLF A;  2XDP A;  3QQ7 A;  2Q1D X;  3FPR A;  5FTN A;  5EQJ B;  4KDI A;  2KY9 A;  5DYG A;  4CQN A;  1CZ4 A;  3MB5 A;  1ZC1 A;  2GFA A;  1QDN A;  2Q1C X;  3FPT A;  3QWZ A;  4KOD A;  4UC4 A;  3FPU A;  2QQR A;  3CF2 A;  5CCX A;  3TIW A;  5CCB A;  2B25 A;  3LHD A;  3LGA A;  2Q1A X;  5FTK A;  3ZGZ A;  5C18 A;  5DYI A;  3QQ8 A;  2JV2 A;  3ZJU A;  1E32 A;  4KO8 A;  5D6Y A;  1R7R A;  3HU1 A;  4KLN A;  1CZ5 A;  1WLF A;  4ARC A;  5B6C A;  1S3S A;  2QQS A;  5C1B A;  1O54 A;  5ERG B;  5FTL A; 
#chains in the Genus database with same CATH homology
 2YVL A;  3HU2 A;  3BQB A;  5CD1 A;  5EPP A;  1I9G A;  2MM0 A;  1QCS A;  5D6X A;  2PWY A;  1CR5 A;  2GF7 A;  2YUJ A;  3ZJT A;  5FTJ A;  4AQ7 A;  4AS1 A;  4KDL A;  5FTM A;  4RV0 A;  2LW6 A;  4FIB A;  2PJH B;  5D6W A;  2Q19 X;  4ARI A;  2Q18 X;  3QC8 A;  3HU3 A;  2MM2 A;  3ZJV A;  5GLF A;  2XDP A;  3QQ7 A;  2Q1D X;  3FPR A;  5FTN A;  5EQJ B;  4KDI A;  2KY9 A;  5DYG A;  4CQN A;  1CZ4 A;  3MB5 A;  1ZC1 A;  2GFA A;  1QDN A;  2Q1C X;  3FPT A;  3QWZ A;  4KOD A;  4UC4 A;  3FPU A;  2QQR A;  3CF2 A;  5CCX A;  3TIW A;  5CCB A;  2B25 A;  3LHD A;  3LGA A;  2Q1A X;  5FTK A;  3ZGZ A;  5C18 A;  5DYI A;  3QQ8 A;  2JV2 A;  3ZJU A;  1E32 A;  4KO8 A;  5D6Y A;  1R7R A;  3HU1 A;  4KLN A;  1CZ5 A;  1WLF A;  4ARC A;  5B6C A;  1S3S A;  2QQS A;  5C1B A;  1O54 A;  5ERG B;  5FTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...