2MM0A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Toxin
molecule keywords Host-selective toxin protein
total genus 5
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm0A00
2MM2A 2MM0A
chains in the Genus database with same CATH superfamily
3HU3A 2YUJA 3QWZA 2Q18X 5FTJA 2LW6A 2XDPA 3MB5A 3QQ7A 5D6YA 2YVLA 3FPRA 2KY9A 3HU2A 4AQ7A 3LHDA 5D6XA 2PJHB 1CZ4A 4KDLA 3ZGZA 5CCBA 4CQNA 5C18A 2MM2A 5C1BA 1CR5A 4ARCA 3QC8A 5ERGB 2GF7A 5FTNA 5FTLA 1QCSA 1S3SA 5B6CA 1ZC1A 3CF2A 2Q1CX 3FPTA 3BQBA 3QQ8A 1I9GA 1WLFA 4KO8A 5EQJB 5FTKA 2QQSA 2JV2A 5EPPA 5CD1A 3HU1A 5CCXA 3FPUA 5DYIA 3ZJVA 1CZ5A 2Q1AX 2QQRA 4KLNA 3ZJUA 5DYGA 4KDIA 4FIBA 4ARIA 1E32A 1O54A 1QDNA 4AS1A 2PWYA 5D6WA 4KODA 2GFAA 5GLFA 2Q19X 2MM0A 3LGAA 3TIWA 1R7RA 4UC4A 4RV0A 2Q1DX 2B25A 3ZJTA 5FTMA
chains in the Genus database with same CATH topology
3HU3A 2YUJA 3QWZA 2Q18X 5FTJA 2LW6A 2XDPA 3MB5A 3QQ7A 5D6YA 2YVLA 3FPRA 2KY9A 3HU2A 4AQ7A 3LHDA 5D6XA 2PJHB 1CZ4A 4KDLA 3ZGZA 5CCBA 4CQNA 5C18A 2MM2A 5C1BA 1CR5A 4ARCA 3QC8A 5ERGB 2GF7A 5FTNA 5FTLA 1QCSA 1S3SA 5B6CA 1ZC1A 3CF2A 2Q1CX 3FPTA 3BQBA 3QQ8A 1I9GA 1WLFA 4KO8A 5EQJB 5FTKA 2QQSA 2JV2A 5EPPA 5CD1A 3HU1A 5CCXA 3FPUA 5DYIA 3ZJVA 1CZ5A 2Q1AX 2QQRA 4KLNA 3ZJUA 5DYGA 4KDIA 4FIBA 4ARIA 1E32A 1O54A 1QDNA 4AS1A 2PWYA 5D6WA 4KODA 2GFAA 5GLFA 2Q19X 2MM0A 3LGAA 3TIWA 1R7RA 4UC4A 4RV0A 2Q1DX 2B25A 3ZJTA 5FTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM2 A;  2MM0 A; 
#chains in the Genus database with same CATH topology
 3HU3 A;  2YUJ A;  3QWZ A;  2Q18 X;  5FTJ A;  2LW6 A;  2XDP A;  3MB5 A;  3QQ7 A;  5D6Y A;  2YVL A;  3FPR A;  2KY9 A;  3HU2 A;  4AQ7 A;  3LHD A;  5D6X A;  2PJH B;  1CZ4 A;  4KDL A;  3ZGZ A;  5CCB A;  4CQN A;  5C18 A;  2MM2 A;  5C1B A;  1CR5 A;  4ARC A;  3QC8 A;  5ERG B;  2GF7 A;  5FTN A;  5FTL A;  1QCS A;  1S3S A;  5B6C A;  1ZC1 A;  3CF2 A;  2Q1C X;  3FPT A;  3BQB A;  3QQ8 A;  1I9G A;  1WLF A;  4KO8 A;  5EQJ B;  5FTK A;  2QQS A;  2JV2 A;  5EPP A;  5CD1 A;  3HU1 A;  5CCX A;  3FPU A;  5DYI A;  3ZJV A;  1CZ5 A;  2Q1A X;  2QQR A;  4KLN A;  3ZJU A;  5DYG A;  4KDI A;  4FIB A;  4ARI A;  1E32 A;  1O54 A;  1QDN A;  4AS1 A;  2PWY A;  5D6W A;  4KOD A;  2GFA A;  5GLF A;  2Q19 X;  2MM0 A;  3LGA A;  3TIW A;  1R7R A;  4UC4 A;  4RV0 A;  2Q1D X;  2B25 A;  3ZJT A;  5FTM A; 
#chains in the Genus database with same CATH homology
 3HU3 A;  2YUJ A;  3QWZ A;  2Q18 X;  5FTJ A;  2LW6 A;  2XDP A;  3MB5 A;  3QQ7 A;  5D6Y A;  2YVL A;  3FPR A;  2KY9 A;  3HU2 A;  4AQ7 A;  3LHD A;  5D6X A;  2PJH B;  1CZ4 A;  4KDL A;  3ZGZ A;  5CCB A;  4CQN A;  5C18 A;  2MM2 A;  5C1B A;  1CR5 A;  4ARC A;  3QC8 A;  5ERG B;  2GF7 A;  5FTN A;  5FTL A;  1QCS A;  1S3S A;  5B6C A;  1ZC1 A;  3CF2 A;  2Q1C X;  3FPT A;  3BQB A;  3QQ8 A;  1I9G A;  1WLF A;  4KO8 A;  5EQJ B;  5FTK A;  2QQS A;  2JV2 A;  5EPP A;  5CD1 A;  3HU1 A;  5CCX A;  3FPU A;  5DYI A;  3ZJV A;  1CZ5 A;  2Q1A X;  2QQR A;  4KLN A;  3ZJU A;  5DYG A;  4KDI A;  4FIB A;  4ARI A;  1E32 A;  1O54 A;  1QDN A;  4AS1 A;  2PWY A;  5D6W A;  4KOD A;  2GFA A;  5GLF A;  2Q19 X;  2MM0 A;  3LGA A;  3TIW A;  1R7R A;  4UC4 A;  4RV0 A;  2Q1D X;  2B25 A;  3ZJT A;  5FTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...