2MM0A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
64
Chain Sequence
b'NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Host-selective toxin protein
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Toxin
total genus 5
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm0A00
2MM2A 2MM0A
chains in the Genus database with same CATH superfamily
3HU2A 5FTKA 4KLNA 2Q19X 5DYIA 3TIWA 5ERGB 3ZJUA 3FPTA 3HU1A 1R7RA 2QQSA 5EQJB 2Q1CX 2QQRA 1WLFA 4KO8A 2Q18X 5GLFA 3ZGZA 4KDLA 4ARIA 5DYGA 3FPRA 4KODA 4CQNA 1CZ4A 3FPUA 1QCSA 2Q1AX 5B6CA 3LGAA 4KDIA 5D6XA 2XDPA 1CZ5A 2YVLA 5D6WA 2Q1DX 1QDNA 1O54A 3ZJVA 2KY9A 2GF7A 2LW6A 2PJHB 4FIBA 1E32A 3ZJTA 3BQBA 2PWYA 1ZC1A 3QC8A 1CR5A 5CD1A 4AQ7A 3QQ8A 5CCXA 2MM2A 3CF2A 3HU3A 5FTLA 3QWZA 3MB5A 3QQ7A 5CCBA 3LHDA 5C1BA 5FTNA 5FTMA 1I9GA 4AS1A 2MM0A 2GFAA 5C18A 2JV2A 1S3SA 4UC4A 2YUJA 5D6YA 4ARCA 2B25A 4RV0A 5FTJA 5EPPA
chains in the Genus database with same CATH topology
3HU2A 5FTKA 4KLNA 2Q19X 5DYIA 3TIWA 5ERGB 3ZJUA 3FPTA 3HU1A 1R7RA 2QQSA 5EQJB 2Q1CX 2QQRA 1WLFA 4KO8A 2Q18X 5GLFA 3ZGZA 4KDLA 4ARIA 5DYGA 3FPRA 4KODA 4CQNA 1CZ4A 3FPUA 1QCSA 2Q1AX 5B6CA 3LGAA 4KDIA 5D6XA 2XDPA 1CZ5A 2YVLA 5D6WA 2Q1DX 1QDNA 1O54A 3ZJVA 2KY9A 2GF7A 2LW6A 2PJHB 4FIBA 1E32A 3ZJTA 3BQBA 2PWYA 1ZC1A 3QC8A 1CR5A 5CD1A 4AQ7A 3QQ8A 5CCXA 2MM2A 3CF2A 3HU3A 5FTLA 3QWZA 3MB5A 3QQ7A 5CCBA 3LHDA 5C1BA 5FTNA 5FTMA 1I9GA 4AS1A 2MM0A 2GFAA 5C18A 2JV2A 1S3SA 4UC4A 2YUJA 5D6YA 4ARCA 2B25A 4RV0A 5FTJA 5EPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM2 A;  2MM0 A; 
#chains in the Genus database with same CATH topology
 3HU2 A;  5FTK A;  4KLN A;  2Q19 X;  5DYI A;  3TIW A;  5ERG B;  3ZJU A;  3FPT A;  3HU1 A;  1R7R A;  2QQS A;  5EQJ B;  2Q1C X;  2QQR A;  1WLF A;  4KO8 A;  2Q18 X;  5GLF A;  3ZGZ A;  4KDL A;  4ARI A;  5DYG A;  3FPR A;  4KOD A;  4CQN A;  1CZ4 A;  3FPU A;  1QCS A;  2Q1A X;  5B6C A;  3LGA A;  4KDI A;  5D6X A;  2XDP A;  1CZ5 A;  2YVL A;  5D6W A;  2Q1D X;  1QDN A;  1O54 A;  3ZJV A;  2KY9 A;  2GF7 A;  2LW6 A;  2PJH B;  4FIB A;  1E32 A;  3ZJT A;  3BQB A;  2PWY A;  1ZC1 A;  3QC8 A;  1CR5 A;  5CD1 A;  4AQ7 A;  3QQ8 A;  5CCX A;  2MM2 A;  3CF2 A;  3HU3 A;  5FTL A;  3QWZ A;  3MB5 A;  3QQ7 A;  5CCB A;  3LHD A;  5C1B A;  5FTN A;  5FTM A;  1I9G A;  4AS1 A;  2MM0 A;  2GFA A;  5C18 A;  2JV2 A;  1S3S A;  4UC4 A;  2YUJ A;  5D6Y A;  4ARC A;  2B25 A;  4RV0 A;  5FTJ A;  5EPP A; 
#chains in the Genus database with same CATH homology
 3HU2 A;  5FTK A;  4KLN A;  2Q19 X;  5DYI A;  3TIW A;  5ERG B;  3ZJU A;  3FPT A;  3HU1 A;  1R7R A;  2QQS A;  5EQJ B;  2Q1C X;  2QQR A;  1WLF A;  4KO8 A;  2Q18 X;  5GLF A;  3ZGZ A;  4KDL A;  4ARI A;  5DYG A;  3FPR A;  4KOD A;  4CQN A;  1CZ4 A;  3FPU A;  1QCS A;  2Q1A X;  5B6C A;  3LGA A;  4KDI A;  5D6X A;  2XDP A;  1CZ5 A;  2YVL A;  5D6W A;  2Q1D X;  1QDN A;  1O54 A;  3ZJV A;  2KY9 A;  2GF7 A;  2LW6 A;  2PJH B;  4FIB A;  1E32 A;  3ZJT A;  3BQB A;  2PWY A;  1ZC1 A;  3QC8 A;  1CR5 A;  5CD1 A;  4AQ7 A;  3QQ8 A;  5CCX A;  2MM2 A;  3CF2 A;  3HU3 A;  5FTL A;  3QWZ A;  3MB5 A;  3QQ7 A;  5CCB A;  3LHD A;  5C1B A;  5FTN A;  5FTM A;  1I9G A;  4AS1 A;  2MM0 A;  2GFA A;  5C18 A;  2JV2 A;  1S3S A;  4UC4 A;  2YUJ A;  5D6Y A;  4ARC A;  2B25 A;  4RV0 A;  5FTJ A;  5EPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...