2MM2A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
NCTANILNINEVVIATGCVPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFINGESLASGGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxb
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Plant protein
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm2A00
2MM0A 2MM2A
chains in the Genus database with same CATH superfamily
1QDNA 3QWZA 2LW6A 4RV0A 3ZJVA 2Q19X 4KODA 1O54A 4AS1A 3HU1A 5EPPA 3LGAA 2GF7A 2Q18X 5D6XA 1E32A 3QC8A 3HU3A 5FTKA 3HU2A 2YUJA 5FTJA 5D6YA 2Q1CX 4KO8A 5GLFA 5CCBA 2KY9A 4UC4A 3TIWA 3FPRA 5FTNA 2MM0A 5C1BA 2QQSA 3QQ7A 4FIBA 3QQ8A 1QCSA 4ARCA 2PWYA 4CQNA 2JV2A 1R7RA 2GFAA 1CZ4A 3ZJTA 1ZC1A 5ERGB 4ARIA 4KDLA 4KLNA 1S3SA 2QQRA 5D6WA 4KDIA 3CF2A 5EQJB 4AQ7A 1WLFA 2YVLA 1CZ5A 2Q1AX 3ZJUA 3LHDA 3FPTA 5CD1A 1CR5A 5FTMA 3FPUA 2Q1DX 3MB5A 5B6CA 2MM2A 2PJHB 1I9GA 3ZGZA 2B25A 2XDPA 5C18A 5FTLA 5CCXA 5DYIA 5DYGA 3BQBA
chains in the Genus database with same CATH topology
1QDNA 3QWZA 2LW6A 4RV0A 3ZJVA 2Q19X 4KODA 1O54A 4AS1A 3HU1A 5EPPA 3LGAA 2GF7A 2Q18X 5D6XA 1E32A 3QC8A 3HU3A 5FTKA 3HU2A 2YUJA 5FTJA 5D6YA 2Q1CX 4KO8A 5GLFA 5CCBA 2KY9A 4UC4A 3TIWA 3FPRA 5FTNA 2MM0A 5C1BA 2QQSA 3QQ7A 4FIBA 3QQ8A 1QCSA 4ARCA 2PWYA 4CQNA 2JV2A 1R7RA 2GFAA 1CZ4A 3ZJTA 1ZC1A 5ERGB 4ARIA 4KDLA 4KLNA 1S3SA 2QQRA 5D6WA 4KDIA 3CF2A 5EQJB 4AQ7A 1WLFA 2YVLA 1CZ5A 2Q1AX 3ZJUA 3LHDA 3FPTA 5CD1A 1CR5A 5FTMA 3FPUA 2Q1DX 3MB5A 5B6CA 2MM2A 2PJHB 1I9GA 3ZGZA 2B25A 2XDPA 5C18A 5FTLA 5CCXA 5DYIA 5DYGA 3BQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM0 A;  2MM2 A; 
#chains in the Genus database with same CATH topology
 1QDN A;  3QWZ A;  2LW6 A;  4RV0 A;  3ZJV A;  2Q19 X;  4KOD A;  1O54 A;  4AS1 A;  3HU1 A;  5EPP A;  3LGA A;  2GF7 A;  2Q18 X;  5D6X A;  1E32 A;  3QC8 A;  3HU3 A;  5FTK A;  3HU2 A;  2YUJ A;  5FTJ A;  5D6Y A;  2Q1C X;  4KO8 A;  5GLF A;  5CCB A;  2KY9 A;  4UC4 A;  3TIW A;  3FPR A;  5FTN A;  2MM0 A;  5C1B A;  2QQS A;  3QQ7 A;  4FIB A;  3QQ8 A;  1QCS A;  4ARC A;  2PWY A;  4CQN A;  2JV2 A;  1R7R A;  2GFA A;  1CZ4 A;  3ZJT A;  1ZC1 A;  5ERG B;  4ARI A;  4KDL A;  4KLN A;  1S3S A;  2QQR A;  5D6W A;  4KDI A;  3CF2 A;  5EQJ B;  4AQ7 A;  1WLF A;  2YVL A;  1CZ5 A;  2Q1A X;  3ZJU A;  3LHD A;  3FPT A;  5CD1 A;  1CR5 A;  5FTM A;  3FPU A;  2Q1D X;  3MB5 A;  5B6C A;  2MM2 A;  2PJH B;  1I9G A;  3ZGZ A;  2B25 A;  2XDP A;  5C18 A;  5FTL A;  5CCX A;  5DYI A;  5DYG A;  3BQB A; 
#chains in the Genus database with same CATH homology
 1QDN A;  3QWZ A;  2LW6 A;  4RV0 A;  3ZJV A;  2Q19 X;  4KOD A;  1O54 A;  4AS1 A;  3HU1 A;  5EPP A;  3LGA A;  2GF7 A;  2Q18 X;  5D6X A;  1E32 A;  3QC8 A;  3HU3 A;  5FTK A;  3HU2 A;  2YUJ A;  5FTJ A;  5D6Y A;  2Q1C X;  4KO8 A;  5GLF A;  5CCB A;  2KY9 A;  4UC4 A;  3TIW A;  3FPR A;  5FTN A;  2MM0 A;  5C1B A;  2QQS A;  3QQ7 A;  4FIB A;  3QQ8 A;  1QCS A;  4ARC A;  2PWY A;  4CQN A;  2JV2 A;  1R7R A;  2GFA A;  1CZ4 A;  3ZJT A;  1ZC1 A;  5ERG B;  4ARI A;  4KDL A;  4KLN A;  1S3S A;  2QQR A;  5D6W A;  4KDI A;  3CF2 A;  5EQJ B;  4AQ7 A;  1WLF A;  2YVL A;  1CZ5 A;  2Q1A X;  3ZJU A;  3LHD A;  3FPT A;  5CD1 A;  1CR5 A;  5FTM A;  3FPU A;  2Q1D X;  3MB5 A;  5B6C A;  2MM2 A;  2PJH B;  1I9G A;  3ZGZ A;  2B25 A;  2XDP A;  5C18 A;  5FTL A;  5CCX A;  5DYI A;  5DYG A;  3BQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...