2MM2A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
NCTANILNINEVVIATGCVPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFINGESLASGGRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Plant protein
molecule keywords Toxb
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm2A00
2MM2A 2MM0A
chains in the Genus database with same CATH superfamily
2MM2A 4UC4A 3LHDA 3BQBA 4AS1A 1QCSA 3QQ7A 2YVLA 4AQ7A 5CCXA 3TIWA 4ARIA 5D6YA 5FTMA 4FIBA 2LW6A 2YUJA 1QDNA 3MB5A 4KO8A 3ZGZA 5C18A 2KY9A 2Q1DX 4KDIA 3HU1A 5EPPA 1CZ4A 5FTJA 3QC8A 4KODA 1WLFA 5D6WA 3CF2A 2Q18X 4ARCA 1I9GA 5FTKA 5D6XA 5DYIA 1S3SA 3ZJUA 5ERGB 3ZJVA 2PJHB 3FPTA 2Q1AX 2B25A 2Q19X 4KDLA 2GF7A 5DYGA 2GFAA 3QWZA 5C1BA 2MM0A 3QQ8A 5EQJB 4CQNA 1CZ5A 1R7RA 3LGAA 2QQSA 5CD1A 1O54A 5B6CA 3ZJTA 2JV2A 1CR5A 2QQRA 3FPRA 1E32A 1ZC1A 5FTLA 4RV0A 5GLFA 5CCBA 2XDPA 3FPUA 2Q1CX 5FTNA 4KLNA 2PWYA 3HU2A 3HU3A
chains in the Genus database with same CATH topology
2MM2A 4UC4A 3LHDA 3BQBA 4AS1A 1QCSA 3QQ7A 2YVLA 4AQ7A 5CCXA 3TIWA 4ARIA 5D6YA 5FTMA 4FIBA 2LW6A 2YUJA 1QDNA 3MB5A 4KO8A 3ZGZA 5C18A 2KY9A 2Q1DX 4KDIA 3HU1A 5EPPA 1CZ4A 5FTJA 3QC8A 4KODA 1WLFA 5D6WA 3CF2A 2Q18X 4ARCA 1I9GA 5FTKA 5D6XA 5DYIA 1S3SA 3ZJUA 5ERGB 3ZJVA 2PJHB 3FPTA 2Q1AX 2B25A 2Q19X 4KDLA 2GF7A 5DYGA 2GFAA 3QWZA 5C1BA 2MM0A 3QQ8A 5EQJB 4CQNA 1CZ5A 1R7RA 3LGAA 2QQSA 5CD1A 1O54A 5B6CA 3ZJTA 2JV2A 1CR5A 2QQRA 3FPRA 1E32A 1ZC1A 5FTLA 4RV0A 5GLFA 5CCBA 2XDPA 3FPUA 2Q1CX 5FTNA 4KLNA 2PWYA 3HU2A 3HU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM2 A;  2MM0 A; 
#chains in the Genus database with same CATH topology
 2MM2 A;  4UC4 A;  3LHD A;  3BQB A;  4AS1 A;  1QCS A;  3QQ7 A;  2YVL A;  4AQ7 A;  5CCX A;  3TIW A;  4ARI A;  5D6Y A;  5FTM A;  4FIB A;  2LW6 A;  2YUJ A;  1QDN A;  3MB5 A;  4KO8 A;  3ZGZ A;  5C18 A;  2KY9 A;  2Q1D X;  4KDI A;  3HU1 A;  5EPP A;  1CZ4 A;  5FTJ A;  3QC8 A;  4KOD A;  1WLF A;  5D6W A;  3CF2 A;  2Q18 X;  4ARC A;  1I9G A;  5FTK A;  5D6X A;  5DYI A;  1S3S A;  3ZJU A;  5ERG B;  3ZJV A;  2PJH B;  3FPT A;  2Q1A X;  2B25 A;  2Q19 X;  4KDL A;  2GF7 A;  5DYG A;  2GFA A;  3QWZ A;  5C1B A;  2MM0 A;  3QQ8 A;  5EQJ B;  4CQN A;  1CZ5 A;  1R7R A;  3LGA A;  2QQS A;  5CD1 A;  1O54 A;  5B6C A;  3ZJT A;  2JV2 A;  1CR5 A;  2QQR A;  3FPR A;  1E32 A;  1ZC1 A;  5FTL A;  4RV0 A;  5GLF A;  5CCB A;  2XDP A;  3FPU A;  2Q1C X;  5FTN A;  4KLN A;  2PWY A;  3HU2 A;  3HU3 A; 
#chains in the Genus database with same CATH homology
 2MM2 A;  4UC4 A;  3LHD A;  3BQB A;  4AS1 A;  1QCS A;  3QQ7 A;  2YVL A;  4AQ7 A;  5CCX A;  3TIW A;  4ARI A;  5D6Y A;  5FTM A;  4FIB A;  2LW6 A;  2YUJ A;  1QDN A;  3MB5 A;  4KO8 A;  3ZGZ A;  5C18 A;  2KY9 A;  2Q1D X;  4KDI A;  3HU1 A;  5EPP A;  1CZ4 A;  5FTJ A;  3QC8 A;  4KOD A;  1WLF A;  5D6W A;  3CF2 A;  2Q18 X;  4ARC A;  1I9G A;  5FTK A;  5D6X A;  5DYI A;  1S3S A;  3ZJU A;  5ERG B;  3ZJV A;  2PJH B;  3FPT A;  2Q1A X;  2B25 A;  2Q19 X;  4KDL A;  2GF7 A;  5DYG A;  2GFA A;  3QWZ A;  5C1B A;  2MM0 A;  3QQ8 A;  5EQJ B;  4CQN A;  1CZ5 A;  1R7R A;  3LGA A;  2QQS A;  5CD1 A;  1O54 A;  5B6C A;  3ZJT A;  2JV2 A;  1CR5 A;  2QQR A;  3FPR A;  1E32 A;  1ZC1 A;  5FTL A;  4RV0 A;  5GLF A;  5CCB A;  2XDP A;  3FPU A;  2Q1C X;  5FTN A;  4KLN A;  2PWY A;  3HU2 A;  3HU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...