2MM2A

Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity.
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
b'NCTANILNINEVVIATGCVPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFINGESLASGGRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxb
publication title Solution NMR Structures of Pyrenophora tritici-repentis ToxB and Its Inactive Homolog Reveal Potential Determinants of Toxin Activity.
pubmed doi rcsb
source organism Pyrenophora tritici-repentis
molecule tags Plant protein
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2014-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18224 ToxB_N ToxB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.100 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 2mm2A00
2MM0A 2MM2A
chains in the Genus database with same CATH superfamily
5EQJB 5D6XA 3HU1A 3ZGZA 4RV0A 5EPPA 2MM0A 3TIWA 3FPUA 1CR5A 5C1BA 2B25A 4AQ7A 2QQSA 1S3SA 1ZC1A 2GFAA 3QWZA 3BQBA 5CD1A 5B6CA 3FPRA 3CF2A 4KLNA 5DYIA 4CQNA 2KY9A 1WLFA 4ARCA 5FTMA 3QC8A 3QQ8A 4AS1A 3ZJTA 3ZJUA 5ERGB 1CZ5A 5C18A 5D6WA 1QDNA 2LW6A 3FPTA 5CCXA 2PJHB 2GF7A 2Q19X 3QQ7A 4UC4A 2MM2A 4ARIA 2Q18X 4KODA 5FTJA 3HU2A 4KO8A 2Q1CX 2YVLA 5FTKA 5DYGA 1E32A 1QCSA 2Q1DX 5CCBA 2PWYA 3LGAA 1I9GA 4KDIA 3ZJVA 1CZ4A 1O54A 5D6YA 2JV2A 3LHDA 3HU3A 5FTNA 3MB5A 1R7RA 4KDLA 2YUJA 2Q1AX 5GLFA 2QQRA 2XDPA 4FIBA 5FTLA
chains in the Genus database with same CATH topology
5EQJB 5D6XA 3HU1A 3ZGZA 4RV0A 5EPPA 2MM0A 3TIWA 3FPUA 1CR5A 5C1BA 2B25A 4AQ7A 2QQSA 1S3SA 1ZC1A 2GFAA 3QWZA 3BQBA 5CD1A 5B6CA 3FPRA 3CF2A 4KLNA 5DYIA 4CQNA 2KY9A 1WLFA 4ARCA 5FTMA 3QC8A 3QQ8A 4AS1A 3ZJTA 3ZJUA 5ERGB 1CZ5A 5C18A 5D6WA 1QDNA 2LW6A 3FPTA 5CCXA 2PJHB 2GF7A 2Q19X 3QQ7A 4UC4A 2MM2A 4ARIA 2Q18X 4KODA 5FTJA 3HU2A 4KO8A 2Q1CX 2YVLA 5FTKA 5DYGA 1E32A 1QCSA 2Q1DX 5CCBA 2PWYA 3LGAA 1I9GA 4KDIA 3ZJVA 1CZ4A 1O54A 5D6YA 2JV2A 3LHDA 3HU3A 5FTNA 3MB5A 1R7RA 4KDLA 2YUJA 2Q1AX 5GLFA 2QQRA 2XDPA 4FIBA 5FTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM0 A;  2MM2 A; 
#chains in the Genus database with same CATH topology
 5EQJ B;  5D6X A;  3HU1 A;  3ZGZ A;  4RV0 A;  5EPP A;  2MM0 A;  3TIW A;  3FPU A;  1CR5 A;  5C1B A;  2B25 A;  4AQ7 A;  2QQS A;  1S3S A;  1ZC1 A;  2GFA A;  3QWZ A;  3BQB A;  5CD1 A;  5B6C A;  3FPR A;  3CF2 A;  4KLN A;  5DYI A;  4CQN A;  2KY9 A;  1WLF A;  4ARC A;  5FTM A;  3QC8 A;  3QQ8 A;  4AS1 A;  3ZJT A;  3ZJU A;  5ERG B;  1CZ5 A;  5C18 A;  5D6W A;  1QDN A;  2LW6 A;  3FPT A;  5CCX A;  2PJH B;  2GF7 A;  2Q19 X;  3QQ7 A;  4UC4 A;  2MM2 A;  4ARI A;  2Q18 X;  4KOD A;  5FTJ A;  3HU2 A;  4KO8 A;  2Q1C X;  2YVL A;  5FTK A;  5DYG A;  1E32 A;  1QCS A;  2Q1D X;  5CCB A;  2PWY A;  3LGA A;  1I9G A;  4KDI A;  3ZJV A;  1CZ4 A;  1O54 A;  5D6Y A;  2JV2 A;  3LHD A;  3HU3 A;  5FTN A;  3MB5 A;  1R7R A;  4KDL A;  2YUJ A;  2Q1A X;  5GLF A;  2QQR A;  2XDP A;  4FIB A;  5FTL A; 
#chains in the Genus database with same CATH homology
 5EQJ B;  5D6X A;  3HU1 A;  3ZGZ A;  4RV0 A;  5EPP A;  2MM0 A;  3TIW A;  3FPU A;  1CR5 A;  5C1B A;  2B25 A;  4AQ7 A;  2QQS A;  1S3S A;  1ZC1 A;  2GFA A;  3QWZ A;  3BQB A;  5CD1 A;  5B6C A;  3FPR A;  3CF2 A;  4KLN A;  5DYI A;  4CQN A;  2KY9 A;  1WLF A;  4ARC A;  5FTM A;  3QC8 A;  3QQ8 A;  4AS1 A;  3ZJT A;  3ZJU A;  5ERG B;  1CZ5 A;  5C18 A;  5D6W A;  1QDN A;  2LW6 A;  3FPT A;  5CCX A;  2PJH B;  2GF7 A;  2Q19 X;  3QQ7 A;  4UC4 A;  2MM2 A;  4ARI A;  2Q18 X;  4KOD A;  5FTJ A;  3HU2 A;  4KO8 A;  2Q1C X;  2YVL A;  5FTK A;  5DYG A;  1E32 A;  1QCS A;  2Q1D X;  5CCB A;  2PWY A;  3LGA A;  1I9G A;  4KDI A;  3ZJV A;  1CZ4 A;  1O54 A;  5D6Y A;  2JV2 A;  3LHD A;  3HU3 A;  5FTN A;  3MB5 A;  1R7R A;  4KDL A;  2YUJ A;  2Q1A X;  5GLF A;  2QQR A;  2XDP A;  4FIB A;  5FTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...