2MMBA

Nmr structure of the protein yp_001712342.1 from acinetobacter baumannii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
b'GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLMKKIADLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein YP_002937094.1 from Eubacterium rectale
rcsb
source organism Acinetobacter baumannii
molecule tags Structural genomics, unknown function
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16309 DUF4951 Domian of unknown function (DUF4951)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.230 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mmbA00
2MMBA
chains in the Genus database with same CATH superfamily
2E32A 4FJHA 4JS5A 2QXFA 3C95A 4KHNA 1P22A 3NDKA 3QETA 1FZ4E 1MTYG 2OVPB 2HD0A 4RNGA 4GAMC 3NGIA 3UO2A 3SI6A 1FYZE 4JRPA 1XVFE 3C6OB 3QEIA 2B8IA 4RG8A 4E4BA 3J2PA 2DY4A 1XVDE 4HCCA 4KI4A 1WAFA 3UIQA 1Q9YA 4FJLA 3SUQA 2JHCA 4E3SA 4FJ5A 1FZ8E 4M45A 4M3YA 1FZ3E 3RWUA 4FJIA 3CFPA 3WSOA 4FJ7A 4FJ8A 4DTJA 1XMGE 1LDKE 3SUNA 3TAGA 2OZMA 3RMBA 3QNNA 1XVBE 1NEXB 2P1PB 4I6JB 3SQ4A 2P5OA 4KHQA 4FJNA 4FVMA 1JW2A 1FZ1E 4J2EA 1CLQA 4AI6A 3SPYA 2MZWB 2YB5A 4ADOA 3SCXA 3L0MA 3LDBA 3TAEA 4AKGA 1FZ0E 4FK0A 3NE6A 2JQTA 3SQ2A 4FJGA 1FZ5E 1WAJA 4FJJA 2LF6A 2P1NB 3RMDA 3CFOA 3OGMB 3SNNA 4IT5A 2FYOA 4M3ZA 1XU5E 5IREA 1FXXA 4DU3A 3RMAA 3QEVA 2LF3A 4AKIA 4M42A 1FZ9E 1MMOG 4ICGC 4M3RA 3QERA 4M3UA 2P1OB 2VJ4A 2ATQA 4J2AA 2P1MB 3UO3A 3N1EA 4DTMA 2DTUA 5IZ7A 3CFRA 3S9HA 2MW2A 4KHSA 3HGKE 1XMHE 2JH8A 1N1CA 3L1NA 2RCUA 2JHPA 1XL3C 3QNOA 3HP9A 2MMBA 1Q9XA 3LD8A 4DU4A 3TL8B 4EYWA 2JHAA 3LZJA 4X5NA 3SUPA 4FJMA 3CQ8A 4JRQA 2OVQB 1FZ6E 4DTNA 4FJ9A 3C94A 3LZIA 4DTOA 3TAFA 2VJ5A 3E4YA 4B08A 1XVGE 3SJJA 3SQ0A 1FZHE 4I9QA 1FZ2E 2PFVA 2P5GA 1XU3E 3KD5E 2H4TA 3J27A 3TABA 2OZSA 3SUOA 4JS4A 5IBKB 4DTXA 4EPHA 2OYQA 3KD1E 4KI6A 2VIXA 3E4WA 3OGLB 4DTPA 3C6PB 4AKHA 3V7DB 2K5SA 4DTRA 3C6NB 3HGLA 3QEWA 2PFTA 1MHYG 3LDSA 4M3XA 1IH7A 3RMCA 4J2DA 3L2OB 1FPOA 3NCIA 4DTUA 4KHYA 4ADNA 4KHWA 1MHZG 3NAEA 2P1QB 4X5MA 1FZ7E 4I9LA 3TJYA 4HCBA 1FS1A 3K2OA 1FZIE 3MKSB 2OVRB 4EP9A 3L8BA 4FJKA 3SPZA 2B7MA 4M3WA 4FK2A 4J2BA 3SQ1A 5H37A 1XVEE 3OGKB 4RL5A 3NHGA 3N1BA 4M41A 2JPNA 3QEXA 2FW3A 4FK4A 4DU1A 2DEBA 2E31A 3QESA 4QNCA 3HL8A 1XMFE 3SVIA 2B1EA 3QEPA 4DTSA 4FJXA 3BVOA 4QNDA 1XVCE 1IG9A 4KHUA 4M3TA 2JH9A 2RKHA
chains in the Genus database with same CATH topology
2E32A 4FJHA 4JS5A 2QXFA 3C95A 4KHNA 1P22A 3NDKA 3QETA 1FZ4E 1MTYG 2OVPB 2HD0A 4RNGA 4GAMC 3NGIA 3SI6A 1FYZE 4JRPA 1XVFE 3C6OB 3QEIA 2B8IA 4RG8A 4E4BA 3J2PA 2DY4A 1XVDE 4HCCA 4KI4A 1WAFA 3UIQA 1Q9YA 4FJLA 3SUQA 2JHCA 4E3SA 4FJ5A 1FZ8E 4M45A 4M3YA 1FZ3E 3RWUA 4FJIA 3CFPA 3WSOA 4FJ7A 4FJ8A 4DTJA 1LDKE 3SUNA 3TAGA 2OZMA 3RMBA 3QNNA 1XVBE 1NEXB 2P1PB 4I6JB 3SQ4A 2P5OA 4KHQA 4FJNA 4FVMA 1FZ1E 4J2EA 1CLQA 4AI6A 3SPYA 2MZWB 2YB5A 4ADOA 3SCXA 3L0MA 3LDBA 3TAEA 4AKGA 1FZ0E 4FK0A 3NE6A 3SQ2A 4FJGA 1FZ5E 1WAJA 4FJJA 2LF6A 2P1NB 3RMDA 3CFOA 3OGMB 3SNNA 2FYOA 4M3ZA 1XU5E 5IREA 1FXXA 4DU3A 3RMAA 3QEVA 2LF3A 4AKIA 4M42A 1FZ9E 1MMOG 4M3RA 4M3UA 3QERA 2P1OB 2VJ4A 2ATQA 4J2AA 2P1MB 3N1EA 4DTMA 2DTUA 5IZ7A 3CFRA 3S9HA 4KHSA 3HGKE 1XMHE 2JH8A 3L1NA 2RCUA 2JHPA 1XL3C 3QNOA 3HP9A 2MMBA 1Q9XA 3LD8A 4DU4A 3TL8B 4EYWA 2JHAA 3LZJA 4X5NA 3SUPA 4FJMA 3CQ8A 4JRQA 2OVQB 1FZ6E 4DTNA 4FJ9A 3C94A 3LZIA 4DTOA 3TAFA 2VJ5A 3E4YA 4B08A 1XVGE 3SJJA 3SQ0A 1FZHE 4I9QA 1FZ2E 2PFVA 2P5GA 1XU3E 3KD5E 2H4TA 3J27A 3TABA 2OZSA 3SUOA 4JS4A 5IBKB 4DTXA 4EPHA 2OYQA 3KD1E 4KI6A 2VIXA 3E4WA 3OGLB 4DTPA 3C6PB 4AKHA 3V7DB 4DTRA 3C6NB 3HGLA 3QEWA 2PFTA 1MHYG 3LDSA 4M3XA 1IH7A 3RMCA 4J2DA 3L2OB 3NCIA 4DTUA 4KHYA 4ADNA 4KHWA 1MHZG 3NAEA 2P1QB 4X5MA 1FZ7E 4I9LA 3TJYA 4HCBA 1FS1A 3K2OA 1FZIE 3MKSB 2OVRB 4EP9A 3L8BA 4FJKA 3SPZA 2B7MA 4M3WA 4FK2A 4J2BA 3SQ1A 5H37A 1XVEE 3OGKB 4RL5A 3NHGA 3N1BA 4M41A 2JPNA 3QEXA 2FW3A 4FK4A 4DU1A 2DEBA 2E31A 3QESA 4QNCA 3HL8A 1XMFE 3SVIA 2B1EA 3QEPA 4DTSA 4FJXA 4QNDA 1IG9A 1XVCE 4KHUA 4M3TA 2JH9A 1XMGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MMB A; 
#chains in the Genus database with same CATH topology
 2E32 A;  4FJH A;  4JS5 A;  2QXF A;  3C95 A;  4KHN A;  1P22 A;  3NDK A;  3QET A;  1FZ4 E;  1MTY G;  2OVP B;  2HD0 A;  4RNG A;  4GAM C;  3NGI A;  3UO2 A;  3SI6 A;  1FYZ E;  4JRP A;  1XVF E;  3C6O B;  3QEI A;  2B8I A;  4RG8 A;  4E4B A;  3J2P A;  2DY4 A;  1XVD E;  4HCC A;  4KI4 A;  1WAF A;  3UIQ A;  1Q9Y A;  4FJL A;  3SUQ A;  2JHC A;  4E3S A;  4FJ5 A;  1FZ8 E;  4M45 A;  4M3Y A;  1FZ3 E;  3RWU A;  4FJI A;  3CFP A;  3WSO A;  4FJ7 A;  4FJ8 A;  4DTJ A;  1XMG E;  1LDK E;  3SUN A;  3TAG A;  2OZM A;  3RMB A;  3QNN A;  1XVB E;  1NEX B;  2P1P B;  4I6J B;  3SQ4 A;  2P5O A;  4KHQ A;  4FJN A;  4FVM A;  1JW2 A;  1FZ1 E;  4J2E A;  1CLQ A;  4AI6 A;  3SPY A;  2MZW B;  2YB5 A;  4ADO A;  3SCX A;  3L0M A;  3LDB A;  3TAE A;  4AKG A;  1FZ0 E;  4FK0 A;  3NE6 A;  2JQT A;  3SQ2 A;  4FJG A;  1FZ5 E;  1WAJ A;  4FJJ A;  2LF6 A;  2P1N B;  3RMD A;  3CFO A;  3OGM B;  3SNN A;  4IT5 A;  2FYO A;  4M3Z A;  1XU5 E;  5IRE A;  1FXX A;  4DU3 A;  3RMA A;  3QEV A;  2LF3 A;  4AKI A;  4M42 A;  1FZ9 E;  1MMO G;  4ICG C;  4M3R A;  3QER A;  4M3U A;  2P1O B;  2VJ4 A;  2ATQ A;  4J2A A;  2P1M B;  3UO3 A;  3N1E A;  4DTM A;  2DTU A;  5IZ7 A;  3CFR A;  3S9H A;  2MW2 A;  4KHS A;  3HGK E;  1XMH E;  2JH8 A;  1N1C A;  3L1N A;  2RCU A;  2JHP A;  1XL3 C;  3QNO A;  3HP9 A;  2MMB A;  1Q9X A;  3LD8 A;  4DU4 A;  3TL8 B;  4EYW A;  2JHA A;  3LZJ A;  4X5N A;  3SUP A;  4FJM A;  3CQ8 A;  4JRQ A;  2OVQ B;  1FZ6 E;  4DTN A;  4FJ9 A;  3C94 A;  3LZI A;  4DTO A;  3TAF A;  2VJ5 A;  3E4Y A;  4B08 A;  1XVG E;  3SJJ A;  3SQ0 A;  1FZH E;  4I9Q A;  1FZ2 E;  2PFV A;  2P5G A;  1XU3 E;  3KD5 E;  2H4T A;  3J27 A;  3TAB A;  2OZS A;  3SUO A;  4JS4 A;  5IBK B;  4DTX A;  4EPH A;  2OYQ A;  3KD1 E;  4KI6 A;  2VIX A;  3E4W A;  3OGL B;  4DTP A;  3C6P B;  4AKH A;  3V7D B;  2K5S A;  4DTR A;  3C6N B;  3HGL A;  3QEW A;  2PFT A;  1MHY G;  3LDS A;  4M3X A;  1IH7 A;  3RMC A;  4J2D A;  3L2O B;  1FPO A;  3NCI A;  4DTU A;  4KHY A;  4ADN A;  4KHW A;  1MHZ G;  3NAE A;  2P1Q B;  4X5M A;  1FZ7 E;  4I9L A;  3TJY A;  4HCB A;  1FS1 A;  3K2O A;  1FZI E;  3MKS B;  2OVR B;  4EP9 A;  3L8B A;  4FJK A;  3SPZ A;  2B7M A;  4M3W A;  4FK2 A;  4J2B A;  3SQ1 A;  5H37 A;  1XVE E;  3OGK B;  4RL5 A;  3NHG A;  3N1B A;  4M41 A;  2JPN A;  3QEX A;  2FW3 A;  4FK4 A;  4DU1 A;  2DEB A;  2E31 A;  3QES A;  4QNC A;  3HL8 A;  1XMF E;  3SVI A;  2B1E A;  3QEP A;  4DTS A;  4FJX A;  3BVO A;  4QND A;  1XVC E;  1IG9 A;  4KHU A;  4M3T A;  2JH9 A;  2RKH A; 
#chains in the Genus database with same CATH homology
 2E32 A;  4FJH A;  4JS5 A;  2QXF A;  3C95 A;  4KHN A;  1P22 A;  3NDK A;  3QET A;  1FZ4 E;  1MTY G;  2OVP B;  2HD0 A;  4RNG A;  4GAM C;  3NGI A;  3SI6 A;  1FYZ E;  4JRP A;  1XVF E;  3C6O B;  3QEI A;  2B8I A;  4RG8 A;  4E4B A;  3J2P A;  2DY4 A;  1XVD E;  4HCC A;  4KI4 A;  1WAF A;  3UIQ A;  1Q9Y A;  4FJL A;  3SUQ A;  2JHC A;  4E3S A;  4FJ5 A;  1FZ8 E;  4M45 A;  4M3Y A;  1FZ3 E;  3RWU A;  4FJI A;  3CFP A;  3WSO A;  4FJ7 A;  4FJ8 A;  4DTJ A;  1LDK E;  3SUN A;  3TAG A;  2OZM A;  3RMB A;  3QNN A;  1XVB E;  1NEX B;  2P1P B;  4I6J B;  3SQ4 A;  2P5O A;  4KHQ A;  4FJN A;  4FVM A;  1FZ1 E;  4J2E A;  1CLQ A;  4AI6 A;  3SPY A;  2MZW B;  2YB5 A;  4ADO A;  3SCX A;  3L0M A;  3LDB A;  3TAE A;  4AKG A;  1FZ0 E;  4FK0 A;  3NE6 A;  3SQ2 A;  4FJG A;  1FZ5 E;  1WAJ A;  4FJJ A;  2LF6 A;  2P1N B;  3RMD A;  3CFO A;  3OGM B;  3SNN A;  2FYO A;  4M3Z A;  1XU5 E;  5IRE A;  1FXX A;  4DU3 A;  3RMA A;  3QEV A;  2LF3 A;  4AKI A;  4M42 A;  1FZ9 E;  1MMO G;  4M3R A;  4M3U A;  3QER A;  2P1O B;  2VJ4 A;  2ATQ A;  4J2A A;  2P1M B;  3N1E A;  4DTM A;  2DTU A;  5IZ7 A;  3CFR A;  3S9H A;  4KHS A;  3HGK E;  1XMH E;  2JH8 A;  3L1N A;  2RCU A;  2JHP A;  1XL3 C;  3QNO A;  3HP9 A;  2MMB A;  1Q9X A;  3LD8 A;  4DU4 A;  3TL8 B;  4EYW A;  2JHA A;  3LZJ A;  4X5N A;  3SUP A;  4FJM A;  3CQ8 A;  4JRQ A;  2OVQ B;  1FZ6 E;  4DTN A;  4FJ9 A;  3C94 A;  3LZI A;  4DTO A;  3TAF A;  2VJ5 A;  3E4Y A;  4B08 A;  1XVG E;  3SJJ A;  3SQ0 A;  1FZH E;  4I9Q A;  1FZ2 E;  2PFV A;  2P5G A;  1XU3 E;  3KD5 E;  2H4T A;  3J27 A;  3TAB A;  2OZS A;  3SUO A;  4JS4 A;  5IBK B;  4DTX A;  4EPH A;  2OYQ A;  3KD1 E;  4KI6 A;  2VIX A;  3E4W A;  3OGL B;  4DTP A;  3C6P B;  4AKH A;  3V7D B;  4DTR A;  3C6N B;  3HGL A;  3QEW A;  2PFT A;  1MHY G;  3LDS A;  4M3X A;  1IH7 A;  3RMC A;  4J2D A;  3L2O B;  3NCI A;  4DTU A;  4KHY A;  4ADN A;  4KHW A;  1MHZ G;  3NAE A;  2P1Q B;  4X5M A;  1FZ7 E;  4I9L A;  3TJY A;  4HCB A;  1FS1 A;  3K2O A;  1FZI E;  3MKS B;  2OVR B;  4EP9 A;  3L8B A;  4FJK A;  3SPZ A;  2B7M A;  4M3W A;  4FK2 A;  4J2B A;  3SQ1 A;  5H37 A;  1XVE E;  3OGK B;  4RL5 A;  3NHG A;  3N1B A;  4M41 A;  2JPN A;  3QEX A;  2FW3 A;  4FK4 A;  4DU1 A;  2DEB A;  2E31 A;  3QES A;  4QNC A;  3HL8 A;  1XMF E;  3SVI A;  2B1E A;  3QEP A;  4DTS A;  4FJX A;  4QND A;  1IG9 A;  1XVC E;  4KHU A;  4M3T A;  2JH9 A;  1XMG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...