2MMBA

Nmr structure of the protein yp_001712342.1 from acinetobacter baumannii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLMKKIADLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein YP_002937094.1 from Eubacterium rectale
rcsb
source organism Acinetobacter baumannii
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16309 DUF4951 Domian of unknown function (DUF4951)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.230 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mmbA00
2MMBA
chains in the Genus database with same CATH superfamily
4JS4A 4QNCA 3TL8B 4FJKA 1IG9A 4KHUA 1FZ3E 2RKHA 4JRPA 4J2BA 3SPYA 3SQ0A 3SQ1A 4DTPA 2P5OA 1FZIE 4ADNA 3TABA 4ADOA 2OVPB 1XU3E 3QEPA 3SJJA 2B7MA 3SI6A 1FPOA 3L0MA 1FZ5E 3QESA 3N1EA 2MMBA 2VJ5A 4JRQA 3QEXA 2JH8A 4DTJA 3SUQA 3SPZA 4FJHA 1FS1A 4FJNA 1XMGE 4FK0A 4FJLA 4FJ8A 4IT5A 4FJJA 4M3XA 4X5MA 4DTSA 3RMCA 4M3WA 3E4WA 3J2PA 2LF3A 3HL8A 3SQ2A 3HGKE 1XMFE 4DTOA 1NEXB 3QNOA 3QETA 4FJ7A 1LDKE 2QXFA 1N1CA 4KHNA 2B8IA 3HGLA 3L2OB 2JHAA 3NCIA 4M45A 4FK2A 4KHQA 3LDSA 1XMHE 3LZJA 4KI6A 2E31A 4B08A 3QEWA 4FK4A 3OGMB 4QNDA 1FZ7E 2OZSA 4AI6A 4RL5A 1WAFA 4E4BA 3UIQA 4KHSA 2JPNA 3QEIA 2P1MB 4KHWA 3SCXA 1XVCE 4DTXA 2DEBA 3BVOA 3TAFA 3TAEA 2DY4A 1XL3C 1XVEE 3UO3A 5IBKB 4JS5A 4DU1A 4J2DA 3CFOA 4FJ9A 4RNGA 4DU4A 2P1NB 1MMOG 5IREA 2YB5A 4DTMA 3RMBA 1XU5E 4AKHA 4EP9A 3QNNA 3CQ8A 3S9HA 4KI4A 1FZ0E 3N1BA 1XVBE 1CLQA 2FW3A 4E3SA 3K2OA 4EYWA 3SUNA 1FYZE 3C94A 3J27A 3CFRA 3SUPA 2OZMA 3KD1E 2JQTA 4FJ5A 2JH9A 4RG8A 2PFTA 2P1OB 3C6NB 1Q9YA 2OYQA 3OGKB 5H37A 2ATQA 2VJ4A 4HCBA 2MZWB 3NDKA 3CFPA 3NHGA 1FZ8E 4DTRA 5IZ7A 4FJIA 1FZ2E 4M3ZA 1JW2A 2H4TA 3C95A 2PFVA 1MTYG 3C6PB 4I9LA 2OVRB 3RMAA 4FJGA 4I6JB 3SNNA 3QERA 2P1PB 3L1NA 4M41A 2JHCA 3NGIA 4DTUA 4FJMA 4M3RA 3RWUA 1WAJA 2K5SA 3MKSB 3WSOA 4FVMA 4M3TA 1FZ6E 2P5GA 3C6OB 4J2EA 2DTUA 1XVFE 2JHPA 3OGLB 2HD0A 1FZ9E 4FJXA 3NE6A 3E4YA 2RCUA 4AKIA 3LZIA 2LF6A 1XVGE 2E32A 4I9QA 3SVIA 1FXXA 3L8BA 3UO2A 1MHYG 3HP9A 3SUOA 3TJYA 3LD8A 4J2AA 1Q9XA 3RMDA 1FZ1E 2P1QB 3SQ4A 4M3UA 4EPHA 1IH7A 3NAEA 4GAMC 4AKGA 2MW2A 4DTNA 4ICGC 1XVDE 4X5NA 3LDBA 4KHYA 1MHZG 2VIXA 2FYOA 4HCCA 4M42A 2B1EA 3QEVA 3TAGA 1P22A 4DU3A 3V7DB 1FZHE 3KD5E 2OVQB 4M3YA 1FZ4E
chains in the Genus database with same CATH topology
4JS4A 4QNCA 3TL8B 4FJKA 1IG9A 4KHUA 1FZ3E 4JRPA 4J2BA 3SPYA 3SQ0A 3SQ1A 4DTPA 2P5OA 1FZIE 4ADNA 3TABA 4ADOA 2OVPB 1XU3E 3QEPA 3SJJA 2B7MA 3SI6A 3L0MA 1FZ5E 3QESA 3N1EA 2MMBA 2VJ5A 4JRQA 3QEXA 2JH8A 4DTJA 3SUQA 3SPZA 4FJHA 1FS1A 4FJNA 1XMGE 4FK0A 4FJLA 4FJ8A 4FJJA 4M3XA 4X5MA 4DTSA 3RMCA 4M3WA 3E4WA 3J2PA 2LF3A 3HL8A 3SQ2A 3HGKE 1XMFE 4DTOA 1NEXB 3QNOA 3QETA 4FJ7A 1LDKE 2QXFA 4KHNA 2B8IA 3HGLA 3L2OB 2JHAA 3NCIA 4M45A 4FK2A 4KHQA 3LDSA 1XMHE 3LZJA 4KI6A 2E31A 4B08A 3QEWA 4FK4A 3OGMB 4QNDA 1FZ7E 2OZSA 4AI6A 4RL5A 1WAFA 4E4BA 3UIQA 4KHSA 2JPNA 3QEIA 2P1MB 4KHWA 3SCXA 1XVCE 4DTXA 2DEBA 3TAFA 3TAEA 2DY4A 1XL3C 1XVEE 5IBKB 4DU1A 4JS5A 4J2DA 3CFOA 4FJ9A 4RNGA 4DU4A 2P1NB 1MMOG 5IREA 2YB5A 4DTMA 3RMBA 1XU5E 4AKHA 4EP9A 3QNNA 3CQ8A 3S9HA 4KI4A 1FZ0E 3N1BA 1XVBE 1CLQA 2FW3A 4E3SA 3K2OA 4EYWA 3SUNA 1FYZE 3C94A 3J27A 3CFRA 3SUPA 2OZMA 3KD1E 4FJ5A 2JH9A 4RG8A 2PFTA 2P1OB 3C6NB 1Q9YA 2OYQA 3OGKB 5H37A 2ATQA 2VJ4A 4HCBA 2MZWB 3NDKA 3CFPA 3NHGA 1FZ8E 4DTRA 5IZ7A 4FJIA 1FZ2E 4M3ZA 2H4TA 3C95A 1MTYG 2PFVA 3C6PB 4I9LA 2OVRB 3RMAA 4FJGA 4I6JB 3SNNA 3QERA 2P1PB 3L1NA 4M41A 2JHCA 3NGIA 4DTUA 4FJMA 4M3RA 3RWUA 1WAJA 3MKSB 3WSOA 4FVMA 4M3TA 1FZ6E 2P5GA 3C6OB 4J2EA 2DTUA 1XVFE 2JHPA 3OGLB 2HD0A 1FZ9E 4FJXA 3NE6A 3E4YA 2RCUA 4AKIA 3LZIA 2LF6A 1XVGE 2E32A 4I9QA 3SVIA 1FXXA 3L8BA 1MHYG 3HP9A 3SUOA 3TJYA 3LD8A 4J2AA 1Q9XA 3RMDA 1FZ1E 2P1QB 3SQ4A 4M3UA 4EPHA 1IH7A 3NAEA 4GAMC 4AKGA 4DTNA 1XVDE 4X5NA 3LDBA 4KHYA 1MHZG 2VIXA 2FYOA 4HCCA 4M42A 2B1EA 3QEVA 3TAGA 1P22A 4DU3A 3V7DB 1FZHE 3KD5E 2OVQB 4M3YA 1FZ4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MMB A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  4QNC A;  3TL8 B;  4FJK A;  1IG9 A;  4KHU A;  1FZ3 E;  2RKH A;  4JRP A;  4J2B A;  3SPY A;  3SQ0 A;  3SQ1 A;  4DTP A;  2P5O A;  1FZI E;  4ADN A;  3TAB A;  4ADO A;  2OVP B;  1XU3 E;  3QEP A;  3SJJ A;  2B7M A;  3SI6 A;  1FPO A;  3L0M A;  1FZ5 E;  3QES A;  3N1E A;  2MMB A;  2VJ5 A;  4JRQ A;  3QEX A;  2JH8 A;  4DTJ A;  3SUQ A;  3SPZ A;  4FJH A;  1FS1 A;  4FJN A;  1XMG E;  4FK0 A;  4FJL A;  4FJ8 A;  4IT5 A;  4FJJ A;  4M3X A;  4X5M A;  4DTS A;  3RMC A;  4M3W A;  3E4W A;  3J2P A;  2LF3 A;  3HL8 A;  3SQ2 A;  3HGK E;  1XMF E;  4DTO A;  1NEX B;  3QNO A;  3QET A;  4FJ7 A;  1LDK E;  2QXF A;  1N1C A;  4KHN A;  2B8I A;  3HGL A;  3L2O B;  2JHA A;  3NCI A;  4M45 A;  4FK2 A;  4KHQ A;  3LDS A;  1XMH E;  3LZJ A;  4KI6 A;  2E31 A;  4B08 A;  3QEW A;  4FK4 A;  3OGM B;  4QND A;  1FZ7 E;  2OZS A;  4AI6 A;  4RL5 A;  1WAF A;  4E4B A;  3UIQ A;  4KHS A;  2JPN A;  3QEI A;  2P1M B;  4KHW A;  3SCX A;  1XVC E;  4DTX A;  2DEB A;  3BVO A;  3TAF A;  3TAE A;  2DY4 A;  1XL3 C;  1XVE E;  3UO3 A;  5IBK B;  4JS5 A;  4DU1 A;  4J2D A;  3CFO A;  4FJ9 A;  4RNG A;  4DU4 A;  2P1N B;  1MMO G;  5IRE A;  2YB5 A;  4DTM A;  3RMB A;  1XU5 E;  4AKH A;  4EP9 A;  3QNN A;  3CQ8 A;  3S9H A;  4KI4 A;  1FZ0 E;  3N1B A;  1XVB E;  1CLQ A;  2FW3 A;  4E3S A;  3K2O A;  4EYW A;  3SUN A;  1FYZ E;  3C94 A;  3J27 A;  3CFR A;  3SUP A;  2OZM A;  3KD1 E;  2JQT A;  4FJ5 A;  2JH9 A;  4RG8 A;  2PFT A;  2P1O B;  3C6N B;  1Q9Y A;  2OYQ A;  3OGK B;  5H37 A;  2ATQ A;  2VJ4 A;  4HCB A;  2MZW B;  3NDK A;  3CFP A;  3NHG A;  1FZ8 E;  4DTR A;  5IZ7 A;  4FJI A;  1FZ2 E;  4M3Z A;  1JW2 A;  2H4T A;  3C95 A;  2PFV A;  1MTY G;  3C6P B;  4I9L A;  2OVR B;  3RMA A;  4FJG A;  4I6J B;  3SNN A;  3QER A;  2P1P B;  3L1N A;  4M41 A;  2JHC A;  3NGI A;  4DTU A;  4FJM A;  4M3R A;  3RWU A;  1WAJ A;  2K5S A;  3MKS B;  3WSO A;  4FVM A;  4M3T A;  1FZ6 E;  2P5G A;  3C6O B;  4J2E A;  2DTU A;  1XVF E;  2JHP A;  3OGL B;  2HD0 A;  1FZ9 E;  4FJX A;  3NE6 A;  3E4Y A;  2RCU A;  4AKI A;  3LZI A;  2LF6 A;  1XVG E;  2E32 A;  4I9Q A;  3SVI A;  1FXX A;  3L8B A;  3UO2 A;  1MHY G;  3HP9 A;  3SUO A;  3TJY A;  3LD8 A;  4J2A A;  1Q9X A;  3RMD A;  1FZ1 E;  2P1Q B;  3SQ4 A;  4M3U A;  4EPH A;  1IH7 A;  3NAE A;  4GAM C;  4AKG A;  2MW2 A;  4DTN A;  4ICG C;  1XVD E;  4X5N A;  3LDB A;  4KHY A;  1MHZ G;  2VIX A;  2FYO A;  4HCC A;  4M42 A;  2B1E A;  3QEV A;  3TAG A;  1P22 A;  4DU3 A;  3V7D B;  1FZH E;  3KD5 E;  2OVQ B;  4M3Y A;  1FZ4 E; 
#chains in the Genus database with same CATH homology
 4JS4 A;  4QNC A;  3TL8 B;  4FJK A;  1IG9 A;  4KHU A;  1FZ3 E;  4JRP A;  4J2B A;  3SPY A;  3SQ0 A;  3SQ1 A;  4DTP A;  2P5O A;  1FZI E;  4ADN A;  3TAB A;  4ADO A;  2OVP B;  1XU3 E;  3QEP A;  3SJJ A;  2B7M A;  3SI6 A;  3L0M A;  1FZ5 E;  3QES A;  3N1E A;  2MMB A;  2VJ5 A;  4JRQ A;  3QEX A;  2JH8 A;  4DTJ A;  3SUQ A;  3SPZ A;  4FJH A;  1FS1 A;  4FJN A;  1XMG E;  4FK0 A;  4FJL A;  4FJ8 A;  4FJJ A;  4M3X A;  4X5M A;  4DTS A;  3RMC A;  4M3W A;  3E4W A;  3J2P A;  2LF3 A;  3HL8 A;  3SQ2 A;  3HGK E;  1XMF E;  4DTO A;  1NEX B;  3QNO A;  3QET A;  4FJ7 A;  1LDK E;  2QXF A;  4KHN A;  2B8I A;  3HGL A;  3L2O B;  2JHA A;  3NCI A;  4M45 A;  4FK2 A;  4KHQ A;  3LDS A;  1XMH E;  3LZJ A;  4KI6 A;  2E31 A;  4B08 A;  3QEW A;  4FK4 A;  3OGM B;  4QND A;  1FZ7 E;  2OZS A;  4AI6 A;  4RL5 A;  1WAF A;  4E4B A;  3UIQ A;  4KHS A;  2JPN A;  3QEI A;  2P1M B;  4KHW A;  3SCX A;  1XVC E;  4DTX A;  2DEB A;  3TAF A;  3TAE A;  2DY4 A;  1XL3 C;  1XVE E;  5IBK B;  4DU1 A;  4JS5 A;  4J2D A;  3CFO A;  4FJ9 A;  4RNG A;  4DU4 A;  2P1N B;  1MMO G;  5IRE A;  2YB5 A;  4DTM A;  3RMB A;  1XU5 E;  4AKH A;  4EP9 A;  3QNN A;  3CQ8 A;  3S9H A;  4KI4 A;  1FZ0 E;  3N1B A;  1XVB E;  1CLQ A;  2FW3 A;  4E3S A;  3K2O A;  4EYW A;  3SUN A;  1FYZ E;  3C94 A;  3J27 A;  3CFR A;  3SUP A;  2OZM A;  3KD1 E;  4FJ5 A;  2JH9 A;  4RG8 A;  2PFT A;  2P1O B;  3C6N B;  1Q9Y A;  2OYQ A;  3OGK B;  5H37 A;  2ATQ A;  2VJ4 A;  4HCB A;  2MZW B;  3NDK A;  3CFP A;  3NHG A;  1FZ8 E;  4DTR A;  5IZ7 A;  4FJI A;  1FZ2 E;  4M3Z A;  2H4T A;  3C95 A;  1MTY G;  2PFV A;  3C6P B;  4I9L A;  2OVR B;  3RMA A;  4FJG A;  4I6J B;  3SNN A;  3QER A;  2P1P B;  3L1N A;  4M41 A;  2JHC A;  3NGI A;  4DTU A;  4FJM A;  4M3R A;  3RWU A;  1WAJ A;  3MKS B;  3WSO A;  4FVM A;  4M3T A;  1FZ6 E;  2P5G A;  3C6O B;  4J2E A;  2DTU A;  1XVF E;  2JHP A;  3OGL B;  2HD0 A;  1FZ9 E;  4FJX A;  3NE6 A;  3E4Y A;  2RCU A;  4AKI A;  3LZI A;  2LF6 A;  1XVG E;  2E32 A;  4I9Q A;  3SVI A;  1FXX A;  3L8B A;  1MHY G;  3HP9 A;  3SUO A;  3TJY A;  3LD8 A;  4J2A A;  1Q9X A;  3RMD A;  1FZ1 E;  2P1Q B;  3SQ4 A;  4M3U A;  4EPH A;  1IH7 A;  3NAE A;  4GAM C;  4AKG A;  4DTN A;  1XVD E;  4X5N A;  3LDB A;  4KHY A;  1MHZ G;  2VIX A;  2FYO A;  4HCC A;  4M42 A;  2B1E A;  3QEV A;  3TAG A;  1P22 A;  4DU3 A;  3V7D B;  1FZH E;  3KD5 E;  2OVQ B;  4M3Y A;  1FZ4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...