2MMBA

Nmr structure of the protein yp_001712342.1 from acinetobacter baumannii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
107
structure length
107
Chain Sequence
GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLMKKIADLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein YP_002937094.1 from Eubacterium rectale
rcsb
source organism Acinetobacter baumannii
molecule tags Structural genomics, unknown function
total genus 22
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16309 DUF4951 Domian of unknown function (DUF4951)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.230 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2mmbA00
2MMBA
chains in the Genus database with same CATH superfamily
4HCBA 5IBKB 4KHSA 1FZ9E 1IG9A 2MW2A 2P1PB 2MMBA 3E4YA 4KHWA 2RKHA 3NGIA 3LZJA 2H4TA 4KHYA 3QETA 4DTMA 3C94A 1FZ2E 3L8BA 4E4BA 3SPYA 3KD1E 1XVFE 2MZWB 4AI6A 1FZ3E 3S9HA 3QESA 3SPZA 4FJ7A 4KHUA 4I9LA 1FPOA 4GAMC 3K2OA 1MMOG 4X5NA 4DU1A 4DU4A 3QEIA 4B08A 4FJMA 4M3YA 4FJLA 4E3SA 3SVIA 4M3XA 4FVMA 5H37A 4FJ5A 1XMFE 3L0MA 4FJGA 4FJXA 3CFRA 4QNCA 1XVDE 3J27A 4FJKA 1XU3E 3E4WA 3HGLA 2JHCA 3OGLB 4DTUA 4J2BA 1XL3C 2DY4A 2FW3A 3TABA 2OVPB 2B7MA 1JW2A 1CLQA 3L1NA 4M45A 1P22A 3CQ8A 3KD5E 1XVEE 3OGMB 2OZMA 3SCXA 1MTYG 2FYOA 3TL8B 4FJIA 2OVRB 3QNNA 3TAGA 2P5OA 2JQTA 3CFOA 4DTSA 2OZSA 3LDSA 1FXXA 3J2PA 4J2EA 4M3WA 4AKGA 1XVCE 4QNDA 3LZIA 3TAFA 3SUPA 3LD8A 4KHNA 3UO2A 2ATQA 2JHPA 2JPNA 3RMAA 3LDBA 1IH7A 4ICGC 4DU3A 3OGKB 4AKIA 3SJJA 2P1OB 2LF6A 1FZIE 2P1NB 3C6NB 2RCUA 4FJHA 1Q9YA 3L2OB 3NCIA 3MKSB 3V7DB 4KHQA 2JH9A 4FK0A 2DTUA 1FZ0E 2YB5A 1FYZE 4M3TA 3CFPA 4M3UA 1WAFA 2B1EA 1XVBE 4J2AA 2P5GA 4FJ8A 5IZ7A 2JHAA 2VJ5A 4ADOA 3SQ1A 4FJNA 3RMDA 4KI6A 4KI4A 1FZ1E 3C95A 3HGKE 4JRQA 3QNOA 2VIXA 3N1EA 4DTXA 3C6OB 3SQ0A 2HD0A 4FJJA 2PFTA 1LDKE 2VJ4A 1MHYG 3TAEA 3QERA 3BVOA 4RG8A 2PFVA 3TJYA 4HCCA 3SUOA 4ADNA 3UIQA 4RL5A 1FZ8E 1FZ7E 1Q9XA 3QEPA 1XVGE 4M3ZA 3N1BA 3NE6A 1FZHE 1FZ4E 3HP9A 1XMHE 2JH8A 2K5SA 4JRPA 3C6PB 3NDKA 3SQ2A 3RWUA 3SUQA 1MHZG 1WAJA 3UO3A 4EYWA 4DTJA 4DTOA 4DTNA 3RMCA 2OVQB 4M3RA 4EP9A 3SNNA 3QEVA 1NEXB 4EPHA 4FJ9A 2DEBA 1XU5E 4JS4A 3RMBA 3SUNA 2E32A 4AKHA 3WSOA 4I9QA 1FZ6E 2E31A 2LF3A 1FZ5E 1N1CA 2B8IA 1XMGE 2QXFA 4M42A 4X5MA 4RNGA 4M41A 4JS5A 4FK4A 3NAEA 3SQ4A 2P1QB 3NHGA 2OYQA 4J2DA 5IREA 3QEXA 2P1MB 3HL8A 4DTRA 3SI6A 4FK2A 3QEWA 4DTPA 1FS1A 4IT5A 4I6JB
chains in the Genus database with same CATH topology
4HCBA 5IBKB 4KHSA 1FZ9E 1IG9A 2P1PB 2MMBA 3E4YA 4KHWA 3NGIA 3LZJA 2H4TA 4KHYA 3QETA 4DTMA 3C94A 1FZ2E 3L8BA 4E4BA 3SPYA 3KD1E 1XVFE 2MZWB 4AI6A 1FZ3E 3S9HA 3QESA 3SPZA 4FJ7A 4KHUA 4I9LA 4GAMC 3K2OA 1MMOG 4X5NA 4DU1A 4DU4A 3QEIA 4B08A 4FJMA 4M3YA 4FJLA 4E3SA 3SVIA 4M3XA 4FVMA 5H37A 4FJ5A 1XMFE 3L0MA 4FJGA 4FJXA 3CFRA 4QNCA 1XVDE 3J27A 4FJKA 1XU3E 3E4WA 3HGLA 2JHCA 3OGLB 4DTUA 4J2BA 1XL3C 2DY4A 2FW3A 3TABA 2OVPB 2B7MA 1CLQA 3L1NA 4M45A 1P22A 3CQ8A 3KD5E 1XVEE 3OGMB 2OZMA 3SCXA 1MTYG 2FYOA 3TL8B 4FJIA 2OVRB 3QNNA 3TAGA 2P5OA 3CFOA 4DTSA 2OZSA 4J2EA 3LDSA 1FXXA 3J2PA 4M3WA 4AKGA 1XVCE 4QNDA 3LZIA 3TAFA 3SUPA 3LD8A 4KHNA 2ATQA 2JHPA 2JPNA 3RMAA 3LDBA 1IH7A 4DU3A 3OGKB 4AKIA 3SJJA 2P1OB 2LF6A 1FZIE 2P1NB 3C6NB 2RCUA 4FJHA 1Q9YA 3L2OB 3NCIA 3MKSB 3V7DB 4KHQA 2JH9A 4FK0A 2DTUA 1FZ0E 2YB5A 1FYZE 4M3TA 3CFPA 4M3UA 1WAFA 2B1EA 1XVBE 4J2AA 2P5GA 4FJ8A 5IZ7A 2JHAA 2VJ5A 4ADOA 3SQ1A 4FJNA 3RMDA 4KI6A 4KI4A 1FZ1E 3C95A 3HGKE 4JRQA 3QNOA 2VIXA 3N1EA 4DTXA 3C6OB 3SQ0A 2HD0A 4FJJA 2PFTA 1LDKE 2VJ4A 1MHYG 3TAEA 3QERA 4RG8A 2PFVA 3TJYA 4HCCA 3SUOA 4ADNA 3UIQA 4RL5A 1FZ8E 1FZ7E 1Q9XA 3QEPA 1XVGE 4M3ZA 3N1BA 3NE6A 1FZHE 1FZ4E 3HP9A 1XMHE 2JH8A 4JRPA 3C6PB 3NDKA 3SQ2A 3RWUA 3SUQA 1MHZG 1WAJA 4DTJA 4EYWA 4DTOA 4DTNA 3RMCA 2OVQB 4M3RA 4EP9A 3SNNA 3QEVA 1NEXB 4EPHA 4FJ9A 2DEBA 1XU5E 4JS4A 3RMBA 3SUNA 2E32A 4AKHA 3WSOA 4I9QA 1FZ6E 2E31A 2LF3A 1FZ5E 2B8IA 1XMGE 2QXFA 4M42A 4X5MA 4RNGA 4M41A 4JS5A 4FK4A 3NAEA 3SQ4A 2P1QB 3NHGA 2OYQA 4J2DA 5IREA 3QEXA 2P1MB 3HL8A 4DTRA 3SI6A 4FK2A 3QEWA 4DTPA 1FS1A 4I6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MMB A; 
#chains in the Genus database with same CATH topology
 4HCB A;  5IBK B;  4KHS A;  1FZ9 E;  1IG9 A;  2MW2 A;  2P1P B;  2MMB A;  3E4Y A;  4KHW A;  2RKH A;  3NGI A;  3LZJ A;  2H4T A;  4KHY A;  3QET A;  4DTM A;  3C94 A;  1FZ2 E;  3L8B A;  4E4B A;  3SPY A;  3KD1 E;  1XVF E;  2MZW B;  4AI6 A;  1FZ3 E;  3S9H A;  3QES A;  3SPZ A;  4FJ7 A;  4KHU A;  4I9L A;  1FPO A;  4GAM C;  3K2O A;  1MMO G;  4X5N A;  4DU1 A;  4DU4 A;  3QEI A;  4B08 A;  4FJM A;  4M3Y A;  4FJL A;  4E3S A;  3SVI A;  4M3X A;  4FVM A;  5H37 A;  4FJ5 A;  1XMF E;  3L0M A;  4FJG A;  4FJX A;  3CFR A;  4QNC A;  1XVD E;  3J27 A;  4FJK A;  1XU3 E;  3E4W A;  3HGL A;  2JHC A;  3OGL B;  4DTU A;  4J2B A;  1XL3 C;  2DY4 A;  2FW3 A;  3TAB A;  2OVP B;  2B7M A;  1JW2 A;  1CLQ A;  3L1N A;  4M45 A;  1P22 A;  3CQ8 A;  3KD5 E;  1XVE E;  3OGM B;  2OZM A;  3SCX A;  1MTY G;  2FYO A;  3TL8 B;  4FJI A;  2OVR B;  3QNN A;  3TAG A;  2P5O A;  2JQT A;  3CFO A;  4DTS A;  2OZS A;  3LDS A;  1FXX A;  3J2P A;  4J2E A;  4M3W A;  4AKG A;  1XVC E;  4QND A;  3LZI A;  3TAF A;  3SUP A;  3LD8 A;  4KHN A;  3UO2 A;  2ATQ A;  2JHP A;  2JPN A;  3RMA A;  3LDB A;  1IH7 A;  4ICG C;  4DU3 A;  3OGK B;  4AKI A;  3SJJ A;  2P1O B;  2LF6 A;  1FZI E;  2P1N B;  3C6N B;  2RCU A;  4FJH A;  1Q9Y A;  3L2O B;  3NCI A;  3MKS B;  3V7D B;  4KHQ A;  2JH9 A;  4FK0 A;  2DTU A;  1FZ0 E;  2YB5 A;  1FYZ E;  4M3T A;  3CFP A;  4M3U A;  1WAF A;  2B1E A;  1XVB E;  4J2A A;  2P5G A;  4FJ8 A;  5IZ7 A;  2JHA A;  2VJ5 A;  4ADO A;  3SQ1 A;  4FJN A;  3RMD A;  4KI6 A;  4KI4 A;  1FZ1 E;  3C95 A;  3HGK E;  4JRQ A;  3QNO A;  2VIX A;  3N1E A;  4DTX A;  3C6O B;  3SQ0 A;  2HD0 A;  4FJJ A;  2PFT A;  1LDK E;  2VJ4 A;  1MHY G;  3TAE A;  3QER A;  3BVO A;  4RG8 A;  2PFV A;  3TJY A;  4HCC A;  3SUO A;  4ADN A;  3UIQ A;  4RL5 A;  1FZ8 E;  1FZ7 E;  1Q9X A;  3QEP A;  1XVG E;  4M3Z A;  3N1B A;  3NE6 A;  1FZH E;  1FZ4 E;  3HP9 A;  1XMH E;  2JH8 A;  2K5S A;  4JRP A;  3C6P B;  3NDK A;  3SQ2 A;  3RWU A;  3SUQ A;  1MHZ G;  1WAJ A;  3UO3 A;  4EYW A;  4DTJ A;  4DTO A;  4DTN A;  3RMC A;  2OVQ B;  4M3R A;  4EP9 A;  3SNN A;  3QEV A;  1NEX B;  4EPH A;  4FJ9 A;  2DEB A;  1XU5 E;  4JS4 A;  3RMB A;  3SUN A;  2E32 A;  4AKH A;  3WSO A;  4I9Q A;  1FZ6 E;  2E31 A;  2LF3 A;  1FZ5 E;  1N1C A;  2B8I A;  1XMG E;  2QXF A;  4M42 A;  4X5M A;  4RNG A;  4M41 A;  4JS5 A;  4FK4 A;  3NAE A;  3SQ4 A;  2P1Q B;  3NHG A;  2OYQ A;  4J2D A;  5IRE A;  3QEX A;  2P1M B;  3HL8 A;  4DTR A;  3SI6 A;  4FK2 A;  3QEW A;  4DTP A;  1FS1 A;  4IT5 A;  4I6J B; 
#chains in the Genus database with same CATH homology
 4HCB A;  5IBK B;  4KHS A;  1FZ9 E;  1IG9 A;  2P1P B;  2MMB A;  3E4Y A;  4KHW A;  3NGI A;  3LZJ A;  2H4T A;  4KHY A;  3QET A;  4DTM A;  3C94 A;  1FZ2 E;  3L8B A;  4E4B A;  3SPY A;  3KD1 E;  1XVF E;  2MZW B;  4AI6 A;  1FZ3 E;  3S9H A;  3QES A;  3SPZ A;  4FJ7 A;  4KHU A;  4I9L A;  4GAM C;  3K2O A;  1MMO G;  4X5N A;  4DU1 A;  4DU4 A;  3QEI A;  4B08 A;  4FJM A;  4M3Y A;  4FJL A;  4E3S A;  3SVI A;  4M3X A;  4FVM A;  5H37 A;  4FJ5 A;  1XMF E;  3L0M A;  4FJG A;  4FJX A;  3CFR A;  4QNC A;  1XVD E;  3J27 A;  4FJK A;  1XU3 E;  3E4W A;  3HGL A;  2JHC A;  3OGL B;  4DTU A;  4J2B A;  1XL3 C;  2DY4 A;  2FW3 A;  3TAB A;  2OVP B;  2B7M A;  1CLQ A;  3L1N A;  4M45 A;  1P22 A;  3CQ8 A;  3KD5 E;  1XVE E;  3OGM B;  2OZM A;  3SCX A;  1MTY G;  2FYO A;  3TL8 B;  4FJI A;  2OVR B;  3QNN A;  3TAG A;  2P5O A;  3CFO A;  4DTS A;  2OZS A;  4J2E A;  3LDS A;  1FXX A;  3J2P A;  4M3W A;  4AKG A;  1XVC E;  4QND A;  3LZI A;  3TAF A;  3SUP A;  3LD8 A;  4KHN A;  2ATQ A;  2JHP A;  2JPN A;  3RMA A;  3LDB A;  1IH7 A;  4DU3 A;  3OGK B;  4AKI A;  3SJJ A;  2P1O B;  2LF6 A;  1FZI E;  2P1N B;  3C6N B;  2RCU A;  4FJH A;  1Q9Y A;  3L2O B;  3NCI A;  3MKS B;  3V7D B;  4KHQ A;  2JH9 A;  4FK0 A;  2DTU A;  1FZ0 E;  2YB5 A;  1FYZ E;  4M3T A;  3CFP A;  4M3U A;  1WAF A;  2B1E A;  1XVB E;  4J2A A;  2P5G A;  4FJ8 A;  5IZ7 A;  2JHA A;  2VJ5 A;  4ADO A;  3SQ1 A;  4FJN A;  3RMD A;  4KI6 A;  4KI4 A;  1FZ1 E;  3C95 A;  3HGK E;  4JRQ A;  3QNO A;  2VIX A;  3N1E A;  4DTX A;  3C6O B;  3SQ0 A;  2HD0 A;  4FJJ A;  2PFT A;  1LDK E;  2VJ4 A;  1MHY G;  3TAE A;  3QER A;  4RG8 A;  2PFV A;  3TJY A;  4HCC A;  3SUO A;  4ADN A;  3UIQ A;  4RL5 A;  1FZ8 E;  1FZ7 E;  1Q9X A;  3QEP A;  1XVG E;  4M3Z A;  3N1B A;  3NE6 A;  1FZH E;  1FZ4 E;  3HP9 A;  1XMH E;  2JH8 A;  4JRP A;  3C6P B;  3NDK A;  3SQ2 A;  3RWU A;  3SUQ A;  1MHZ G;  1WAJ A;  4DTJ A;  4EYW A;  4DTO A;  4DTN A;  3RMC A;  2OVQ B;  4M3R A;  4EP9 A;  3SNN A;  3QEV A;  1NEX B;  4EPH A;  4FJ9 A;  2DEB A;  1XU5 E;  4JS4 A;  3RMB A;  3SUN A;  2E32 A;  4AKH A;  3WSO A;  4I9Q A;  1FZ6 E;  2E31 A;  2LF3 A;  1FZ5 E;  2B8I A;  1XMG E;  2QXF A;  4M42 A;  4X5M A;  4RNG A;  4M41 A;  4JS5 A;  4FK4 A;  3NAE A;  3SQ4 A;  2P1Q B;  3NHG A;  2OYQ A;  4J2D A;  5IRE A;  3QEX A;  2P1M B;  3HL8 A;  4DTR A;  3SI6 A;  4FK2 A;  3QEW A;  4DTP A;  1FS1 A;  4I6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...