2MMPA

Solution structure of a ribosomal protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
b'MLKHGKYVYIDLNNGKYVKVRILKSRDDNSVEKYVLTSHVSKNRPKNAIVIKMDNLPIEVKDKLTRFFLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Ribosomal protein
source organism Sulfolobus solfataricus
publication title Structure determination of archaea-specific ribosomal protein L46a reveals a novel protein fold
pubmed doi rcsb
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18533 DUF5622 Domain of unknown function (DUF5622)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.860 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mmpA00
2MMPA
chains in the Genus database with same CATH superfamily
4K11A 2JZ2A 4C0GA 4BI4A 4E6RA 2A08A 2CZ7B 2JUFA 1K9MR 1YCSB 2CT3A 2E5QA 3ZBDA 1N8RC 5LJ3h 4M7DE 4N0AC 2FEIA 1N9RA 4E7ZA 4E7HA 1VQOQ 3I5RA 1OPKA 3RNJA 4MZPA 1NEGA 4M7AB 3CCEQ 3JSCA 5CKDA 3G7ZA 2Y4YA 1WXTA 4V2SA 4J7FA 3J7AF 4XTUA 4PJOF 1B3QA 2DEUA 2EGEA 4JPBW 3CCQA 1OU8A 2HQXA 2VC8A 4QQGA 4F17A 2AZSA 4L59A 4OB2B 3QBYA 3CCMA 2RHUA 2VKNA 1SHFA 1M3AA 2ZPGB 1U8RA 1K0XA 2EQUA 4OP0A 3MCAB 1WHJA 4O6JA 2YRCA 4RTTA 2ESWA 2SRCA 2J05A 1NLOC 3I35A 2CSQA 1M3BA 2NUTB 3THKA 1WX6A 2DIGA 4RKUE 3CC4A 1M4ZA 5CVIA 2K2VA 3VS4A 2P4TA 3CCLQ 1BCOA 1D1BA 2EYYA 2HNIA 1YIJQ 4Z8AA 3I5SA 3V8LA 1PHTA 2BE7D 1UFFA 2I0NA 1Y96B 4QVDA 1VQ4A 3HHTB 2RJEA 4M7AC 2JVVA 4D8KA 4GY5A 1YI2Q 2GQIA 3JB9G 4L6V5 1YJ9A 2E5KA 4LDVA 3G4SA 3A8MB 1OZ2A 2K57A 4X1VA 2ABLA 3OYAA 2CDTA 2XIDA 4XTWA 3M58A 5KYXA 3OW2S 1NJIC 1Z9ZA 1VQ8Q 4Z89A 1B07A 2L5QA 5FU6B 1N6AA 2JTMA 3FLGA 3R6NA 3FIFA 1TUGB 1Y0MA 5IHNA 2FZCB 5IAYA 1QW1A 3NTIA 1WGSA 4C5HA 1PCXA 3SEMA 5I2SA 4BACA 2VUBA 2QEXA 1ZBXA 2HZYA 1TU0B 1O9SA 2DETA 4OMQA 5ECAA 1AHJB 1RL2A 2KI7A 4MDXA 2BE9B 4RCBA 5GAMj 3ZEHA 2P0KA 1JB0E 2DILA 1D1CA 1M3CA 4WF2A 1YITA 1K8AC 1KQSP 4ELYC 1T0HA 1TWBA 1U5SA 3OSVA 3LW5E 2O4XB 4JDSA 3P8DA 4FYYB 1NYFA 3EFOA 2YUPA 1Q81R 2HL5C 2DLPA 1WJSA 2D6FA 1M1FA 4NS5A 2A37A 5A0DA 2QEXT 4LDXA 2DZ9A 4XQ3A 2XKOC 2DMOA 4M7DG 1NLPC 3JCMX 1QVFA 1QCNA 1RAHB 3JCMf 5A0LA 3EG2A 2AKKA 2ED1A 2DRMA 2E1HA 2YDLA 5IHKA 1VQOT 2DNUA 4M78F 3CCJQ 3JCMW 1RAAB 4R0KA 2L3PA 3VRYA 1YIJT 3MEAA 2E65A 5IHIA 1OV3A 4LD9K 3M5AA 1K8AU 5D6YA 1MHNA 2DIQA 4D6WA 3JCMP 4F7UE 2LTOA 2MPXC 1QKWA 1VUBA 3LH0A 4LXCA 1RACB 1VQMA 1UUEA 4JRIA 2KRMA 4RTVA 4XU0A 4JJCA 2OTJT 4IUTA 3H9NA 1FMWA 1QVGA 1LPLA 4FSSA 1WFWA 1QVGP 4FCYA 2PNIA 5FROA 3URGA 2EBPA 1UEBA 4PKCC 3UT1A 2V8KA 3JB9F 2J6OA 3EG9B 3OSSC 5GMKl 4CC3A 2ROTA 3CD6T 3I55T 1AWXA 3MP1A 2VVKA 2F2WA 3P8HA 4TVRA 3EGDA 4IKFA 2EGAA 3X24B 2QQBA 3G6EA 1VQ8T 4M7DC 4IUQA 2QGFB 2RQRA 1E6GA 4PJOD 1GCQA 3NHNA 1EIFA 4MZMA 2LJ1A 1I8FA 1KSWA 1WYXA 1TUDA 3MO8A 2B8AA 3DKMA 3CPWA 3GBQA 3RMQA 3S6WA 5CQXA 4AMCA 3JB9I 4RUGA 2M51A 2A7YA 3HSBA 2NUPB 2B86A 2FL7A 4N0AA 4AFUC 2KK4A 1MMAA 5GAOl 3I56Q 2M0YA 4HCCA 1M27C 1V29B 5HCKA 4CC2A 1KD1R 3OYJA 5CKFA 3OB9A 1Q82R 1VIEA 4EMKB 3OMGA 2RQWA 3EGXB 4EMHA 3S3NA 3L2UA 3BW1A 2DVJA 1VQNA 3JCMV 1XNIA 3A98A 3L42A 2JNGA 2V26A 1WQ7A 2DBMA 4XTXA 2RMOA 2AHJB 1G3WA 3CCMT 3GPLA 2CKKA 3CCUT 2QASA 3OYFA 3CBPA 1UHCA 2HAXA 2OAWA 1SRMA 4LDWA 3QWXX 2LQWA 2W10A 2COWA 4OMMA 2F2XA 1H92A 4QW2A 2CZ0B 2HKQB 2X35A 2K3BA 2OAUA 4IUVA 4QVCA 1NM7A 2DTIA 4C92C 1I5LA 4ANJA 2XDBA 4CRIA 1YI2A 4JS5A 5GANd 4PJOA 2O01E 1IGUA 2RHZA 2A36A 4HXJA 1XTDA 1BBZA 3OY9A 1HSQA 3REBB 2QA4A 5I2MA 4Y28E 5D6WA 2YT6A 2YRVA 5CR2A 1WIEA 3TSWA 2ZPIB 3H8ZA 2VGMA 3L2RA 3X26B 4AT1B 3G6ET 1CKAA 1VQ8A 4RMOA 3CMEQ 3A8GB 2J6KA 1EX4A 3HP9A 5LJ5g 3NGPA 1M1KC 1IB8A 4OMNA 3EH2A 1Y07A 1AOJA 1G8XA 2LVMA 4FL6A 1RAIB 4J6WA 2K9GA 4FYWB 5D7UA 1NE8A 2R5AA 1W6XA 4IIOA 1G2BA 4C0ZA 4FYVB 4EPCA 2L3SA 2C06A 4MMKA 3QHSA 4Y92A 2DFUA 1VOMA 4BI8B 4KGZB 2ROLA 2E4HA 1Q82C 5M9OA 3L1AA 5HKCA 2PTKA 4D8DA 3E9GA 4F7UA 3G71Q 1W2BA 2Z0WA 1Q86C 4M77A 3LH5A 1QCOA 2GQVA 1WXBA 2EKOA 1OX8A 4LNPA 1YJNT 3F70A 2QA4T 1M8MA 2IVWA 2KVQG 3QDFA 3QYGB 1T0JA 1X43A 1RI0A 4RG2A 1K4US 1VQOA 4FT4A 4JRQA 2DL4A 4A53A 2EPDA 4QKUA 1OPLA 1X6BA 1K73R 2QQ9A 4EDUA 1X6GA 5GAN3 2DERA 4MZTA 2DXBA 3QXEB 2XMFA 2JW4A 1KQ2A 4IUUA 3G1JA 3GNFB 5LJ5f 2M9UA 1HK9A 5I21A 1MUZA 2P4RA 4A54A 4KGXB 2MYSA 2RF0A 4C8QC 2IPOB 5IT9E 5D6XA 3JCMc 3RBBB 2LC4A 4M7AE 3CCSA 2HBWA 3CCVT 2F69A 2M0OA 2HEQA 5KYUB 1UE9A 1Y57A 3CC4Q 2X3WD 1KQ1A 4CC7A 4BY6B 1MV3A 3CCLA 2QQAA 3UWNA 2VGNA 2DXCA 3I56T 2FYKA 1J3TA 4JS4A 3MP8A 1WQWA 5FW9A 4M78G 4M77D 1KJWA 1NBEB 2KRNA 1PSEA 2FPEA 5IXFA 3NTHA 1W2BS 2CP0A 1D0ZA 3RDVA 4PJLA 5KYWA 1YJ9Q 3OYGA 2HBPA 1I4K1 3PMTA 2JTEA 5FU7C 3CQTA 1C6VX 4C8QE 3M0PA 4C92D 1JU5C 1YNZA 3CCLT 3E19A 2CREA 2GTOA 3OYYA 1C0MA 2KRSA 3QIIA 2VB6A 1AEYA 3L2ZA 2OTLT 4EMGA 3VYGA 1G83A 1VQMT 3CCUQ 4II1A 5A0GA 1G3TA 3QUIA 5GMKe 5EC7A 3VU3C 5I22A 1JQQA 4DEYA 2EFIA 2QQSA 1QWFA 3MEWA 1NYGA 2RI3A 3H0FA 3SWNB 4M7DB 4NL3A 4DOWA 2RK1A 5GMKh 3CXCA 2Y4XA 4KBMB 5GAMf 1AD5A 5GAMh 3CD6Q 4N4GA 2K7AA 1KD1U 2XU8A 2BZXA 3RMSA 1BKBA 3HL8A 1UDLA 2BIVA 3M4GA 3VS5A 1YITQ 2M16A 7AT1B 1NPRA 3QSUA 4J9HA 2KXDA 2VYTA 2BKDN 1W2BP 2KSSA 1TUCA 4OB0B 2BUDA 3CCQT 3GNGA 4BY6C 3LX7A 4M75G 2YWWA 1X2QA 1M90U 3UATA 4J5YA 5LJ3g 4M78D 4M77G 2CP6A 4Z02A 3PIPA 2KR3A 3M9QA 1AWOA 4CC4B 4PL6A 1KD1C 2V1RA 2FPDA 3J81E 3CMAT 2EJFA 2ENMA 4PLLA 1UGQB 1W4SA 2J7IA 4FM4B 2HDAA 4X9DA 4BI3A 1T3LA 4BE2A 1VQPA 3OS0A 3OYLA 3VS6A 3EH1A 3E2UA 2DO3A 1MMNA 5FWBA 2KROA 2OTJQ 5KYXB 2OTJA 2HSPA 2KE9A 4N4HA 1UECA 2CP7A 4LE9A 4C0DB 1X75C 2AZVA 3Q1JA 5J3BA 1IRXA 1VQ9Q 2RJFA 2YUNA 3QO3A 1Q7YR 5CKBA 2GBQA 3KBGA 3H6ZA 3AT1B 2LMJA 4ZN1A 1EZZB 2YLBA 4M78B 1AWWA 3CXCP 2EIFA 1KK7A 1GCPA 2MAMA 4J9EA 4E7LA 2JS2A 1M2VA 1UJYA 5FWCA 2O9VA 2XHCA 1H8KA 1SEMA 4PJOG 3CCRA 3JRZA 5KE3A 2KYMA 1M1KR 1VQ4Q 1WNLA 4HT8A 1YFNA 1JJ2S 4ZTFA 1X27A 2JN0A 2GFUA 2D0QB 4A4KA 3FRNA 1XQHA 1S72T 3SDZA 1ZSZA 4GLMA 3HRUA 2LRQA 1KFZA 3A8OB 1MV0B 1YN8A 2EJ9A 3I55A 4F14A 4WTOB 4M75A 2D8HA 2IG0A 4M75E 3I55Q 1A0NB 4PK4A 1VQLA 1BCMA 5FU6C 1F1BB 2KMTA 1BI3A 2QTVA 1I0CA 4C92E 5GMKm 3VUBA 2BTTA 2YUOA 4ME7A 1B34A 2ZAEA 2ZPEB 2K79A 1BI0A 1PG5B 5GANf 1FMKA 1ZUYA 2DEQA 2DF6A 1ZQ1A 2XICA 4M77F 4F04B 4BUGA 2FHDA 3NMZC 1M8VA 3HKSA 4DEXA 2X4YA 1IHVA 2XI9A 4PFPA 4ZGDB 4F16A 2RPNA 3MPUB 1D3BB 1AT1B 4HA8A 1TTHB 1WPYA 4JLGA 2DL8A 4PJOC 4M78C 1WHKA 3BDUA 1UHFA 1UB4A 5GMKi 2SEMA 2EQMA 2LQNA 3CPFA 2LJ0A 4XTYA 4PJMA 3AHUA 5CQYA 2AIRB 2PQWA 3CC2Q 1VQ7A 2P84A 3EHRA 3EG9A 1Q81U 3CC2A 1X69A 2DL7A 3CCVA 3RESA 3QWYA 4C5GA 4HVUA 3V7RA 2O9SA 4Z88A 4C5IA 3CBOA 3EGDB 1OZ3A 1SF9A 2GF7A 2O31A 3PNWC 5LJ5h 3O5ZA 1E6HA 3M54A 2LNHB 2ZCFB 4M7DF 1KHCA 4NOYA 1UTIA 2F5KA 4IURA 1ZSGA 4JJNK 1YHQT 2JOYA 3OQ5A 2FB7A 4DBHA 1WHMA 1RABB 3C94A 2DZCA 1TSFA 2P0PA 3R6OA 1MGQA 4FSXA 1WLPB 2P0QA 3TREA 3OS1A 4C8QD 3CMEA 3SHWA 2H3EB 5LJ3d 1VQMQ 3UA6A 2NUPA 4RTUA 1ZUKA 3UA7A 1KC8C 5CK9A 3JB9D 2IIMA 2QYZA 5FRNA 2CH4A 3BFMA 4AG1C 4J9DA 1Z9QA 2FZGB 4OGEA 3UPUA 5CO7A 3PMIA 3WVEB 4KUDK 2CUBA 1GRIA 3A8LB 1GL5A 2X51A 4J6XA 3CC7T 4L5GA 1K1ZA 4LDUA 1NEBA 2O4XA 3SWNC 3QZ9B 1IO6A 4M7AD 3QG1A 4J9FA 1VQ7T 4LDYA 1LOJA 4E2FB 4OMPA 1GFDA 2K5FA 4FW1A 5CKEA 2COYA 3DB3A 3X28B 4C8QA 1B7TA 1FX7A 4QVZA 4IUPA 4PNOA 2AKLA 4J9CA 3DLLA 1RAEB 3VS2A 2GFAA 1QVGS 4XK8E 1M5Q1 3V7SA 1I07A 2O2OA 3MKDA 5KYYB 2LNVA 2LCLA 1VQKQ 5FRMA 5DY9A 2PZ1A 1VQKA 3NTKA 5GAOr 3EFSA 2DX1A 2EQIA 4C8QG 2NUZA 4O5VA 4OMFB 1YJ9T 2H3JA 1V76A 1S72Q 1N27A 2RI2A 2K3YA 5AYFA 1K73U 2DA9A 4RTXA 2KDSA 2ZPBB 1M9SA 2ECZA 2QQRA 4QT7A 1YP5A 1BI1A 1FYNA 1EFNA 1OX9A 3M56A 4MDWA 4ORZA 3TEEA 3A5ZB 1PD1A 1RAGB 3OYNA 4DBFA 2DK3A 2E70A 1NZ9A 2GGRA 3M57A 4DOVA 2I2LA 1QQJA 1JBMA 2CZ1B 2JM8A 1TXQA 5IH2A 2KT8A 4C92G 5GJWB 2VWFA 2COZA 3CCST 3OS5A 4M7AG 1K76A 1OEBA 4JZ4A 3UDCA 3V8KA 2EWNA 2GNCA 4M75C 3VS3A 1GBQA 3M0QA 4C92A 3GIBA 1WHHA 1LCKA 1Q81C 2YRDA 1RI9A 2RD1A 2OTLQ 3QYHB 1Q86R 4XTVA 2D0NA 2EYZA 2CP2A 2XDDA 3GOXA 1KG1A 5CCAA 1VA7A 5DLQE 1VQLQ 4BD3A 3SB2A 4AFQC 1QP3A 3CCUA 1WXUA 2F1LA 3WXMB 4M78E 3EHQA 5GAN2 4R56A 4PJOE 2G6FX 4JZ3A 1R8OB 2LT1A 4HCBA 3JCMb 1BU1A 4RTYA 2HL3A 5KYNA 1WZOA 1U1SA 3JCMh 3EG3A 1I81A 2CGHA 4F7UF 3SFMA 2YUQA 3JCMe 1V1CA 3KUFA 4B9WA 2CS7A 4EMKA 2BZ8A 1G3YA 1WA7A 3TU4K 3OYHA 1OU9A 5KH6A 1KHIA 1SHGA 1ZHIA 1G3SA 2LCSA 1NJIR 4A4EA 1QWEA 3HFOA 5CAIA 5J39A 4RG8A 4IIMA 4BB7A 4JJBA 3V8JA 4PJNA 3G71A 2W0ZA 2E3IA 2F5TX 3H0IA 1VQLT 2MF2A 4M77C 3JCMg 4Y91A 1IZ6A 1W70A 2C0IA 1KC8R 2CUDA 1Q7YU 1R0CB 1PC0A 2X4JA 1JEGA 2DAQA 1ZA1B 2PUKB 1OYXA 2EQKA 1JXMA 3DLMA 1ZX6A 1H3HA 2WSCE 3CEYA 3JB9H 5GAMg 4PJOB 1Y71A 1YJWT 3CCJA 1CSKA 1X01A 4R55A 4PFOA 4RCCA 3BE3A 1VQPQ 2QTXA 1RLQC 1WJRA 4XU2A 5DM7R 1SG5A 4DQ2A 2PVGB 3CCQQ 3OS2A 1YCYA 3ASKA 1TOVA 2E41A 2PU9B 4KUIA 3OYMA 2VASA 3E1SA 1M2OA 4OMLA 3OYCA 3M59A 3TVTA 3PFSA 5L23A 4PFZA 1CKBA 5FU7B 3CCET 2L3QA 2X9HA 3CCSQ 5GAMe 3NPFA 1WDXA 2JTFA 2DL3A 2K6DA 1AZEA 1ABOA 2NUTA 2VV5A 1OULA 3CC2T 4GBQA 2HMAA 1YHQA 3GLXA 4A4HA 4DA4A 2E12A 3CC4T 3CCRQ 2CSIA 2ZPFB 1BB9A 2YHTA 2CP3A 3M53A 1Y96A 2D8JA 2AK5A 1PWTA 2RNAA 4XU1A 1Y7XA 2DKGA 3LWIA 3QJYA 4HCZA 3RUXA 1U3OA 3VS7A 2NYSA 3G6EQ 3LGLA 4P5NA 1I1JA 4M77B 2DVEA 3IQLA 2EYWA 4OGCA 1Q82U 1WHLA 3FC3A 4B6MA 2C0TA 1AZGB 2XD0A 2FPFA 2DM1A 2PVOB 1K9AA 4J8OA 4ESRA 3VUZA 3S3OA 3FDRA 3PTAA 1QVFP 3MJXA 3U23A 2QK0A 3I56A 2LX9A 3M0UA 3VJPA 2EYXA 2QDLA 5GAOp 2EYQA 2EJGA 2PVDB 1PKTA 4KH1B 4QQ6A 2RH2A 5HY6A 4ZNXA 3OA6A 2DE0X 1VYVA 4WCIA 3ZL7C 4FYXB 3EAEA 5KE2A 3JCMQ 1BK2A 2A0FB 2G3RA 2V8IA 1D1AA 4E7IA 1U1TA 1UJ0A 4A4GA 5LJ5e 1R0BG 4HKEA 1K9MU 1AWJA 4AFSC 4AG2C 2H8HA 4KH0B 4HVVA 5GAOq 4C0DC 1M2VB 2HQEA 1PRLC 2DTOA 2RJCA 3CCVQ 2NLUA 2JMCA 1VQKT 1PKSA 2L0AA 4M7AA 2XG8D 5KYWB 1ACMB 3RERA 4EIKA 2O88A 5GAN4 2DYIA 3LYIA 1VQ6Q 3VS0A 5AT1B 1X6OA 2QDYB 4E7SA 4M75B 2C0OA 3PVQA 1BIBA 1N9SA 2HD0A 2X3XD 3M0RA 2JT4A 3EG1A 1PRMC 3CCJT 2D9TA 3QPHA 5GAOn 4N4IA 1MNEA 1LVKA 3A1PA 1PSFA 5GAN8 4PJJA 2MCNA 3O8VA 4BDYA 3SWNA 5KCOA 4EMKC 4ATOA 1B34B 2A28A 2YXYA 1Q7YC 3OMCA 1LNXA 1SSFA 1VQ5Q 4ZGEB 2A3LA 2KEAA 2RK2A 2WSEE 1ZLMA 2EW3A 4QQDA 3RR6A 5GAN6 4BE1A 2E10A 1YBYA 2DJQA 3LWHA 1YI2T 1IGQA 1KIKA 2DXTA 2GTJA 2RQTA 4XTZA 3HTRA 1WHGA 3JV3A 3T9NA 1N8RU 2X4XA 5LJ5j 1OOTA 1BYMA 2YLCA 1IHWA 2CT4A 2EQJA 4J9IA 2E6NA 2WACA 2FO0A 2JJ9A 5IN1A 1QMCA 3QDRB 2OI3A 1KC8U 1U06A 5L8RE 3PIOA 4MMLA 2XK0A 1UGRB 8AT1B 3WVDB 2RB6A 1GFCA 5GAMd 2ZZDA 3FJ5A 3BY7A 4E7JA 1QVPA 3MEUA 2NWMA 2JM9A 5LL6S 2YSQA 2EVRA 1QVFS 1W1FA 2ZGWA 3RKYA 1VQ5T 1D0YA 3HPWA 3CCMQ 4XU3A 3KXTA 1PD0A 1ZBJA 4BE0A 3EGXA 1UG1A 1OI1A 1SKUB 3GP8A 2K5IA 5LJ3f 3BDLA 1C1AA 4XAXB 2MOXA 3MP6A 3S3MA 3CPWS 3TQ7P 4M78A 5GANg 3EFOB 2J6FA 1D0XA 2QXFA 4B9XA 2LQ8A 3RKXA 5C0MA 3H0HA 2FG0A 4OB1B 4BDZA 2VXFA 1SRLA 1TS9A 4J6YA 3CC7A 2RQVA 3RIRA 1N8RR 2LQKA 2F2VA 2R58A 3P8BB 1I5OB 1XOVA 2HSEB 3VRZA 1HD3A 1RAFB 4PLIA 2FZKB 1ZSZB 4OMOA 5DLOA 3M0SA 1K73C 3ER0A 1BI2A 1WI7A 2K3XA 3HRTA 1QLYA 2BZYA 4JLIA 5GANj 2DBKA 3HRSA 4FIBA 4JRPA 4C8QB 3EFRA 3L2VA 2DL5A 2DYBA 1FMVA 1N5ZA 2OJ2A 4Q5WA 2OX7A 2JS0A 5GJVB 3CMAQ 2FRWA 4ZN3A 1MMDA 1VQ4T 5KYYA 1IREB 3X25B 2KT1A 3J80E 3L2WA 2KY9A 2LCCA 1R77A 2DRKA 3OW2A 8ATCB 2L8DA 2RO0A 4M7AF 3TSZA 3TCJA 2RA2A 2E3HA 1PNJA 1VQ6T 1X2KA 3OW2P 3M4YA 1O75A 3NFCA 3REAB 1QCFA 4HT9A 1HJDA 3V7CA 1D3BA 1DJ7B 4JJDA 2L89A 3L2QA 1VQ9T 4LUEA 1SSHA 3HFNA 2JMAA 5GANh 2EKHA 2KBTA 2KNBB 1KQSA 5GANe 2KQWA 2MMPA 4FU6A 3JCMJ 3M55A 2DXUA 2LX7A 5LJ3e 2X4WA 1HXDA 4LUDA 3CBMA 5IXBA 2RHXA 3LGFA 2AT1B 3FJPA 3VYHB 3C12A 3PGGA 2GCXA 4C8QF 5I11A 1RADB 4M4ZA 2D1XA 3QZ5B 4FW2A 4GLKA 3MEVA 3OBWA 5HK0A 4J9BA 2ED0A 1VQNT 1BIAA 4C0FA 2DD4A 4KT0E 2DD5A 4C92F 1WJQA 1VYTA 4M7DD 1PM3A 1YJNQ 1K9MC 1GXIE 3META 2QA4Q 1FXXA 3EGUA 3X20B 5C6SA 2JXBA 2HQHA 4VUBA 2ATCB 1MMGA 5LJ3j 1JJ2P 3G71T 3VKIA 4J7IA 1P92A 4J83A 1YITT 3LLRA 1VQ9A 1VYUA 2EGCA 1VQ5A 3SD4A 1S1NA 2RN8A 1YHQQ 3CXCS 2V1QA 2LP5A 4KULA 5FLXE 1YIJA 3GF5A 1GBRA 2DJZA 3C95A 4E47A 1RLPC 1YJWQ 2R5MA 2VXEA 1UGVA 3KFVA 1YJWA 5CKHA 2LJ3A 2LZ6B 1VQPT 4HVWA 1TG0A 2KAFA 2HCKA 5EG2A 1M1GA 4LD6A 3JCMd 2RM4A 3I9QA 1HYOA 3FB9A 3JB9J 1NPPA 2ZPHB 3C4SA 2LT4A 2M02A 4JUVA 2LDMA 1QP2A 2OTLA 2QI2A 3CCRT 4OVAA 5GMKj 3G4SQ 5A2QE 2K2MA 4X34A 2HKNA 4LN2A 3OYBA 3JAME 3CPWP 1NG2A 2KYBA 4OB3B 1M30A 1H3ZA 4OF1A 2CH4W 2J06A 1ZUUA 2CZ6B 3ZFJA 4RTWA 2FRYA 3CCEA 2KGTA 3ULRB 4J9GA 2L2PA 4X9CA 2EAYA 3OYKA 2Y90A 4DBRA 4M7DA 4M75D 5KCHA 4JRKA 3RKWA 5HK3A 2RQUA 5LJ5d 1GCQC 3FEOA 4UC4A 2MI6A 1KQSS 1RUWA 4A63B 6AT1B 1S72A 1ABQA 2QG9B 3M0TA 3VV0A 1M90C 2CYZB 1JJ2A 1VQNQ 1G5VA 1OQKA 3OBYA 1UGPB 1IXDA 1NJIU 2FVUA 1M90R 4F7UB 3N5BB 5CIUA 3UF4A 4AFZC 1K0SA 1E7OA 2MWOA 5GAN7 1LJOA 3PT9A 3D7SB 3OYDA 1VQ7Q 2RHYA 4A4FA 2M1HA 2MIOA 2RHIA 2MWPA 1SPKA 1XJWB 1Q95G 4M75F 4HCKA 1AVZC 3CC7Q 1D09B 4YTLA 4C92B 4FT2A 3MHXA 4ELZC 4DBQA 2V8JA 2K5LA 3A8HB 4KGVB 2PUOB 3C0CA 1QKXA 1VQ6A 4CI0C 1JRIA 1YJNA 1M1KU 1UGSB 2RJDA 4ZGJB 2L3RA 4RTZA 3OYEA 4M77E 1YWPA 1Q86U 5GAN5 2QGGA 3E9FA 3CMAA 3DB4A 1VIFA 2KXCA 4E7KA 4NL2A 2QAZA 1ARKA 5KYUA 2E64A 9ATCB 5J26A 1K8AR 1TH7A 5GAOm 3ME9A 3CD6A 4C5EA 2QEXQ 3VS1A 1MNDA 1FWZA 2R57A 2DPPB 4KRTA 2XDPA 2K4YA 1ZSZC 3PE0A 3EG0A 2DTHA 4ZTJA 3G4ST 1JXOA 1YWOA 4F7UG 3H41A 2CP5A 2MK5A 1T3SA 3CMET 3OYIA 2RI5A 3QKJA 3INZA 1ZA2B 1JO8A 2WSFE 3QJ6A 2E6ZA 3PVLA 1H641
chains in the Genus database with same CATH topology
1LOJA 2EKOA 2JZ2A 2E6NA 2K5FA 5CKEA 4BI4A 2WACA 4C0GA 1YJNT 3DB3A 3X28B 4C8QA 2CZ7B 3F70A 2QA4T 1FX7A 2JUFA 4IUPA 2IVWA 2KVQG 3QYGB 2E5QA 4PNOA 4QVZA 5IN1A 3ZBDA 3DLLA 3QDRB 1N8RC 4RG2A 1RI0A 1KC8U 5LJ3h 4M7DE 4N0AC 5L8RE 1VQOA 1N9RA 2GFAA 4FT4A 4E7HA 3PIOA 4MMLA 1QVGS 4XK8E 1M5Q1 3V7SA 4JRQA 2XK0A 4A53A 4MZPA 4M7AB 1UGRB 2LNVA 3JSCA 2LCLA 5FRMA 2QQ9A 5DY9A 3WVDB 5CKDA 4EDUA 1VQKA 2RB6A 3G7ZA 5GAN3 5GAMd 2Y4YA 4MZTA 2ZZDA 2DXBA 4V2SA 3NTKA 4J7FA 5GAOr 3J7AF 3BY7A 3EFSA 3QXEB 4E7JA 4XTUA 1KQ2A 4IUUA 1QVPA 3GNFB 3MEUA 4PJOF 5LJ5f 2M9UA 1HK9A 5I21A 5LL6S 4A54A 4C8QG 1QVFS 4O5VA 3CCQA 2ZGWA 3RKYA 4C8QC 2HQXA 2VC8A 3HPWA 4OMFB 4QQGA 4XU3A 3KXTA 5IT9E 2H3JA 1YJ9T 4L59A 4OB2B 3QBYA 3CCMA 4BE0A 5D6XA 1N27A 2RHUA 2RI2A 2K3YA 5AYFA 1K73U 3JCMc 1OI1A 2KDSA 2ZPBB 2ZPGB 3GP8A 1U8RA 1M9SA 2K5IA 5LJ3f 2EQUA 2LC4A 2QQRA 3BDLA 4OP0A 4M7AE 3MCAB 4O6JA 4XAXB 3CCSA 1BI1A 3MP6A 3S3MA 3CPWS 4M78A 3CCVT 2F69A 2M0OA 5GANg 3M56A 4MDWA 3TEEA 2DIGA 3A5ZB 4RKUE 3CC4A 1KQ1A 1M4ZA 2QXFA 5CVIA 4B9XA 3OYNA 4BY6B 2K2VA 2P4TA 2DK3A 2E70A 1NZ9A 2LQ8A 2HNIA 3M57A 3RKXA 4DOVA 5C0MA 2QQAA 2I2LA 4OB1B 1JBMA 2CZ1B 3UWNA 3CCLA 2VGNA 2DXCA 4BDZA 2VXFA 3V8LA 3I56T 2FYKA 4C92G 1Y96B 3MP8A 4JS4A 1WQWA 4QVDA 1VQ4A 3HHTB 4J6YA 4M78G 3OS5A 4M77D 3CC7A 3RIRA 3CCST 4M7AG 2LQKA 2R58A 3P8BB 1PSEA 2RJEA 1W2BS 1XOVA 3NTHA 3UDCA 3V8KA 2JVVA 4M7AC 2EWNA 4GY5A 4M75C 3GIBA 4C92A 3JB9G 4PLIA 3OYGA 1Q81C 2HBPA 4L6V5 2RD1A 1YJ9A 1I4K1 3QYHB 3PMTA 5DLOA 4LDVA 4XTVA 5FU7C 3G4SA 3A8MB 1K73C 3ER0A 1BI2A 4C8QE 3HRTA 2K3XA 4C92D 1OZ2A 2K57A 2XDDA 4JLIA 3CCLT 5GANj 3E19A 3HRSA 4FIBA 3GOXA 1KG1A 5CCAA 4JRPA 3OYYA 2XIDA 3OYAA 4XTWA 3M58A 5DLQE 3EFRA 4C8QB 4BD3A 3OW2S 3L2VA 3QIIA 1NJIC 3SB2A 1QP3A 3CCUA 3L2ZA 2L5QA 5FU6B 2OTLT 3WXMB 4EMGA 3VYGA 1VQMT 4M78E 1N6AA 5GAN2 4R56A 4Q5WA 4PJOE 2JTMA 3FLGA 4II1A 5A0GA 3FIFA 1G3TA 3QUIA 4ZN3A 5GMKe 1R8OB 2LT1A 3VU3C 1VQ4T 3JCMb 4HCBA 1IREB 3X25B 2EFIA 2QQSA 3MEWA 5IAYA 3J80E 1QW1A 2RI3A 3NTIA 3SWNB 3L2WA 2KY9A 4NL3A 1U1SA 1WGSA 4DOWA 2LCCA 4M7DB 3JCMh 2RK1A 4C5HA 5GMKh 3CXCA 2Y4XA 4KBMB 1I81A 2CGHA 4F7UF 5GAMf 5I2SA 4BACA 5GAMh 3OW2A 2VUBA 2QEXA 4N4GA 2L8DA 2RO0A 3SFMA 4M7AF 3TCJA 4B9WA 2RA2A 3KUFA 3JCMe 2CS7A 4EMKA 1KD1U 1ZBXA 1VQ6T 1O9SA 1G3YA 2XU8A 3M4YA 1O75A 3NFCA 1AHJB 3RMSA 3TU4K 1BKBA 1RL2A 4HT9A 4MDXA 3HL8A 3OYHA 5KH6A 3V7CA 1D3BA 1DJ7B 2BIVA 3M4GA 2L89A 4RCBA 1KHIA 3L2QA 5GAMj 3ZEHA 1ZHIA 2P0KA 1JB0E 1G3SA 1VQ9T 2M16A 3HFNA 4ZTFA 4WF2A 5GANh 1YITA 4A4EA 1NPRA 3HFOA 3QSUA 5CAIA 5J39A 1K8AC 4ELYC 2VYTA 4RG8A 4BB7A 1KQSA 2BKDN 3V8JA 3JB9F 2KSSA 3OSVA 3G71A 5GANe 2KQWA 2O4XB 3LW5E 2BUDA 2MMPA 4OB0B 2F5TX 4FU6A 4JDSA 3GNGA 3CCQT 3JCMJ 3P8DA 4BY6C 1VQLT 3M55A 2DXUA 3LX7A 4M75G 2MF2A 4M77C 1M90U 3JCMg 4J5YA 4Y91A 1IZ6A 5LJ3g 4M78D 4M77G 5LJ3e 1WJSA 2X4WA 2D6FA 1M1FA 1HXDA 3CBMA 4NS5A 2RHXA 3LGFA 3FJPA 5A0DA 2DZ9A 4Z02A 2QEXT 1Q7YU 4LDXA 3PIPA 3VYHB 4XQ3A 2XKOC 3M9QA 2X4JA 3C12A 2DAQA 4M7DG 3PGGA 2GCXA 4C8QF 2PUKB 1OYXA 3JCMX 2EQKA 3DLMA 4PL6A 1KD1C 3QZ5B 1QVFA 3J81E 3CMAT 3JCMf 4GLKA 2EJFA 4PLLA 5A0LA 1UGQB 2WSCE 3CEYA 3MEVA 3OBWA 5HK0A 1W4SA 3JB9H 5GAMg 4FM4B 4PJOB 1VQOT 2E1HA 1VQNT 1Y71A 1BIAA 4X9DA 1YJWT 4C0FA 4BI3A 1X01A 3CCJA 2DD4A 4BE2A 1VQPA 4R55A 4M78F 3JCMW 3OS0A 4RCCA 3OYLA 2QTXA 4KT0E 2DD5A 4C92F 1YIJT 1WJQA 1WJRA 3MEAA 4XU2A 5DM7R 2E65A 4M7DD 1K9MC 4LD9K 1GXIE 3META 1FXXA 2DO3A 3M5AA 4DQ2A 2PVGB 1K8AU 3X20B 5D6YA 1MHNA 2DIQA 5C6SA 3OS2A 1YCYA 3ASKA 2PU9B 2E41A 4KUIA 4VUBA 4D6WA 3OYMA 3JCMP 3E1SA 3OYCA 5LJ3j 2OTJA 3M59A 3PFSA 4F7UE 4N4HA 3G71T 2LTOA 3VKIA 4J7IA 1P92A 4C0DB 1X75C 1VUBA 3Q1JA 5J3BA 3LH0A 4J83A 2RJFA 3QO3A 5FU7B 3CCET 1YITT 3LLRA 5CKBA 1VQ9A 5GAMe 1VQMA 2JTFA 4JRIA 3KBGA 3H6ZA 4XU0A 2OTJT 4IUTA 4ZN1A 2YLBA 4M78B 1QVGA 1VQ5A 2VV5A 3SD4A 3CC2T 2EIFA 3CXCS 5FROA 3URGA 2MAMA 1UEBA 4PKCC 1YHQA 4KULA 2V8KA 3UT1A 3GLXA 5FLXE 4E7LA 4A4HA 4DA4A 3OSSC 5GMKl 1YIJA 3GF5A 3CD6T 2E12A 2DJZA 3C95A 3I55T 4E47A 3CC4T 2R5MA 2XHCA 2ZPFB 2VXEA 4PJOG 3CCRA 3JRZA 3MP1A 5KE3A 5CKHA 1YJWA 2YHTA 1VQPT 3M53A 3P8HA 2KAFA 4TVRA 1WNLA 1Y96A 1VQ5T 5EG2A 4HT8A 1M1GA 4LD6A 3JCMd 2RM4A 1JJ2S 4XU1A 3FB9A 3JB9J 1Y7XA 1NPPA 2DKGA 2ZPHB 3C4SA 2JN0A 3LWIA 2GFUA 2EQJA 3QJYA 2LT4A 4HCZA 4JUVA 2D0QB 3RUXA 2LDMA 2QQBA 3X24B 1QP2A 4A4KA 3G6EA 1VQ8T 2OTLA 2QI2A 4IUQA 3FRNA 3CCRT 1XQHA 1S72T 4OVAA 3SDZA 3LGLA 5GMKj 4P5NA 3HRUA 2LRQA 4M77B 5A2QE 3A8OB 4PJOD 4X34A 2DVEA 2EJ9A 3I55A 4M75A 2IG0A 4M75E 4OGCA 3OYBA 1Q82U 3JAME 1EIFA 4MZMA 4M7DC 1VQLA 5FU6C 1I8FA 2KMTA 4OB3B 3FC3A 3MO8A 1H3ZA 4OF1A 2B8AA 1BI3A 3DKMA 3CPWA 2CZ6B 4C92E 5GMKm 3RMQA 3VUBA 3S6WA 2XD0A 2PVOB 5CQXA 3ZFJA 3JB9I 2A7YA 4J8OA 3HSBA 3VUZA 3CCEA 3S3OA 3FDRA 4ME7A 1B34A 2FL7A 4N0AA 2KK4A 3PTAA 2ZPEB 1BI0A 4X9CA 5GAOl 2EAYA 3OYKA 5GANf 2DEQA 2Y90A 4M7DA 4M75D 5KCHA 1V29B 1ZQ1A 2LX9A 2XICA 4M77F 3VJPA 4BUGA 3I56A 2FHDA 5GAOp 4JRKA 2EYQA 2EJGA 3RKWA 2PVDB 3OYJA 5HK3A 1M8VA 5CKFA 5LJ5d 3HKSA 3FEOA 2X4YA 3OB9A 4QQ6A 4UC4A 2RH2A 5HY6A 2MI6A 1VIEA 2XI9A 4EMKB 3OA6A 1KQSS 4ZGDB 3OMGA 4EMHA 3EAEA 5KE2A 1S72A 3JCMQ 3S3NA 3L2UA 3BW1A 1D3BB 1VQNA 3JCMV 4HA8A 1XNIA 1WPYA 2G3RA 3VV0A 2CYZB 1M90C 1JJ2A 2V8IA 3L42A 1G5VA 4JLGA 2JNGA 4E7IA 1WQ7A 1U1TA 3OBYA 4A4GA 4PJOC 5LJ5e 1UGPB 4HKEA 1K9MU 4M78C 4XTXA 3BDUA 1NJIU 2FVUA 2AHJB 1G3WA 1UB4A 4F7UB 3GPLA 3CCMT 3N5BB 5CIUA 5GMKi 2CKKA 3CCUT 3OYFA 3CBPA 2EQMA 2MWOA 3CPFA 5GAN7 4XTYA 2HAXA 5GAOq 3AHUA 1LJOA 4LDWA 2PQWA 5CQYA 4C0DC 3PT9A 1VQ7A 1Q81U 3CC2A 3OYDA 2RHYA 2HQEA 2M1HA 4A4FA 2DTOA 3CCVA 2RHIA 3RESA 4C5GA 2MWPA 2RJCA 4QW2A 3V7RA 2CZ0B 2NLUA 2X35A 1VQKT 2OAUA 4M75F 4IUVA 4C5IA 4M7AA 4QVCA 2DTIA 3CBOA 4C92C 2XG8D 1OZ3A 3PNWC 2GF7A 4YTLA 4C92B 1I5LA 4IKFA 4FT2A 3MHXA 4ELZC 4CRIA 2XDBA 1YI2A 2V8JA 4JS5A 5GANd 3RERA 4PJOA 5LJ5h 2O01E 5GAN4 2K5LA 3M54A 3A8HB 2PUOB 2RHZA 3LYIA 2ZCFB 4M7DF 1XTDA 1KHCA 4NOYA 1VQ6A 1X6OA 4CI0C 1JRIA 1YJNA 3OY9A 2QDYB 2QA4A 1M1KU 2F5KA 4IURA 5I2MA 4M75B 1UGSB 2RJDA 4Y28E 5D6WA 2YRVA 4ZGJB 5CR2A 4JJNK 1BIBA 1YHQT 2JOYA 2L3RA 1N9SA 2FB7A 2HD0A 3OQ5A 2ZPIB 3H8ZA 3C94A 2DZCA 2VGMA 3OYEA 3L2RA 4M77E 3X26B 2P0PA 3R6OA 1MGQA 3G6ET 1VQ8A 4RMOA 4FSXA 2P0QA 1Q86U 3CCJT 3TREA 5GAN5 3OS1A 2D9TA 3QPHA 3A8GB 4C8QD 4N4IA 5GAOn 3CMEA 3HP9A 5LJ5g 1PSFA 3E9FA 5GAN8 3CMAA 3DB4A 1VIFA 5LJ3d 1M1KC 3O8VA 4BDYA 3SWNA 5KCOA 4EMKC 1Y07A 4NL2A 4E7KA 4ATOA 1B34B 2LVMA 1KC8C 5CK9A 1Q7YC 3OMCA 4FL6A 1LNXA 1SSFA 4J6WA 2E64A 3JB9D 4ZGEB 2A3LA 5J26A 1TH7A 5GAOm 3ME9A 2RK2A 3CD6A 5FRNA 2WSEE 4C5EA 4QQDA 1NE8A 3BFMA 2R5AA 1FWZA 2R57A 2DPPB 2XDPA 4HCCA 2K4YA 5GAN6 4BE1A 2DTHA 4OGEA 3UPUA 5CO7A 4C0ZA 3PMIA 4ZTJA 3G4ST 2E10A 3WVEB 4EPCA 4KUDK 1YBYA 4F7UG 3LWHA 1YI2T 2C06A 4MMKA 3A8LB 3QHSA 2DXTA 4BI8B 4J6XA 4XTZA 1Q82C 3CC7T 4L5GA 3T9NA 3CMET 1N8RU 2X4XA 2RI5A 3QKJA 4LDUA 5M9OA 3INZA 3OYIA 5LJ5j 3L1AA 5HKCA 2O4XA 3SWNC 1BYMA 2WSFE 3QZ9B 3QJ6A 1W2BA 2E6ZA 3E9GA 4F7UA 4M7AD 2YLCA 3QG1A 1Q86C 4M77A 1VQ7T 4LDYA 1H641 2GQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MMP A; 
#chains in the Genus database with same CATH topology
 4K11 A;  2JZ2 A;  4C0G A;  4BI4 A;  4E6R A;  2A08 A;  2CZ7 B;  2JUF A;  1K9M R;  1YCS B;  2CT3 A;  2E5Q A;  3ZBD A;  1N8R C;  5LJ3 h;  4M7D E;  4N0A C;  2FEI A;  1N9R A;  4E7Z A;  4E7H A;  1VQO Q;  3I5R A;  1OPK A;  3RNJ A;  4MZP A;  1NEG A;  4M7A B;  3CCE Q;  3JSC A;  5CKD A;  3G7Z A;  2Y4Y A;  1WXT A;  4V2S A;  4J7F A;  3J7A F;  4XTU A;  4PJO F;  1B3Q A;  2DEU A;  2EGE A;  4JPB W;  3CCQ A;  1OU8 A;  2HQX A;  2VC8 A;  4QQG A;  4F17 A;  2AZS A;  4L59 A;  4OB2 B;  3QBY A;  3CCM A;  2RHU A;  2VKN A;  1SHF A;  1M3A A;  2ZPG B;  1U8R A;  1K0X A;  2EQU A;  4OP0 A;  3MCA B;  1WHJ A;  4O6J A;  2YRC A;  4RTT A;  2ESW A;  2SRC A;  2J05 A;  1NLO C;  3I35 A;  2CSQ A;  1M3B A;  2NUT B;  3THK A;  1WX6 A;  2DIG A;  4RKU E;  3CC4 A;  1M4Z A;  5CVI A;  2K2V A;  3VS4 A;  2P4T A;  3CCL Q;  1BCO A;  1D1B A;  2EYY A;  2HNI A;  1YIJ Q;  4Z8A A;  3I5S A;  3V8L A;  1PHT A;  2BE7 D;  1UFF A;  2I0N A;  1Y96 B;  4QVD A;  1VQ4 A;  3HHT B;  2RJE A;  4M7A C;  2JVV A;  4D8K A;  4GY5 A;  1YI2 Q;  2GQI A;  3JB9 G;  4L6V 5;  1YJ9 A;  2E5K A;  4LDV A;  3G4S A;  3A8M B;  1OZ2 A;  2K57 A;  4X1V A;  2ABL A;  3OYA A;  2CDT A;  2XID A;  4XTW A;  3M58 A;  5KYX A;  3OW2 S;  1NJI C;  1Z9Z A;  1VQ8 Q;  4Z89 A;  1B07 A;  2L5Q A;  5FU6 B;  1N6A A;  2JTM A;  3FLG A;  3R6N A;  3FIF A;  1TUG B;  1Y0M A;  5IHN A;  2FZC B;  5IAY A;  1QW1 A;  3NTI A;  1WGS A;  4C5H A;  1PCX A;  3SEM A;  5I2S A;  4BAC A;  2VUB A;  2QEX A;  1ZBX A;  2HZY A;  1TU0 B;  1O9S A;  2DET A;  4OMQ A;  5ECA A;  1AHJ B;  1RL2 A;  2KI7 A;  4MDX A;  2BE9 B;  4RCB A;  5GAM j;  3ZEH A;  2P0K A;  1JB0 E;  2DIL A;  1D1C A;  1M3C A;  4WF2 A;  1YIT A;  1K8A C;  1KQS P;  4ELY C;  1T0H A;  1TWB A;  1U5S A;  3OSV A;  3LW5 E;  2O4X B;  4JDS A;  3P8D A;  4FYY B;  1NYF A;  3EFO A;  2YUP A;  1Q81 R;  2HL5 C;  2DLP A;  1WJS A;  2D6F A;  1M1F A;  4NS5 A;  2A37 A;  5A0D A;  2QEX T;  4LDX A;  2DZ9 A;  4XQ3 A;  2XKO C;  2DMO A;  4M7D G;  1NLP C;  3JCM X;  1QVF A;  1QCN A;  1RAH B;  3JCM f;  5A0L A;  3EG2 A;  2AKK A;  2ED1 A;  2DRM A;  2E1H A;  2YDL A;  5IHK A;  1VQO T;  2DNU A;  4M78 F;  3CCJ Q;  3JCM W;  1RAA B;  4R0K A;  2L3P A;  3VRY A;  1YIJ T;  3MEA A;  2E65 A;  5IHI A;  1OV3 A;  4LD9 K;  3M5A A;  1K8A U;  5D6Y A;  1MHN A;  2DIQ A;  4D6W A;  3JCM P;  4F7U E;  2LTO A;  2MPX C;  1QKW A;  1VUB A;  3LH0 A;  4LXC A;  1RAC B;  1VQM A;  1UUE A;  4JRI A;  2KRM A;  4RTV A;  4XU0 A;  4JJC A;  2OTJ T;  4IUT A;  3H9N A;  1FMW A;  1QVG A;  1LPL A;  4FSS A;  1WFW A;  1QVG P;  4FCY A;  2PNI A;  5FRO A;  3URG A;  2EBP A;  1UEB A;  4PKC C;  3UT1 A;  2V8K A;  3JB9 F;  2J6O A;  3EG9 B;  3OSS C;  5GMK l;  4CC3 A;  2ROT A;  3CD6 T;  3I55 T;  1AWX A;  3MP1 A;  2VVK A;  2F2W A;  3P8H A;  4TVR A;  3EGD A;  4IKF A;  2EGA A;  3X24 B;  2QQB A;  3G6E A;  1VQ8 T;  4M7D C;  4IUQ A;  2QGF B;  2RQR A;  1E6G A;  4PJO D;  1GCQ A;  3NHN A;  1EIF A;  4MZM A;  2LJ1 A;  1I8F A;  1KSW A;  1WYX A;  1TUD A;  3MO8 A;  2B8A A;  3DKM A;  3CPW A;  3GBQ A;  3RMQ A;  3S6W A;  5CQX A;  4AMC A;  3JB9 I;  4RUG A;  2M51 A;  2A7Y A;  3HSB A;  2NUP B;  2B86 A;  2FL7 A;  4N0A A;  4AFU C;  2KK4 A;  1MMA A;  5GAO l;  3I56 Q;  2M0Y A;  4HCC A;  1M27 C;  1V29 B;  5HCK A;  4CC2 A;  1KD1 R;  3OYJ A;  5CKF A;  3OB9 A;  1Q82 R;  1VIE A;  4EMK B;  3OMG A;  2RQW A;  3EGX B;  4EMH A;  3S3N A;  3L2U A;  3BW1 A;  2DVJ A;  1VQN A;  3JCM V;  1XNI A;  3A98 A;  3L42 A;  2JNG A;  2V26 A;  1WQ7 A;  2DBM A;  4XTX A;  2RMO A;  2AHJ B;  1G3W A;  3CCM T;  3GPL A;  2CKK A;  3CCU T;  2QAS A;  3OYF A;  3CBP A;  1UHC A;  2HAX A;  2OAW A;  1SRM A;  4LDW A;  3QWX X;  2LQW A;  2W10 A;  2COW A;  4OMM A;  2F2X A;  1H92 A;  4QW2 A;  2CZ0 B;  2HKQ B;  2X35 A;  2K3B A;  2OAU A;  4IUV A;  4QVC A;  1NM7 A;  2DTI A;  4C92 C;  1I5L A;  4ANJ A;  2XDB A;  4CRI A;  1YI2 A;  4JS5 A;  5GAN d;  4PJO A;  2O01 E;  1IGU A;  2RHZ A;  2A36 A;  4HXJ A;  1XTD A;  1BBZ A;  3OY9 A;  1HSQ A;  3REB B;  2QA4 A;  5I2M A;  4Y28 E;  5D6W A;  2YT6 A;  2YRV A;  5CR2 A;  1WIE A;  3TSW A;  2ZPI B;  3H8Z A;  2VGM A;  3L2R A;  3X26 B;  4AT1 B;  3G6E T;  1CKA A;  1VQ8 A;  4RMO A;  3CME Q;  3A8G B;  2J6K A;  1EX4 A;  3HP9 A;  5LJ5 g;  3NGP A;  1M1K C;  1IB8 A;  4OMN A;  3EH2 A;  1Y07 A;  1AOJ A;  1G8X A;  2LVM A;  4FL6 A;  1RAI B;  4J6W A;  2K9G A;  4FYW B;  5D7U A;  1NE8 A;  2R5A A;  1W6X A;  4IIO A;  1G2B A;  4C0Z A;  4FYV B;  4EPC A;  2L3S A;  2C06 A;  4MMK A;  3QHS A;  4Y92 A;  2DFU A;  1VOM A;  4BI8 B;  4KGZ B;  2ROL A;  2E4H A;  1Q82 C;  5M9O A;  3L1A A;  5HKC A;  2PTK A;  4D8D A;  3E9G A;  4F7U A;  3G71 Q;  1W2B A;  2Z0W A;  1Q86 C;  4M77 A;  3LH5 A;  1QCO A;  2GQV A;  1WXB A;  2EKO A;  1OX8 A;  4LNP A;  1YJN T;  3F70 A;  2QA4 T;  1M8M A;  2IVW A;  2KVQ G;  3QDF A;  3QYG B;  1T0J A;  1X43 A;  1RI0 A;  4RG2 A;  1K4U S;  1VQO A;  4FT4 A;  4JRQ A;  2DL4 A;  4A53 A;  2EPD A;  4QKU A;  1OPL A;  1X6B A;  1K73 R;  2QQ9 A;  4EDU A;  1X6G A;  5GAN 3;  2DER A;  4MZT A;  2DXB A;  3QXE B;  2XMF A;  2JW4 A;  1KQ2 A;  4IUU A;  3G1J A;  3GNF B;  5LJ5 f;  2M9U A;  1HK9 A;  5I21 A;  1MUZ A;  2P4R A;  4A54 A;  4KGX B;  2MYS A;  2RF0 A;  4C8Q C;  2IPO B;  5IT9 E;  5D6X A;  3JCM c;  3RBB B;  2LC4 A;  4M7A E;  3CCS A;  2HBW A;  3CCV T;  2F69 A;  2M0O A;  2HEQ A;  5KYU B;  1UE9 A;  1Y57 A;  3CC4 Q;  2X3W D;  1KQ1 A;  4CC7 A;  4BY6 B;  1MV3 A;  3CCL A;  2QQA A;  3UWN A;  2VGN A;  2DXC A;  3I56 T;  2FYK A;  1J3T A;  4JS4 A;  3MP8 A;  1WQW A;  5FW9 A;  4M78 G;  4M77 D;  1KJW A;  1NBE B;  2KRN A;  1PSE A;  2FPE A;  5IXF A;  3NTH A;  1W2B S;  2CP0 A;  1D0Z A;  3RDV A;  4PJL A;  5KYW A;  1YJ9 Q;  3OYG A;  2HBP A;  1I4K 1;  3PMT A;  2JTE A;  5FU7 C;  3CQT A;  1C6V X;  4C8Q E;  3M0P A;  4C92 D;  1JU5 C;  1YNZ A;  3CCL T;  3E19 A;  2CRE A;  2GTO A;  3OYY A;  1C0M A;  2KRS A;  3QII A;  2VB6 A;  1AEY A;  3L2Z A;  2OTL T;  4EMG A;  3VYG A;  1G83 A;  1VQM T;  3CCU Q;  4II1 A;  5A0G A;  1G3T A;  3QUI A;  5GMK e;  5EC7 A;  3VU3 C;  5I22 A;  1JQQ A;  4DEY A;  2EFI A;  2QQS A;  1QWF A;  3MEW A;  1NYG A;  2RI3 A;  3H0F A;  3SWN B;  4M7D B;  4NL3 A;  4DOW A;  2RK1 A;  5GMK h;  3CXC A;  2Y4X A;  4KBM B;  5GAM f;  1AD5 A;  5GAM h;  3CD6 Q;  4N4G A;  2K7A A;  1KD1 U;  2XU8 A;  2BZX A;  3RMS A;  1BKB A;  3HL8 A;  1UDL A;  2BIV A;  3M4G A;  3VS5 A;  1YIT Q;  2M16 A;  7AT1 B;  1NPR A;  3QSU A;  4J9H A;  2KXD A;  2VYT A;  2BKD N;  1W2B P;  2KSS A;  1TUC A;  4OB0 B;  2BUD A;  3CCQ T;  3GNG A;  4BY6 C;  3LX7 A;  4M75 G;  2YWW A;  1X2Q A;  1M90 U;  3UAT A;  4J5Y A;  5LJ3 g;  4M78 D;  4M77 G;  2CP6 A;  4Z02 A;  3PIP A;  2KR3 A;  3M9Q A;  1AWO A;  4CC4 B;  4PL6 A;  1KD1 C;  2V1R A;  2FPD A;  3J81 E;  3CMA T;  2EJF A;  2ENM A;  4PLL A;  1UGQ B;  1W4S A;  2J7I A;  4FM4 B;  2HDA A;  4X9D A;  4BI3 A;  1T3L A;  4BE2 A;  1VQP A;  3OS0 A;  3OYL A;  3VS6 A;  3EH1 A;  3E2U A;  2DO3 A;  1MMN A;  5FWB A;  2KRO A;  2OTJ Q;  5KYX B;  2OTJ A;  2HSP A;  2KE9 A;  4N4H A;  1UEC A;  2CP7 A;  4LE9 A;  4C0D B;  1X75 C;  2AZV A;  3Q1J A;  5J3B A;  1IRX A;  1VQ9 Q;  2RJF A;  2YUN A;  3QO3 A;  1Q7Y R;  5CKB A;  2GBQ A;  3KBG A;  3H6Z A;  3AT1 B;  2LMJ A;  4ZN1 A;  1EZZ B;  2YLB A;  4M78 B;  1AWW A;  3CXC P;  2EIF A;  1KK7 A;  1GCP A;  2MAM A;  4J9E A;  4E7L A;  2JS2 A;  1M2V A;  1UJY A;  5FWC A;  2O9V A;  2XHC A;  1H8K A;  1SEM A;  4PJO G;  3CCR A;  3JRZ A;  5KE3 A;  2KYM A;  1M1K R;  1VQ4 Q;  1WNL A;  4HT8 A;  1YFN A;  1JJ2 S;  4ZTF A;  1X27 A;  2JN0 A;  2GFU A;  2D0Q B;  4A4K A;  3FRN A;  1XQH A;  1S72 T;  3SDZ A;  1ZSZ A;  4GLM A;  3HRU A;  2LRQ A;  1KFZ A;  3A8O B;  1MV0 B;  1YN8 A;  2EJ9 A;  3I55 A;  4F14 A;  4WTO B;  4M75 A;  2D8H A;  2IG0 A;  4M75 E;  3I55 Q;  1A0N B;  4PK4 A;  1VQL A;  1BCM A;  5FU6 C;  1F1B B;  2KMT A;  1BI3 A;  2QTV A;  1I0C A;  4C92 E;  5GMK m;  3VUB A;  2BTT A;  2YUO A;  4ME7 A;  1B34 A;  2ZAE A;  2ZPE B;  2K79 A;  1BI0 A;  1PG5 B;  5GAN f;  1FMK A;  1ZUY A;  2DEQ A;  2DF6 A;  1ZQ1 A;  2XIC A;  4M77 F;  4F04 B;  4BUG A;  2FHD A;  3NMZ C;  1M8V A;  3HKS A;  4DEX A;  2X4Y A;  1IHV A;  2XI9 A;  4PFP A;  4ZGD B;  4F16 A;  2RPN A;  3MPU B;  1D3B B;  1AT1 B;  4HA8 A;  1TTH B;  1WPY A;  4JLG A;  2DL8 A;  4PJO C;  4M78 C;  1WHK A;  3BDU A;  1UHF A;  1UB4 A;  5GMK i;  2SEM A;  2EQM A;  2LQN A;  3CPF A;  2LJ0 A;  4XTY A;  4PJM A;  3AHU A;  5CQY A;  2AIR B;  2PQW A;  3CC2 Q;  1VQ7 A;  2P84 A;  3EHR A;  3EG9 A;  1Q81 U;  3CC2 A;  1X69 A;  2DL7 A;  3CCV A;  3RES A;  3QWY A;  4C5G A;  4HVU A;  3V7R A;  2O9S A;  4Z88 A;  4C5I A;  3CBO A;  3EGD B;  1OZ3 A;  1SF9 A;  2GF7 A;  2O31 A;  3PNW C;  5LJ5 h;  3O5Z A;  1E6H A;  3M54 A;  2LNH B;  2ZCF B;  4M7D F;  1KHC A;  4NOY A;  1UTI A;  2F5K A;  4IUR A;  1ZSG A;  4JJN K;  1YHQ T;  2JOY A;  3OQ5 A;  2FB7 A;  4DBH A;  1WHM A;  1RAB B;  3C94 A;  2DZC A;  1TSF A;  2P0P A;  3R6O A;  1MGQ A;  4FSX A;  1WLP B;  2P0Q A;  3TRE A;  3OS1 A;  4C8Q D;  3CME A;  3SHW A;  2H3E B;  5LJ3 d;  1VQM Q;  3UA6 A;  2NUP A;  4RTU A;  1ZUK A;  3UA7 A;  1KC8 C;  5CK9 A;  3JB9 D;  2IIM A;  2QYZ A;  5FRN A;  2CH4 A;  3BFM A;  4AG1 C;  4J9D A;  1Z9Q A;  2FZG B;  4OGE A;  3UPU A;  5CO7 A;  3PMI A;  3WVE B;  4KUD K;  2CUB A;  1GRI A;  3A8L B;  1GL5 A;  2X51 A;  4J6X A;  3CC7 T;  4L5G A;  1K1Z A;  4LDU A;  1NEB A;  2O4X A;  3SWN C;  3QZ9 B;  1IO6 A;  4M7A D;  3QG1 A;  4J9F A;  1VQ7 T;  4LDY A;  1LOJ A;  4E2F B;  4OMP A;  1GFD A;  2K5F A;  4FW1 A;  5CKE A;  2COY A;  3DB3 A;  3X28 B;  4C8Q A;  1B7T A;  1FX7 A;  4QVZ A;  4IUP A;  4PNO A;  2AKL A;  4J9C A;  3DLL A;  1RAE B;  3VS2 A;  2GFA A;  1QVG S;  4XK8 E;  1M5Q 1;  3V7S A;  1I07 A;  2O2O A;  3MKD A;  5KYY B;  2LNV A;  2LCL A;  1VQK Q;  5FRM A;  5DY9 A;  2PZ1 A;  1VQK A;  3NTK A;  5GAO r;  3EFS A;  2DX1 A;  2EQI A;  4C8Q G;  2NUZ A;  4O5V A;  4OMF B;  1YJ9 T;  2H3J A;  1V76 A;  1S72 Q;  1N27 A;  2RI2 A;  2K3Y A;  5AYF A;  1K73 U;  2DA9 A;  4RTX A;  2KDS A;  2ZPB B;  1M9S A;  2ECZ A;  2QQR A;  4QT7 A;  1YP5 A;  1BI1 A;  1FYN A;  1EFN A;  1OX9 A;  3M56 A;  4MDW A;  4ORZ A;  3TEE A;  3A5Z B;  1PD1 A;  1RAG B;  3OYN A;  4DBF A;  2DK3 A;  2E70 A;  1NZ9 A;  2GGR A;  3M57 A;  4DOV A;  2I2L A;  1QQJ A;  1JBM A;  2CZ1 B;  2JM8 A;  1TXQ A;  5IH2 A;  2KT8 A;  4C92 G;  5GJW B;  2VWF A;  2COZ A;  3CCS T;  3OS5 A;  4M7A G;  1K76 A;  1OEB A;  4JZ4 A;  3UDC A;  3V8K A;  2EWN A;  2GNC A;  4M75 C;  3VS3 A;  1GBQ A;  3M0Q A;  4C92 A;  3GIB A;  1WHH A;  1LCK A;  1Q81 C;  2YRD A;  1RI9 A;  2RD1 A;  2OTL Q;  3QYH B;  1Q86 R;  4XTV A;  2D0N A;  2EYZ A;  2CP2 A;  2XDD A;  3GOX A;  1KG1 A;  5CCA A;  1VA7 A;  5DLQ E;  1VQL Q;  4BD3 A;  3SB2 A;  4AFQ C;  1QP3 A;  3CCU A;  1WXU A;  2F1L A;  3WXM B;  4M78 E;  3EHQ A;  5GAN 2;  4R56 A;  4PJO E;  2G6F X;  4JZ3 A;  1R8O B;  2LT1 A;  4HCB A;  3JCM b;  1BU1 A;  4RTY A;  2HL3 A;  5KYN A;  1WZO A;  1U1S A;  3JCM h;  3EG3 A;  1I81 A;  2CGH A;  4F7U F;  3SFM A;  2YUQ A;  3JCM e;  1V1C A;  3KUF A;  4B9W A;  2CS7 A;  4EMK A;  2BZ8 A;  1G3Y A;  1WA7 A;  3TU4 K;  3OYH A;  1OU9 A;  5KH6 A;  1KHI A;  1SHG A;  1ZHI A;  1G3S A;  2LCS A;  1NJI R;  4A4E A;  1QWE A;  3HFO A;  5CAI A;  5J39 A;  4RG8 A;  4IIM A;  4BB7 A;  4JJB A;  3V8J A;  4PJN A;  3G71 A;  2W0Z A;  2E3I A;  2F5T X;  3H0I A;  1VQL T;  2MF2 A;  4M77 C;  3JCM g;  4Y91 A;  1IZ6 A;  1W70 A;  2C0I A;  1KC8 R;  2CUD A;  1Q7Y U;  1R0C B;  1PC0 A;  2X4J A;  1JEG A;  2DAQ A;  1ZA1 B;  2PUK B;  1OYX A;  2EQK A;  1JXM A;  3DLM A;  1ZX6 A;  1H3H A;  2WSC E;  3CEY A;  3JB9 H;  5GAM g;  4PJO B;  1Y71 A;  1YJW T;  3CCJ A;  1CSK A;  1X01 A;  4R55 A;  4PFO A;  4RCC A;  3BE3 A;  1VQP Q;  2QTX A;  1RLQ C;  1WJR A;  4XU2 A;  5DM7 R;  1SG5 A;  4DQ2 A;  2PVG B;  3CCQ Q;  3OS2 A;  1YCY A;  3ASK A;  1TOV A;  2E41 A;  2PU9 B;  4KUI A;  3OYM A;  2VAS A;  3E1S A;  1M2O A;  4OML A;  3OYC A;  3M59 A;  3TVT A;  3PFS A;  5L23 A;  4PFZ A;  1CKB A;  5FU7 B;  3CCE T;  2L3Q A;  2X9H A;  3CCS Q;  5GAM e;  3NPF A;  1WDX A;  2JTF A;  2DL3 A;  2K6D A;  1AZE A;  1ABO A;  2NUT A;  2VV5 A;  1OUL A;  3CC2 T;  4GBQ A;  2HMA A;  1YHQ A;  3GLX A;  4A4H A;  4DA4 A;  2E12 A;  3CC4 T;  3CCR Q;  2CSI A;  2ZPF B;  1BB9 A;  2YHT A;  2CP3 A;  3M53 A;  1Y96 A;  2D8J A;  2AK5 A;  1PWT A;  2RNA A;  4XU1 A;  1Y7X A;  2DKG A;  3LWI A;  3QJY A;  4HCZ A;  3RUX A;  1U3O A;  3VS7 A;  2NYS A;  3G6E Q;  3LGL A;  4P5N A;  1I1J A;  4M77 B;  2DVE A;  3IQL A;  2EYW A;  4OGC A;  1Q82 U;  1WHL A;  3FC3 A;  4B6M A;  2C0T A;  1AZG B;  2XD0 A;  2FPF A;  2DM1 A;  2PVO B;  1K9A A;  4J8O A;  4ESR A;  3VUZ A;  3S3O A;  3FDR A;  3PTA A;  1QVF P;  3MJX A;  3U23 A;  2QK0 A;  3I56 A;  2LX9 A;  3M0U A;  3VJP A;  2EYX A;  2QDL A;  5GAO p;  2EYQ A;  2EJG A;  2PVD B;  1PKT A;  4KH1 B;  4QQ6 A;  2RH2 A;  5HY6 A;  4ZNX A;  3OA6 A;  2DE0 X;  1VYV A;  4WCI A;  3ZL7 C;  4FYX B;  3EAE A;  5KE2 A;  3JCM Q;  1BK2 A;  2A0F B;  2G3R A;  2V8I A;  1D1A A;  4E7I A;  1U1T A;  1UJ0 A;  4A4G A;  5LJ5 e;  1R0B G;  4HKE A;  1K9M U;  1AWJ A;  4AFS C;  4AG2 C;  2H8H A;  4KH0 B;  4HVV A;  5GAO q;  4C0D C;  1M2V B;  2HQE A;  1PRL C;  2DTO A;  2RJC A;  3CCV Q;  2NLU A;  2JMC A;  1VQK T;  1PKS A;  2L0A A;  4M7A A;  2XG8 D;  5KYW B;  1ACM B;  3RER A;  4EIK A;  2O88 A;  5GAN 4;  2DYI A;  3LYI A;  1VQ6 Q;  3VS0 A;  5AT1 B;  1X6O A;  2QDY B;  4E7S A;  4M75 B;  2C0O A;  3PVQ A;  1BIB A;  1N9S A;  2HD0 A;  2X3X D;  3M0R A;  2JT4 A;  3EG1 A;  1PRM C;  3CCJ T;  2D9T A;  3QPH A;  5GAO n;  4N4I A;  1MNE A;  1LVK A;  3A1P A;  1PSF A;  5GAN 8;  4PJJ A;  2MCN A;  3O8V A;  4BDY A;  3SWN A;  5KCO A;  4EMK C;  4ATO A;  1B34 B;  2A28 A;  2YXY A;  1Q7Y C;  3OMC A;  1LNX A;  1SSF A;  1VQ5 Q;  4ZGE B;  2A3L A;  2KEA A;  2RK2 A;  2WSE E;  1ZLM A;  2EW3 A;  4QQD A;  3RR6 A;  5GAN 6;  4BE1 A;  2E10 A;  1YBY A;  2DJQ A;  3LWH A;  1YI2 T;  1IGQ A;  1KIK A;  2DXT A;  2GTJ A;  2RQT A;  4XTZ A;  3HTR A;  1WHG A;  3JV3 A;  3T9N A;  1N8R U;  2X4X A;  5LJ5 j;  1OOT A;  1BYM A;  2YLC A;  1IHW A;  2CT4 A;  2EQJ A;  4J9I A;  2E6N A;  2WAC A;  2FO0 A;  2JJ9 A;  5IN1 A;  1QMC A;  3QDR B;  2OI3 A;  1KC8 U;  1U06 A;  5L8R E;  3PIO A;  4MML A;  2XK0 A;  1UGR B;  8AT1 B;  3WVD B;  2RB6 A;  1GFC A;  5GAM d;  2ZZD A;  3FJ5 A;  3BY7 A;  4E7J A;  1QVP A;  3MEU A;  2NWM A;  2JM9 A;  5LL6 S;  2YSQ A;  2EVR A;  1QVF S;  1W1F A;  2ZGW A;  3RKY A;  1VQ5 T;  1D0Y A;  3HPW A;  3CCM Q;  4XU3 A;  3KXT A;  1PD0 A;  1ZBJ A;  4BE0 A;  3EGX A;  1UG1 A;  1OI1 A;  1SKU B;  3GP8 A;  2K5I A;  5LJ3 f;  3BDL A;  1C1A A;  4XAX B;  2MOX A;  3MP6 A;  3S3M A;  3CPW S;  3TQ7 P;  4M78 A;  5GAN g;  3EFO B;  2J6F A;  1D0X A;  2QXF A;  4B9X A;  2LQ8 A;  3RKX A;  5C0M A;  3H0H A;  2FG0 A;  4OB1 B;  4BDZ A;  2VXF A;  1SRL A;  1TS9 A;  4J6Y A;  3CC7 A;  2RQV A;  3RIR A;  1N8R R;  2LQK A;  2F2V A;  2R58 A;  3P8B B;  1I5O B;  1XOV A;  2HSE B;  3VRZ A;  1HD3 A;  1RAF B;  4PLI A;  2FZK B;  1ZSZ B;  4OMO A;  5DLO A;  3M0S A;  1K73 C;  3ER0 A;  1BI2 A;  1WI7 A;  2K3X A;  3HRT A;  1QLY A;  2BZY A;  4JLI A;  5GAN j;  2DBK A;  3HRS A;  4FIB A;  4JRP A;  4C8Q B;  3EFR A;  3L2V A;  2DL5 A;  2DYB A;  1FMV A;  1N5Z A;  2OJ2 A;  4Q5W A;  2OX7 A;  2JS0 A;  5GJV B;  3CMA Q;  2FRW A;  4ZN3 A;  1MMD A;  1VQ4 T;  5KYY A;  1IRE B;  3X25 B;  2KT1 A;  3J80 E;  3L2W A;  2KY9 A;  2LCC A;  1R77 A;  2DRK A;  3OW2 A;  8ATC B;  2L8D A;  2RO0 A;  4M7A F;  3TSZ A;  3TCJ A;  2RA2 A;  2E3H A;  1PNJ A;  1VQ6 T;  1X2K A;  3OW2 P;  3M4Y A;  1O75 A;  3NFC A;  3REA B;  1QCF A;  4HT9 A;  1HJD A;  3V7C A;  1D3B A;  1DJ7 B;  4JJD A;  2L89 A;  3L2Q A;  1VQ9 T;  4LUE A;  1SSH A;  3HFN A;  2JMA A;  5GAN h;  2EKH A;  2KBT A;  2KNB B;  1KQS A;  5GAN e;  2KQW A;  2MMP A;  4FU6 A;  3JCM J;  3M55 A;  2DXU A;  2LX7 A;  5LJ3 e;  2X4W A;  1HXD A;  4LUD A;  3CBM A;  5IXB A;  2RHX A;  3LGF A;  2AT1 B;  3FJP A;  3VYH B;  3C12 A;  3PGG A;  2GCX A;  4C8Q F;  5I11 A;  1RAD B;  4M4Z A;  2D1X A;  3QZ5 B;  4FW2 A;  4GLK A;  3MEV A;  3OBW A;  5HK0 A;  4J9B A;  2ED0 A;  1VQN T;  1BIA A;  4C0F A;  2DD4 A;  4KT0 E;  2DD5 A;  4C92 F;  1WJQ A;  1VYT A;  4M7D D;  1PM3 A;  1YJN Q;  1K9M C;  1GXI E;  3MET A;  2QA4 Q;  1FXX A;  3EGU A;  3X20 B;  5C6S A;  2JXB A;  2HQH A;  4VUB A;  2ATC B;  1MMG A;  5LJ3 j;  1JJ2 P;  3G71 T;  3VKI A;  4J7I A;  1P92 A;  4J83 A;  1YIT T;  3LLR A;  1VQ9 A;  1VYU A;  2EGC A;  1VQ5 A;  3SD4 A;  1S1N A;  2RN8 A;  1YHQ Q;  3CXC S;  2V1Q A;  2LP5 A;  4KUL A;  5FLX E;  1YIJ A;  3GF5 A;  1GBR A;  2DJZ A;  3C95 A;  4E47 A;  1RLP C;  1YJW Q;  2R5M A;  2VXE A;  1UGV A;  3KFV A;  1YJW A;  5CKH A;  2LJ3 A;  2LZ6 B;  1VQP T;  4HVW A;  1TG0 A;  2KAF A;  2HCK A;  5EG2 A;  1M1G A;  4LD6 A;  3JCM d;  2RM4 A;  3I9Q A;  1HYO A;  3FB9 A;  3JB9 J;  1NPP A;  2ZPH B;  3C4S A;  2LT4 A;  2M02 A;  4JUV A;  2LDM A;  1QP2 A;  2OTL A;  2QI2 A;  3CCR T;  4OVA A;  5GMK j;  3G4S Q;  5A2Q E;  2K2M A;  4X34 A;  2HKN A;  4LN2 A;  3OYB A;  3JAM E;  3CPW P;  1NG2 A;  2KYB A;  4OB3 B;  1M30 A;  1H3Z A;  4OF1 A;  2CH4 W;  2J06 A;  1ZUU A;  2CZ6 B;  3ZFJ A;  4RTW A;  2FRY A;  3CCE A;  2KGT A;  3ULR B;  4J9G A;  2L2P A;  4X9C A;  2EAY A;  3OYK A;  2Y90 A;  4DBR A;  4M7D A;  4M75 D;  5KCH A;  4JRK A;  3RKW A;  5HK3 A;  2RQU A;  5LJ5 d;  1GCQ C;  3FEO A;  4UC4 A;  2MI6 A;  1KQS S;  1RUW A;  4A63 B;  6AT1 B;  1S72 A;  1ABQ A;  2QG9 B;  3M0T A;  3VV0 A;  1M90 C;  2CYZ B;  1JJ2 A;  1VQN Q;  1G5V A;  1OQK A;  3OBY A;  1UGP B;  1IXD A;  1NJI U;  2FVU A;  1M90 R;  4F7U B;  3N5B B;  5CIU A;  3UF4 A;  4AFZ C;  1K0S A;  1E7O A;  2MWO A;  5GAN 7;  1LJO A;  3PT9 A;  3D7S B;  3OYD A;  1VQ7 Q;  2RHY A;  4A4F A;  2M1H A;  2MIO A;  2RHI A;  2MWP A;  1SPK A;  1XJW B;  1Q95 G;  4M75 F;  4HCK A;  1AVZ C;  3CC7 Q;  1D09 B;  4YTL A;  4C92 B;  4FT2 A;  3MHX A;  4ELZ C;  4DBQ A;  2V8J A;  2K5L A;  3A8H B;  4KGV B;  2PUO B;  3C0C A;  1QKX A;  1VQ6 A;  4CI0 C;  1JRI A;  1YJN A;  1M1K U;  1UGS B;  2RJD A;  4ZGJ B;  2L3R A;  4RTZ A;  3OYE A;  4M77 E;  1YWP A;  1Q86 U;  5GAN 5;  2QGG A;  3E9F A;  3CMA A;  3DB4 A;  1VIF A;  2KXC A;  4E7K A;  4NL2 A;  2QAZ A;  1ARK A;  5KYU A;  2E64 A;  9ATC B;  5J26 A;  1K8A R;  1TH7 A;  5GAO m;  3ME9 A;  3CD6 A;  4C5E A;  2QEX Q;  3VS1 A;  1MND A;  1FWZ A;  2R57 A;  2DPP B;  4KRT A;  2XDP A;  2K4Y A;  1ZSZ C;  3PE0 A;  3EG0 A;  2DTH A;  4ZTJ A;  3G4S T;  1JXO A;  1YWO A;  4F7U G;  3H41 A;  2CP5 A;  2MK5 A;  1T3S A;  3CME T;  3OYI A;  2RI5 A;  3QKJ A;  3INZ A;  1ZA2 B;  1JO8 A;  2WSF E;  3QJ6 A;  2E6Z A;  3PVL A;  1H64 1; 
#chains in the Genus database with same CATH homology
 1LOJ A;  2EKO A;  2JZ2 A;  2E6N A;  2K5F A;  5CKE A;  4BI4 A;  2WAC A;  4C0G A;  1YJN T;  3DB3 A;  3X28 B;  4C8Q A;  2CZ7 B;  3F70 A;  2QA4 T;  1FX7 A;  2JUF A;  4IUP A;  2IVW A;  2KVQ G;  3QYG B;  2E5Q A;  4PNO A;  4QVZ A;  5IN1 A;  3ZBD A;  3DLL A;  3QDR B;  1N8R C;  4RG2 A;  1RI0 A;  1KC8 U;  5LJ3 h;  4M7D E;  4N0A C;  5L8R E;  1VQO A;  1N9R A;  2GFA A;  4FT4 A;  4E7H A;  3PIO A;  4MML A;  1QVG S;  4XK8 E;  1M5Q 1;  3V7S A;  4JRQ A;  2XK0 A;  4A53 A;  4MZP A;  4M7A B;  1UGR B;  2LNV A;  3JSC A;  2LCL A;  5FRM A;  2QQ9 A;  5DY9 A;  3WVD B;  5CKD A;  4EDU A;  1VQK A;  2RB6 A;  3G7Z A;  5GAN 3;  5GAM d;  2Y4Y A;  4MZT A;  2ZZD A;  2DXB A;  4V2S A;  3NTK A;  4J7F A;  5GAO r;  3J7A F;  3BY7 A;  3EFS A;  3QXE B;  4E7J A;  4XTU A;  1KQ2 A;  4IUU A;  1QVP A;  3GNF B;  3MEU A;  4PJO F;  5LJ5 f;  2M9U A;  1HK9 A;  5I21 A;  5LL6 S;  4A54 A;  4C8Q G;  1QVF S;  4O5V A;  3CCQ A;  2ZGW A;  3RKY A;  4C8Q C;  2HQX A;  2VC8 A;  3HPW A;  4OMF B;  4QQG A;  4XU3 A;  3KXT A;  5IT9 E;  2H3J A;  1YJ9 T;  4L59 A;  4OB2 B;  3QBY A;  3CCM A;  4BE0 A;  5D6X A;  1N27 A;  2RHU A;  2RI2 A;  2K3Y A;  5AYF A;  1K73 U;  3JCM c;  1OI1 A;  2KDS A;  2ZPB B;  2ZPG B;  3GP8 A;  1U8R A;  1M9S A;  2K5I A;  5LJ3 f;  2EQU A;  2LC4 A;  2QQR A;  3BDL A;  4OP0 A;  4M7A E;  3MCA B;  4O6J A;  4XAX B;  3CCS A;  1BI1 A;  3MP6 A;  3S3M A;  3CPW S;  4M78 A;  3CCV T;  2F69 A;  2M0O A;  5GAN g;  3M56 A;  4MDW A;  3TEE A;  2DIG A;  3A5Z B;  4RKU E;  3CC4 A;  1KQ1 A;  1M4Z A;  2QXF A;  5CVI A;  4B9X A;  3OYN A;  4BY6 B;  2K2V A;  2P4T A;  2DK3 A;  2E70 A;  1NZ9 A;  2LQ8 A;  2HNI A;  3M57 A;  3RKX A;  4DOV A;  5C0M A;  2QQA A;  2I2L A;  4OB1 B;  1JBM A;  2CZ1 B;  3UWN A;  3CCL A;  2VGN A;  2DXC A;  4BDZ A;  2VXF A;  3V8L A;  3I56 T;  2FYK A;  4C92 G;  1Y96 B;  3MP8 A;  4JS4 A;  1WQW A;  4QVD A;  1VQ4 A;  3HHT B;  4J6Y A;  4M78 G;  3OS5 A;  4M77 D;  3CC7 A;  3RIR A;  3CCS T;  4M7A G;  2LQK A;  2R58 A;  3P8B B;  1PSE A;  2RJE A;  1W2B S;  1XOV A;  3NTH A;  3UDC A;  3V8K A;  2JVV A;  4M7A C;  2EWN A;  4GY5 A;  4M75 C;  3GIB A;  4C92 A;  3JB9 G;  4PLI A;  3OYG A;  1Q81 C;  2HBP A;  4L6V 5;  2RD1 A;  1YJ9 A;  1I4K 1;  3QYH B;  3PMT A;  5DLO A;  4LDV A;  4XTV A;  5FU7 C;  3G4S A;  3A8M B;  1K73 C;  3ER0 A;  1BI2 A;  4C8Q E;  3HRT A;  2K3X A;  4C92 D;  1OZ2 A;  2K57 A;  2XDD A;  4JLI A;  3CCL T;  5GAN j;  3E19 A;  3HRS A;  4FIB A;  3GOX A;  1KG1 A;  5CCA A;  4JRP A;  3OYY A;  2XID A;  3OYA A;  4XTW A;  3M58 A;  5DLQ E;  3EFR A;  4C8Q B;  4BD3 A;  3OW2 S;  3L2V A;  3QII A;  1NJI C;  3SB2 A;  1QP3 A;  3CCU A;  3L2Z A;  2L5Q A;  5FU6 B;  2OTL T;  3WXM B;  4EMG A;  3VYG A;  1VQM T;  4M78 E;  1N6A A;  5GAN 2;  4R56 A;  4Q5W A;  4PJO E;  2JTM A;  3FLG A;  4II1 A;  5A0G A;  3FIF A;  1G3T A;  3QUI A;  4ZN3 A;  5GMK e;  1R8O B;  2LT1 A;  3VU3 C;  1VQ4 T;  3JCM b;  4HCB A;  1IRE B;  3X25 B;  2EFI A;  2QQS A;  3MEW A;  5IAY A;  3J80 E;  1QW1 A;  2RI3 A;  3NTI A;  3SWN B;  3L2W A;  2KY9 A;  4NL3 A;  1U1S A;  1WGS A;  4DOW A;  2LCC A;  4M7D B;  3JCM h;  2RK1 A;  4C5H A;  5GMK h;  3CXC A;  2Y4X A;  4KBM B;  1I81 A;  2CGH A;  4F7U F;  5GAM f;  5I2S A;  4BAC A;  5GAM h;  3OW2 A;  2VUB A;  2QEX A;  4N4G A;  2L8D A;  2RO0 A;  3SFM A;  4M7A F;  3TCJ A;  4B9W A;  2RA2 A;  3KUF A;  3JCM e;  2CS7 A;  4EMK A;  1KD1 U;  1ZBX A;  1VQ6 T;  1O9S A;  1G3Y A;  2XU8 A;  3M4Y A;  1O75 A;  3NFC A;  1AHJ B;  3RMS A;  3TU4 K;  1BKB A;  1RL2 A;  4HT9 A;  4MDX A;  3HL8 A;  3OYH A;  5KH6 A;  3V7C A;  1D3B A;  1DJ7 B;  2BIV A;  3M4G A;  2L89 A;  4RCB A;  1KHI A;  3L2Q A;  5GAM j;  3ZEH A;  1ZHI A;  2P0K A;  1JB0 E;  1G3S A;  1VQ9 T;  2M16 A;  3HFN A;  4ZTF A;  4WF2 A;  5GAN h;  1YIT A;  4A4E A;  1NPR A;  3HFO A;  3QSU A;  5CAI A;  5J39 A;  1K8A C;  4ELY C;  2VYT A;  4RG8 A;  4BB7 A;  1KQS A;  2BKD N;  3V8J A;  3JB9 F;  2KSS A;  3OSV A;  3G71 A;  5GAN e;  2KQW A;  2O4X B;  3LW5 E;  2BUD A;  2MMP A;  4OB0 B;  2F5T X;  4FU6 A;  4JDS A;  3GNG A;  3CCQ T;  3JCM J;  3P8D A;  4BY6 C;  1VQL T;  3M55 A;  2DXU A;  3LX7 A;  4M75 G;  2MF2 A;  4M77 C;  1M90 U;  3JCM g;  4J5Y A;  4Y91 A;  1IZ6 A;  5LJ3 g;  4M78 D;  4M77 G;  5LJ3 e;  1WJS A;  2X4W A;  2D6F A;  1M1F A;  1HXD A;  3CBM A;  4NS5 A;  2RHX A;  3LGF A;  3FJP A;  5A0D A;  2DZ9 A;  4Z02 A;  2QEX T;  1Q7Y U;  4LDX A;  3PIP A;  3VYH B;  4XQ3 A;  2XKO C;  3M9Q A;  2X4J A;  3C12 A;  2DAQ A;  4M7D G;  3PGG A;  2GCX A;  4C8Q F;  2PUK B;  1OYX A;  3JCM X;  2EQK A;  3DLM A;  4PL6 A;  1KD1 C;  3QZ5 B;  1QVF A;  3J81 E;  3CMA T;  3JCM f;  4GLK A;  2EJF A;  4PLL A;  5A0L A;  1UGQ B;  2WSC E;  3CEY A;  3MEV A;  3OBW A;  5HK0 A;  1W4S A;  3JB9 H;  5GAM g;  4FM4 B;  4PJO B;  1VQO T;  2E1H A;  1VQN T;  1Y71 A;  1BIA A;  4X9D A;  1YJW T;  4C0F A;  4BI3 A;  1X01 A;  3CCJ A;  2DD4 A;  4BE2 A;  1VQP A;  4R55 A;  4M78 F;  3JCM W;  3OS0 A;  4RCC A;  3OYL A;  2QTX A;  4KT0 E;  2DD5 A;  4C92 F;  1YIJ T;  1WJQ A;  1WJR A;  3MEA A;  4XU2 A;  5DM7 R;  2E65 A;  4M7D D;  1K9M C;  4LD9 K;  1GXI E;  3MET A;  1FXX A;  2DO3 A;  3M5A A;  4DQ2 A;  2PVG B;  1K8A U;  3X20 B;  5D6Y A;  1MHN A;  2DIQ A;  5C6S A;  3OS2 A;  1YCY A;  3ASK A;  2PU9 B;  2E41 A;  4KUI A;  4VUB A;  4D6W A;  3OYM A;  3JCM P;  3E1S A;  3OYC A;  5LJ3 j;  2OTJ A;  3M59 A;  3PFS A;  4F7U E;  4N4H A;  3G71 T;  2LTO A;  3VKI A;  4J7I A;  1P92 A;  4C0D B;  1X75 C;  1VUB A;  3Q1J A;  5J3B A;  3LH0 A;  4J83 A;  2RJF A;  3QO3 A;  5FU7 B;  3CCE T;  1YIT T;  3LLR A;  5CKB A;  1VQ9 A;  5GAM e;  1VQM A;  2JTF A;  4JRI A;  3KBG A;  3H6Z A;  4XU0 A;  2OTJ T;  4IUT A;  4ZN1 A;  2YLB A;  4M78 B;  1QVG A;  1VQ5 A;  2VV5 A;  3SD4 A;  3CC2 T;  2EIF A;  3CXC S;  5FRO A;  3URG A;  2MAM A;  1UEB A;  4PKC C;  1YHQ A;  4KUL A;  2V8K A;  3UT1 A;  3GLX A;  5FLX E;  4E7L A;  4A4H A;  4DA4 A;  3OSS C;  5GMK l;  1YIJ A;  3GF5 A;  3CD6 T;  2E12 A;  2DJZ A;  3C95 A;  3I55 T;  4E47 A;  3CC4 T;  2R5M A;  2XHC A;  2ZPF B;  2VXE A;  4PJO G;  3CCR A;  3JRZ A;  3MP1 A;  5KE3 A;  5CKH A;  1YJW A;  2YHT A;  1VQP T;  3M53 A;  3P8H A;  2KAF A;  4TVR A;  1WNL A;  1Y96 A;  1VQ5 T;  5EG2 A;  4HT8 A;  1M1G A;  4LD6 A;  3JCM d;  2RM4 A;  1JJ2 S;  4XU1 A;  3FB9 A;  3JB9 J;  1Y7X A;  1NPP A;  2DKG A;  2ZPH B;  3C4S A;  2JN0 A;  3LWI A;  2GFU A;  2EQJ A;  3QJY A;  2LT4 A;  4HCZ A;  4JUV A;  2D0Q B;  3RUX A;  2LDM A;  2QQB A;  3X24 B;  1QP2 A;  4A4K A;  3G6E A;  1VQ8 T;  2OTL A;  2QI2 A;  4IUQ A;  3FRN A;  3CCR T;  1XQH A;  1S72 T;  4OVA A;  3SDZ A;  3LGL A;  5GMK j;  4P5N A;  3HRU A;  2LRQ A;  4M77 B;  5A2Q E;  3A8O B;  4PJO D;  4X34 A;  2DVE A;  2EJ9 A;  3I55 A;  4M75 A;  2IG0 A;  4M75 E;  4OGC A;  3OYB A;  1Q82 U;  3JAM E;  1EIF A;  4MZM A;  4M7D C;  1VQL A;  5FU6 C;  1I8F A;  2KMT A;  4OB3 B;  3FC3 A;  3MO8 A;  1H3Z A;  4OF1 A;  2B8A A;  1BI3 A;  3DKM A;  3CPW A;  2CZ6 B;  4C92 E;  5GMK m;  3RMQ A;  3VUB A;  3S6W A;  2XD0 A;  2PVO B;  5CQX A;  3ZFJ A;  3JB9 I;  2A7Y A;  4J8O A;  3HSB A;  3VUZ A;  3CCE A;  3S3O A;  3FDR A;  4ME7 A;  1B34 A;  2FL7 A;  4N0A A;  2KK4 A;  3PTA A;  2ZPE B;  1BI0 A;  4X9C A;  5GAO l;  2EAY A;  3OYK A;  5GAN f;  2DEQ A;  2Y90 A;  4M7D A;  4M75 D;  5KCH A;  1V29 B;  1ZQ1 A;  2LX9 A;  2XIC A;  4M77 F;  3VJP A;  4BUG A;  3I56 A;  2FHD A;  5GAO p;  4JRK A;  2EYQ A;  2EJG A;  3RKW A;  2PVD B;  3OYJ A;  5HK3 A;  1M8V A;  5CKF A;  5LJ5 d;  3HKS A;  3FEO A;  2X4Y A;  3OB9 A;  4QQ6 A;  4UC4 A;  2RH2 A;  5HY6 A;  2MI6 A;  1VIE A;  2XI9 A;  4EMK B;  3OA6 A;  1KQS S;  4ZGD B;  3OMG A;  4EMH A;  3EAE A;  5KE2 A;  1S72 A;  3JCM Q;  3S3N A;  3L2U A;  3BW1 A;  1D3B B;  1VQN A;  3JCM V;  4HA8 A;  1XNI A;  1WPY A;  2G3R A;  3VV0 A;  2CYZ B;  1M90 C;  1JJ2 A;  2V8I A;  3L42 A;  1G5V A;  4JLG A;  2JNG A;  4E7I A;  1WQ7 A;  1U1T A;  3OBY A;  4A4G A;  4PJO C;  5LJ5 e;  1UGP B;  4HKE A;  1K9M U;  4M78 C;  4XTX A;  3BDU A;  1NJI U;  2FVU A;  2AHJ B;  1G3W A;  1UB4 A;  4F7U B;  3GPL A;  3CCM T;  3N5B B;  5CIU A;  5GMK i;  2CKK A;  3CCU T;  3OYF A;  3CBP A;  2EQM A;  2MWO A;  3CPF A;  5GAN 7;  4XTY A;  2HAX A;  5GAO q;  3AHU A;  1LJO A;  4LDW A;  2PQW A;  5CQY A;  4C0D C;  3PT9 A;  1VQ7 A;  1Q81 U;  3CC2 A;  3OYD A;  2RHY A;  2HQE A;  2M1H A;  4A4F A;  2DTO A;  3CCV A;  2RHI A;  3RES A;  4C5G A;  2MWP A;  2RJC A;  4QW2 A;  3V7R A;  2CZ0 B;  2NLU A;  2X35 A;  1VQK T;  2OAU A;  4M75 F;  4IUV A;  4C5I A;  4M7A A;  4QVC A;  2DTI A;  3CBO A;  4C92 C;  2XG8 D;  1OZ3 A;  3PNW C;  2GF7 A;  4YTL A;  4C92 B;  1I5L A;  4IKF A;  4FT2 A;  3MHX A;  4ELZ C;  4CRI A;  2XDB A;  1YI2 A;  2V8J A;  4JS5 A;  5GAN d;  3RER A;  4PJO A;  5LJ5 h;  2O01 E;  5GAN 4;  2K5L A;  3M54 A;  3A8H B;  2PUO B;  2RHZ A;  3LYI A;  2ZCF B;  4M7D F;  1XTD A;  1KHC A;  4NOY A;  1VQ6 A;  1X6O A;  4CI0 C;  1JRI A;  1YJN A;  3OY9 A;  2QDY B;  2QA4 A;  1M1K U;  2F5K A;  4IUR A;  5I2M A;  4M75 B;  1UGS B;  2RJD A;  4Y28 E;  5D6W A;  2YRV A;  4ZGJ B;  5CR2 A;  4JJN K;  1BIB A;  1YHQ T;  2JOY A;  2L3R A;  1N9S A;  2FB7 A;  2HD0 A;  3OQ5 A;  2ZPI B;  3H8Z A;  3C94 A;  2DZC A;  2VGM A;  3OYE A;  3L2R A;  4M77 E;  3X26 B;  2P0P A;  3R6O A;  1MGQ A;  3G6E T;  1VQ8 A;  4RMO A;  4FSX A;  2P0Q A;  1Q86 U;  3CCJ T;  3TRE A;  5GAN 5;  3OS1 A;  2D9T A;  3QPH A;  3A8G B;  4C8Q D;  4N4I A;  5GAO n;  3CME A;  3HP9 A;  5LJ5 g;  1PSF A;  3E9F A;  5GAN 8;  3CMA A;  3DB4 A;  1VIF A;  5LJ3 d;  1M1K C;  3O8V A;  4BDY A;  3SWN A;  5KCO A;  4EMK C;  1Y07 A;  4NL2 A;  4E7K A;  4ATO A;  1B34 B;  2LVM A;  1KC8 C;  5CK9 A;  1Q7Y C;  3OMC A;  4FL6 A;  1LNX A;  1SSF A;  4J6W A;  2E64 A;  3JB9 D;  4ZGE B;  2A3L A;  5J26 A;  1TH7 A;  5GAO m;  3ME9 A;  2RK2 A;  3CD6 A;  5FRN A;  2WSE E;  4C5E A;  4QQD A;  1NE8 A;  3BFM A;  2R5A A;  1FWZ A;  2R57 A;  2DPP B;  2XDP A;  4HCC A;  2K4Y A;  5GAN 6;  4BE1 A;  2DTH A;  4OGE A;  3UPU A;  5CO7 A;  4C0Z A;  3PMI A;  4ZTJ A;  3G4S T;  2E10 A;  3WVE B;  4EPC A;  4KUD K;  1YBY A;  4F7U G;  3LWH A;  1YI2 T;  2C06 A;  4MMK A;  3A8L B;  3QHS A;  2DXT A;  4BI8 B;  4J6X A;  4XTZ A;  1Q82 C;  3CC7 T;  4L5G A;  3T9N A;  3CME T;  1N8R U;  2X4X A;  2RI5 A;  3QKJ A;  4LDU A;  5M9O A;  3INZ A;  3OYI A;  5LJ5 j;  3L1A A;  5HKC A;  2O4X A;  3SWN C;  1BYM A;  2WSF E;  3QZ9 B;  3QJ6 A;  1W2B A;  2E6Z A;  3E9G A;  4F7U A;  4M7A D;  2YLC A;  3QG1 A;  1Q86 C;  4M77 A;  1VQ7 T;  4LDY A;  1H64 1;  2GQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...