2MMXA

Nmr study of 6ajl2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
111
structure length
111
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V1-22 protein
publication title Solution structure of 6aJL2 and 6aJL2-R24G amyloidogenics light chain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mmxA00
1DLFL 3RIFF 1AY1H 1RUQL 5D1XD 2EDQA 4GLRH 3I9GH 3HG1D 5GJSH 5GRUH 1NEZB 2NNAA 4QOKB 2A9NL 4JRYE 3VXUB 3ZE1E 4M61B 2FX7L 5I19L 2F5BL 4XVJH 4D0BA 1S9WB 4PRNA 5EO1B 4WFED 5TDOA 5E6ID 1FCGA 1KLUA 1N4XH 1UWXH 3MLWL 4RNRA 5E2VH 1UGNA 2IGFL 2J8HA 1NC4D 4CVXB 4IHOB 1NMCB 5F1NA 2FH6A 1KFAL 1T1WB 5E08H 1OWWA 4ZAKC 5CBAB 3FB6B 3FB7A 1LO3H 1EO8H 3FT4A 4J4PC 1KCVL 4Y4FD 1P9MA 4M9OA 2VQ1B 4XNMB 4PJGA 2CXGA 5I1DA 1SYVA 5EDXA 3GMQA 4JM2C 5ALBL 3FQXB 3CVIH 5DEFA 4JFFE 1CICD 2PYFB 1YNTA 4Q9BA 4EDWL 3GBNH 3CVHH 4UU9A 2VH5H 3GRWH 5LXGL 3LRGA 4KVCL 1K8IA 3VRJA 3ULSA 1DR9A 2P5EE 3MLRL 4ELME 4D9LL 3O9WC 5D5ME 4FXKA 2YA0A 3O8XA 3QDJE 1Q0XL 3BIKA 4Y4HB 5IV2B 3L3KA 5B39G 5E8DH 3MLSL 5CJXC 3ZE2E 5I1IL 3BGFC 1KPRA 5KVEL 2DL9A 4OI8A 3C08H 1OARH 3P0YL 2NXZB 4PJBE 4K07A 4X7EC 3MLVH 1FZOA 2IF7A 1TQCB 4M6OH 3QXVA 4NRXB 3LZFH 1V8HA 5EU5B 3RTQA 3VH8A 5JNYA 2FJFB 3U0TB 4R9HA 4NN6C 5D1XC 4ZUSB 3QDMD 4LSSH 3MV7D 2NW3B 4L29A 2LAGB 5I30H 4NQCE 2A9MH 1HQ4A 1CL7L 1F4HA 5LGKA 3UTZB 2J5LC 1JTTA 2ZSVA 3MTRA 5SWQA 4ODTH 2GY7B 1I9IL 3TBWB 4MNHA 3MNZB 5E6IC 3BXNA 5I15H 1FFPB 5E2UL 5GISL 5DMIH 3PP4L 3RGVC 3LEYH 4WUUA 4R26H 3QXWA 4DKEL 2R39A 3GMMA 3GSUB 1TZGH 3LN5B 3OKDA 3QIWD 4PY8I 2JTDA 1FYTE 5ESVA 1EIBA 2AEQH 4GW1A 3AMKA 1IE5A 4OD1L 4Y4FC 3WS3B 3EOAA 3ARXA 4NGHH 4ZTPL 1XCQB 5F71A 4KU1A 1NMBL 4GRLC 1QA9B 3N0PB 1F8TL 5DHYA 4WI3A 2ZCKH 1ZWIA 5GXBB 1CICC 2Z93B 3CPLA 4D0DB 3P4MB 1KEGH 3BN9D 1BJ8A 1JHTB 5DD3L 3FO0L 3BUYB 4BM7A 3ULUF 4GG6A 1X5XA 2IMMA 1DBBL 3WJJC 1DQJA 2VABA 3PWLA 3TT1H 5ETUA 3W9EA 3AROA 4LSTL 4IRSA 3LQMA 3MLPA 1DN0A 6FABL 5JDJA 5E9DD 4L9LC 1RK0B 4HS8L 1T0NB 4RAHA 1OAKH 4OB5L 5JXEA 2Z8RA 1BBDL 4LFHD 1MCBA 3FQTA 4JAMA 4OGYL 3BSZL 1BD2B 5LCVL 5C07B 3WDHA 3REWA 2GCYB 3IDMB 1S9YB 5D6DA 1I8LC 1KLGB 2AI0H 3V0AC 2GTWB 1ORSA 1IM3B 5J7CC 1J1XL 1FNEA 4ONHA 1EO5A 1F4YH 2DQDL 2UZXB 3IFPA 2NY0B 1QP1A 1KIQB 3CFBB 5TH2A 1O7VA 2RIKA 3T04D 1FG2A 5DWUL 4GW4A 4HWBH 3NFPB 3IFOB 5DZNA 2LFGA 3G6JA 5FA4B 5E95B 4M3KB 4UT9H 2FB4L 3IT8D 1NEUA 1XT5A 1M7XA 4D9QE 2B0SL 5JW3H 3BRGC 4XNUH 4D9RD 1CLZH 1LWRA 3MV8B 4HK3N 4LVHC 1YEEH 3D6GA 1M05A 1CU4H 2XN9B 1IEBA 1S7RB 1I7ZB 4NUGH 5C0GA 3MJ8A 4XPHH 4Q9CA 4QRTB 1GAFH 2OR8A 3BN9C 1FNAA 1BIIA 3TYFB 5EIIB 3N1FC 1IQDB 2EYRB 5HYIA 4RGOL 3KPSD 5I1GH 1RIHH 4HC1A 1N6VA 3DURB 5E03A 5J1AA 1C5DB 4P5MA 5C0IA 2R4RL 4P2QA 1QSFA 3KS0H 3ME0A 3MRGB 4Y1AB 1T0MB 5KZCB 3EOBA 2VDPH 3EYQD 4BH7B 2BX5A 4Q6IC 4RWYH 3O2DA 5CEZL 2W0PA 3OJMB 3B5TA 4G6KH 1QBLL 2F53A 4JM2B 2EH8L 5F3BA 5D93C 5ICXA 1OM3L 5JORA 4POZD 3DSNA 1EPFA 5AG9A 2R23A 2DS4A 4M1DH 3FHAA 4ALAH 2GSIB 4OD2B 1V7NH 1CLYL 1KB5L 1HH6A 3DUUB 5HY9A 4XP4H 1MCPH 2D3VA 5CP7B 1EVTC 3MYJB 4X4ZA 4XPAH 3S34L 2E27L 3O9WB 2CR6A 4CAGA 3F6LA 4AQOA 1VACA 5F9OH 3L5JA 1DP0A 3U7YL 4W70A 4ODWA 5MP6L 4U6VH 1S7QA 2GUOA 5ESQA 4U0QB 4KQ3H 3QJHA 2VKXA 2XA8L 5C08B 2FECI 4BZ1H 1MCLA 5IVXE 4V1DA 4O5LL 3BVNA 1I1AC 2ICES 2ZUTA 1SJHB 4JFEE 2UZIL 1IGYB 5CEYB 5F72S 1OAUL 4KZEL 1NDGB 3DSFH 4PREA 1P4BL 4OLYH 4XNXL 1T1ZA 3PQYE 2J5LB 1DE4A 1XIWD 2VZ1A 1FFQA 4P2RB 3PGCA 2ILLA 1YNLL 4OIIL 2FZ3A 5HTSA 2BRQA 4RAVA 1DQDH 4NDMB 1NGZA 4HJGB 1KCRL 5E70A 4HBCH 1VPOL 4UBDC 1RZ7L 1R5WB 3OR7A 1NC4B 1HI6A 3WUWG 5E8NB 1TENA 4N1EA 4OCMC 1T5WA 2FGZA 5IROC 4QXUH 3D87B 3HC3H 1SVCP 4TULL 4P9HC 1HHKB 2F5AL 1IM9A 5DRZA 2X4UB 3LN4B 1Z6JT 3RI5K 1JNHB 1W72A 2BFVL 5HDQH 1G7JB 5DI8B 5D1QB 2VSCA 3ECBB 3I50H 4HC1L 3RA7H 3RNQA 2FEDD 4P9ML 4RGMB 3EO0B 1G9MC 4M6AA 3QCUL 4OAWA 4ONOA 1DVFD 4PJXA 5J1TC 3L1OH 4XP6H 5I16A 4LPVA 4LCCA 2LTQC 3O2DL 1ZLVH 5DQDH 5LGJB 2V2XB 5GGSA 4F7CA 1FVCA 2JB5H 5H8DA 2WUCH 4S11A 3MXVH 3C5ZA 1I3RA 1VERA 1RV6X 3HPJB 2H3NA 1UB6B 2BMKA 4GRWE 4P3CL 4JQVC 4ZS7H 5T1KA 4NM8H 5JQ6H 3T8XB 3UROR 1YMMD 2LABA 4XAKD 2GIYA 1TVHB 3IJHA 1UB5A 1SBSH 4HUWB 4PBXA 5IR1B 1FPTL 3QDMB 3CH1B 3MV7B 3S97C 2J88H 25C8L 2JJSC 4PJCA 3E6FA 4ZQKA 2YKLH 4XB8A 5GZOC 4PYGA 1ZA6B 2VLKE 4MQXD 4Z8FH 5JW4M 3CSPA 3X3GH 2VC2L 4NQED 1WCQA 3VXQA 4Y19A 1F4WH 2P8MB 3DX8A 2GK0B 3OAYH 5FGCE 2KBGA 4I13B 3O6KH 2DQJH 4Z7WA 5D6CA 5BO1L 4HUNB 3A6CH 5IEKB 3QIWB 4NO2A 3VRIB 4TOYL 2OP4H 4JPVL 4KK5C 3TO2A 1KN2H 5DK0A 5EN2B 3CK0H 2P46B 2G9HB 4HSQA 3P0VH 3VXSA 4FRWA 2R4SL 4XI5D 3T4AA 5J6GB 4R7NB 2FEDC 2DD8L 3H0TB 1VFUA 1NGWB 4YXKH 3NA9L 3MQIA 1YEGH 4PJGF 3VCLB 2FDBP 1DVFC 5HHOD 3C60C 4JG1H 1CFNA 3OG4B 1LVEA 1MCWM 2A6KA 4G8EA 1Q94A 1IC5H 1UEYA 1DQQB 3FO2A 4LQFL 1W72L 1A3QA 4BFBD 1QEWA 1LE9A 5CILH 5IK3A 2RGSA 1F6AA 4YHYC 3HZKA 4AENB 4MGXA 4QLRA 5ID0A 5L88L 3O6LH 5E9DB 4RBPH 3TN0A 4Q6IB 5GS0H 4J23A 1CZ8H 1BFSA 5ANMA 4XMKH 1ZVHA 1S9VB 4QHKI 4YHOL 5E8OA 4JANB 1A5FH 4NZTH 4O2FB 5B3JF 3HNTH 3C8HA 3TZVD 3GK8H 3LQAC 3RWEB 5HJ3B 2EIEA 4ZAKA 3K7UA 3RL2B 1IT9H 2W0FB 2X4SA 1WZLA 1SMAA 4WI8A 4MA7L 3VE0B 1YMHA 4J4PA 4MQXC 2XZQH 3EZJB 2CKNA 5C0EB 2NY6C 3PF2A 5A43C 1RUKH 3TBTB 3GMNA 3QIUA 3ZHLA 4BK4A 1QRKA 1XCTA 2I9LA 3VFNA 1BJ1H 2Z35A 3BPOB 4RMTA 2WANA 2XQBH 2OI9B 3MZTA 4TUJB 3L9RB 1HK6A 1BQLH 5DJ0A 4JLRA 2AEPH 3UYRL 1H5BC 3DARA 2IBZY 1EGJA 3IB4A 5F7FA 3MBED 1WTLA 3KPQB 2BJML 4XCNA 5C71A 1AXTL 3FOLA 2CUIA 5FGSA 1AP2B 4WI6A 4MD5B 3U4BH 1WWCA 3KPSB 1H3UA 5C0CA 5I75C 3U48A 5C7XH 5FM4A 4U1HA 4UTAL 1EV2E 5D1XA 3D1MC 3R1GL 5I1JL 1BOYA 3S4SG 1U8QB 3HG1A 5GGUB 3CX2A 2DAVA 1UH4A 5FYKL 1QYGH 2Z31D 2D03L 2AJXH 4UI2A 4BZ2L 4WO4C 1UH3A 4ZG1A 3QDGE 4OFIA 2HVKB 3RGVA 5MERA 3KPLB 2VIRA 2FL5A 3GKWH 3IKKA 3MRIB 4PUBL 3MACL 2DLTA 3P77B 2E5EA 1XZ0B 1IGJB 1ZT1B 2VZUA 2HLFD 5J1SC 5EZLA 3G5ZA 4ONFH 5ISZB 2O93L 1X6NA 4X9GA 4GRLA 5T1MB 1OSZA 4KJQD 4Q97A 2R8SL 1CIUA 1ZHBA 3CUPB 3OKEA 3CFKB 4YHLH 1CICA 5FHBL 3WE6A 2XA3A 3TFKD 5CHNA 1C16B 2K7QA 4K7FB 3GJFK 3MZGB 4P3WA 5D7IB 3HMXA 5EFIA 2BP3A 3A67L 5T1LA 1BVKA 4QY8A 3WJJA 2WK2A 3WNOA 3FO1B 2CDGA 4M7LH 3WNPA 3ZYZA 5MI0C 4TTDD 3G6JF 2X70A 4X8XA 3BI9X 3TWCH 2OTWA 3Q6GL 1XIWB 3SJVD 4H5SB 4L9LA 4YFLI 4ZDHB 3INUH 1A8JH 3NCCB 2CLRB 2Q8BH 1JV5A 3JWOC 4DVBB 3HKFA 3GIZL 1Q9KB 2OJEA 1KENL 4U6YB 4Y5XA 3DRTB 1S5HA 4M1GH 1NGQH 3EYVB 5TE4H 1PKQA 2PW2B 4OZHE 3BGMB 4LDEB 1I8LA 4Z95H 1NAMA 3M1BA 5E5UB 1OAYH 4KQ4H 3DBXA 1ZSDA 3CMOL 3DIFB 5B3JE 4PJEB 4M7ZC 4WHTA 1J8HE 4GXUM 2Z31C 4YDIL 5E56A 1ODAA 1I8IB 4A6YH 5LBSL 2LQRA 4XXDA 5KSUB 3EAKA 1MFBL 4JR9L 2NR6D 2VE6B 1DVFB 1PEWA 1FE8H 5I8CB 4P3DB 4HIXH 4MCZA 3O0RH 3MRPA 5KANG 1AR2A 1CDHA 2WWKO 4PJ8A 2HLFC 1SEQL 2VL4A 4KRLB 1IKFH 4TNVK 1DQTA 5F89A 3FT3B 4R90L 2LVEA 4KJQC 4O2CB 4I1NB 3R06B 1FZKB 3ZO0A 5AZEH 3QZWG 3TFKC 3VA6A 4JREC 4RX4A 5SWSE 1MFCH 4KFZC 1U8LA 5IHZA 4EZMA 2V17L 1YMMB 4IRJA 3VFOB 1CGSH 5FUOL 3MOAH 2IPTH 3KPMB 2O5YL 2C3VB 4P48A 3MRBA 1HCVA 4MCYB 4EBQL 4TVPL 2ADIB 4NKQB 1JGEA 4H0HB 3QFDA 4KVNH 3VGDA 2V7HA 4PRPA 3MLUL 1PW3A 5T3XH 5I1HL 2ICWB 3C2AH 3RIAF 3U6RB 5IMMA 1KJ3L 5CEZE 5JO5B 2CJUL 4NQEB 2QQKH 4L8BB 2DQGL 3FQRA 1CXFA 3HMXL 4GG6E 5EORH 1R0AH 2W65B 4FS0A 1J7VR 5ACLA 1E27A 3MRDB 4GMTH 3ZSTA 2APXA 4R96B 2QBWA 4PV9A 2ORBL 1UT9A 2GI7A 1A6WH 2DMBA 2IFFH 3PWVA 4MMXC 1MHEA 1JRHI 3QQ9C 5DTFA 3FQUB 3QXUA 3FT2A 4G5ZH 3K2UH 2QQNH 2NR6C 3PXHA 2W9LA 5CSZA 4MD0B 4Z7UE 4MJ6A 1CD0A 1MRCH 3PDDA 3X14B 5E00A 5IESH 3F7QA 1NAML 5F70A 5FK9B 5F21B 7FABL 2Q8AH 4IDJH 4G7YL 4MB4A 4TNWK 5KSVA 4QO1A 2I07B 5H2BB 3MRJB 1WIOA 1B6UA 1I1YB 4KGJA 4Q0XL 2R9HC 2UWEA 2FSEB 4HMCA 1I1AA 1HH9B 5CWSB 4YXLL 5I76A 4Y16C 1NC2A 1LO5A 4XAWH 4YR6A 3MNVA 3P11H 4I2XA 2CLVB 3DX7A 1CFTA 3ARBD 4WU5A 4MDIA 1R3KA 1E0OB 1RK1B 2EDJA 3S88L 4KMTH 3MRFA 3Q5YA 4ETQB 2X4QB 5EO9B 1U58B 1YZZA 4XH2B 3KJ6H 5INDB 3LCYA 3VMOA 5GS1C 3TZVB 2CGRL 4KZDH 3MRLB 3QDAA 5K9KA 3L6FB 5IROA 5FO9B 4X9HA 3DI2B 1TJGL 2GHWB 4WFHD 3S36L 3PL6D 3HI1A 3GUTB 3CDCA 2IAMC 4ZS6D 4G9DA 5E1AB 1EEZA 1T1XB 3IDIB 5F96H 4YPGA 1RZ8B 1WBZB 1MJ7L 4M3JA 1UQSA 5DVOA 3DXAA 5FOBB 4P2QE 1BBJA 4HCRA 4X6BA 1QSFE 5CMAA 2C3GA 3CMGA 4JQIL 3V4UH 1XGPA 4PRDB 3E2HC 3HC4L 5KG9B 1MY7A 4LLYA 5JOFA 1QSVA 5I6XB 4NO0D 1JZ6A 3UJIH 4Z7WF 1DBJH 1EHLL 2EKSB 4K71C 1C7SA 2B5IB 3QO0B 5DK3A 3MBEB 3PHOB 1OPGH 2IANE 3NN8A 3CXHK 4KKNA 3ZKXC 1M71A 1ZS8B 3C6SA 4OF6A 3RFZC 1YEIL 1KN4H 4KDTC 3QXAB 3D25B 2BERA 3BESR 1NJ9A 4HX1B 3SKJL 3EJYD 4LLVB 1UM6H 1XGRA 3TBSB 5HGBA 1R3LA 1UENA 3FKUS 1IFHL 4N8VB 4J3VA 4RISH 1OVZA 1H8NA 4GAJH 3VXPB 3FFDB 2Z91B 4HJJH 2Z31B 4LSPH 1QSED 3IVKA 5ERWA 5IW6A 1QACA 3ARBC 1EZVY 4ODVL 1A7OL 3MCLH 3VFGH 2LVCA 2DQCL 3UYPA 2GAZB 4E41D 2NYYC 4Y0GA 5DMKB 4HWZB 1O0VA 2QL1A 2AJYL 2V9TA 4LNRA 4PJ5D 3WHXA 4EDWH 2NY1D 1AE6L 2HH0L 4ZS6C 1P7QA 4GS7C 4UV7H 1S7VA 5EPMA 5DSCB 4XT1C 1WCBA 4C55A 4QHUA 1SY6L 3MLSH 4K8RD 3UTSD 4MXVF 5BVJB 3TVMD 4JREB 4OZ4B 5FA3A 3C60A 1KUMA 4HV8B 2VLLA 4JM2F 4L3CB 5HHXH 1EA9C 3CLFL 2Y7QB 1UVQB 2D0FA 3HS0A 4IOIB 4KJWD 1FYHB 1QTYT 3OKNB 1G6RA 4KWUA 1GPOL 1W0WA 3SJVB 3UJJH 3QFJA 4PJFA 3SO5A 3QI9A 4M48H 2MJWA 1XGTA 2J8UA 4HCRL 4OZIA 3ZKND 2XTJE 1NUNB 4PJXE 4HZLA 1K6QH 2Z92A 5JHDD 5D1ZA 1QFUH 4CW1A 2F54A 3KPRA 3T2NL 5KS9A 5EOTB 3VFPB 5DQJA 4LSVL 1S7TB 1FL5B 2VDMH 2QR0A 3TNNB 2ZG1A 4OGAC 3DO7B 4PY7B 3RY6C 1VGEL 4H26B 4O9HH 1UM4H 3OPZL 4KUZL 1ZA3A 2O5XH 1BWMA 3VW3L 3P30H 3F58H 1WFNA 2DYPA 1I3GL 4L4TB 1EEUA 5I2IB 1CD8A 1CLOH 1HKFA 3RKDD 4BSVA 4PJCE 5ICZB 2B1HL 2NY1C 2GEEA 1MY5A 1DANT 3B6SB 5DMJB 1U95B 1R3HA 4XGZB 5IM7B 4X0KA 4ORGA 1H5BA 3RZCD 1I8KA 4Y19E 4LGRB 4HBQA 4NQDD 3VRLE 3BQUD 4LSTH 5DJXA 1RJYA 5IB3B 6FABH 1Z9SA 2OTPA 5FV1L 4YE4H 4K8RC 3EIFA 1OP9A 4AYFA 1BVLA 3TVMC 2FD6L 4FQLL 4F7EA 5HHOA 1NL0L 3I6LD 5FCUH 2OBGA 1FO0H 2DMKA 2WWKT 4NNPH 1CS6A 4HQQL 2ZUSA 3UZVB 1MHHB 4DN3L 5GS1B 3ARRA 4JZJB 4EIGB 4NHCH 5T3ZH 2YRZA 2PNDA 5B4MD 1AI1H 3DROA 5GGVY 2ICWJ 4R3SA 3DX6B 4YLQT 1ERNA 3P9LB 3ZDYE 2FBJL 1KOAA 2AGJL 5FYKU 3ZKNC 3KPPB 1SEBB 3BKMH 4HG4K 3QUMA 4G8FA 4HLJA 4WO4A 4YO0B 1YYMH 4JGJA 3VWKD 2IPUG 4LVOB 5IT2L 2B39A 1EAJA 4I3GA 5ADPL 4N0FA 2HJKB 3TJEL 3KDMA 3FFCB 4OGXL 1A3RH 2FGWL 3STZA 2BDNH 1DLHA 4U05A 1EBPA 4B50A 4NWTL 4K71B 2PTTA 4XPTL 5ANME 1GCFA 4WUKL 1AGEB 5I8EB 4UNVA 4ZXBD 3F7YB 2AV1B 2DWEA 4JFDA 4JPKL 4OLUL 3ZKXB 5FUCC 2H8PA 1CBVH 4OD3H 4PJ7E 3I02A 1WT5C 2YUXA 1AQDA 3HAEH 3HHRB 2AJVL 3REVA 2ZWLT 3QUXD 5BV7C 3E8UL 3BQUC 1KIUA 5C0BA 4JPWH 2R1YB 3T1FB 4M4PA 1U3ZA 43C9B 4KY1H 1DDHA 5KVMC 5CUSL 3OJDB 1KELH 3ARBB 2CDEA 3B43A 2FYYA 3B3IB 4OLWH 1JWSB 5F9WC 4G6JL 1KJ2A 2VL5B 2DQUH 1MF2H 4M8QA 1CDBA 4L9DA 1MPAH 3ZL4L 4H25A 1QLFA 4HWEL 3BH9B 1BM3L 1QQDA 3PL6B 1KIRB 5FYJD 5JOPD 3BH8B 1PZ5B 3DTXB 2YPLE 4N5ED 3B2VL 4BSWA 1FIEA 1M7DA 1F4AA 3ARDD 4X7FC 3K3QA 2H6PA 5C0CE 2PN5A 3S96A 3VWKC 4MJ4A 2BSSB 3NZ8B 4HPYH 3PJSA 1A4KA 2Q6WA 3EOTL 5C0FB 3FOMA 1HDMA 5EOCL 2JJWA 2GY5A 1YYLH 3HUJF 1IGIL 1QSZA 5DJAB 1JFQL 2IBGA 5H35B 2CUMA 4A6YB 5IFAL 4KTDL 4JPIB 2A6IA 4NO0B 3FRUA 3UZQA 3JTTB 4PPTA 4YIQB 1JZ8A 4NBYB 5DD6B 4LRNL 5CEXA 3CFDB 1E6JH 1ZHKA 3BWAB 4FTVA 3U30B 4ERSL 3VXOA 4ZFFA 4ZXBC 1D5ZB 3VU2A 3MREA 2CIKA 4M7JH 4DQOH 4MXQC 3QHTC 4MNQB 4OZFG 5J56B 4ZTOL 2AS5M 5EG6C 2VKWA 1NANH 4UUJB 2OZ4L 4PRHD 1XF5B 1WK0A 5F7HA 4TSCH 5IW1A 3QUXC 1WBYB 3QUYD 4MAYB 2CR3A 3ALPA 4TVPE 2C7UA 3K8KA 4G80B 4DKAA 3ILPB 3UDWC 3D69A 5C6TL 3S8WA 2QV2A 1L6ZA 2NY3D 1QSEB 3VGFA 5ID1B 4G6ML 2ADGB 1U8KB 2APWA 3UTTD 2R2HA 1UYWH 3C5SA 4OZGB 4E41B 3WIIL 3KLDA 4EQ3A 2W38A 3KNBB 4XC3H 3ZT6A 4Z0BL 2VWEE 4I18C 4PP1D 3LPGA 4PJ5B 4WRLA 4HKJA 2NY1B 2YSSB 4BQ8A 1AJ7L 3Q2CA 3OL2A 4N5EC 4OFYD 1JZ4A 2GJ6D 2DWDA 1RFDH 2OR9H 4UNTA 2HVJB 3HMWH 4F33A 5ICYB 5L6YL 2VXVH 4G9FB 4PY8J 1KJ2L 1WGOA 5DD5H 1GGUA 3H9HB 3UTSB 1ZE3C 4Z7VE 1PKQE 4LKCA 5E4EB 3TVMB 4PGBA 3EO1A 3T65B 2E7LC 1Q9WB 2AXFA 5FF6B 3CFJB 3O11B 5TF1H 2XI9A 4OLZL 1I7TA 3RNKB 1I7RA 1EFXB 2Y5TB 1D5MB 3QNXB 2W59A 2VXQH 3BD3A 3MOBH 1J10A 3WSQH 4QTHA 2HFEA 1N59B 1QNZL 3G04B 1WUNT 1J12A 1CR9H 4Y16A 4NO3B 3BKCL 3BGAA 4PRAA 1MRDH 3WYRA 1HWGB 5EBWB 1UA6L 5JHDB 3SE4C 3L7FB 5EZJB 3S6CA 1VEPA 1HHIB 5E2WL 3QUYC 1AHWB 1LDSA 3U46A 1RHFA 5HHVH 2EEAA 5TDNB 2MKWA 1QR1A 1D3CA 4Z78B 2ZCHL 3GMLA 5JHLH 5K9OA 1G9EA 5TFSL 1HYSD 2IAMA 2ZUQC 5F9AC 1EUTA 1G9NC 4ZOAA 2GK2A 1J0JA 3DVGA 3MJ7A 4HIJB 2R4SH 3ZT5A 4YEFA 1CDIA 3QNZA 4QHLB 4DGYL 3QEGH 1N7ML 5I66A 1NCBL 2A74A 1BIHA 4PP1C 1EH9A 1FJ1A 5DJCB 3VXNA 5K9QI 2Q86B 2AXHA 1F42A 2VERN 1N8ZB 2A6JA 3WKML 1C12A 4HIHA 4XRCB 4QGTA 5TJWK 3ARZA 3QCTH 5EA0H 3RZCB 4OCWL 4U1LB 1FORH 1PVHA 3S3JA 4NQDB 2NTFB 3BQUB 1YEKH 3BT2H 5TE7L 2BVTA 4XX1G 4YBQD 1OGTA 3N1QC 4H1LH 1PG7H 43CAB 1KCSH 4OCSH 4APQD 1PQZB 4JY5H 1S5IL 1IGTB 4D0CB 3HZVB 4X5WA 2KH2B 4PJIA 1DQLH 1JL8A 3IJSB 4YWGL 4HS6A 3DVFA 1IGFH 2ZSWB 3W0WD 2V9RA 3RWCB 1JPSL 5EU7C 5HDOA 1BOGA 3O2WL 3FB8B 4PLOB 3SN6N 4XP9L 3SDYH 3QHFH 2P42B 3VGGA 2FO4B 5CCKL 2FHFA 3VXUA 1MCQA 4FG6C 5JW5B 1T66D 2YRPA 2N7AA 3VWKB 4AY0A 3NIDE 3HE7D 1GGIH 3VXMA 2BNQA 2UWEE 4I0PB 1OHQA 3MX0A 3VWJC 4LOUD 5KVFH 2R1WB 2J8UF 1F00I 4OZIF 3A6BH 5DRXA 3TA3D 2EO9A 2CLZA 1DEEA 4U3CA 5JUEL 1CF8L 1KGCD 1VFBB 5J11B 4IHOA 4MLSA 1NFIA 4D94A 2YK1H 2CKBA 1LNUA 1UEMA 1DUZB 5KS9F 3JSSA 1NCAL 1NQBA 3S5LB 4XVTL 4AM0B 2ERJC 4J3XA 2R2EB 3UBXI 4XNMA 1DQMH 3WS6C 5ALCL 4X6CB 3WCYA 1G7MA 3W9DA 4LHUD 3KYMA 3GIVA 1JPTL 5JIHA 5ACZB 2BRRL 1BEYH 4LKXA 4ZO7A 1JGVL 3ZHDA 4Y2OA 3V5KB 2RCSL 3L7EB 3VFTA 1T1YA 4FQ1H 2OM5A 2DBLH 1GGBH 1Y0LB 5F7NC 4IS6B 1LD9A 4OSUL 4M62L 4X4XA 4WCYH 2EEBA 1U91B 2XIDA 5IMLB 3DXAE 1U93B 4J1UB 2ATKB 4APQC 1C5CL 1L0XA 4I48B 5FUZH 3K74B 3AFLA 3U0PB 3KPNB 4AG4H 4CVUA 1AR1D 3MV9E 4JN1L 4JO3H 5SWZD 4POUB 5CAYB 4LSRH 2VLMD 3VDCA 4DKFL 4KXZI 4YDKL 1I4FA 3CX5K 4XPBH 3U0TA 3IFNH 1YJDC 5JMOC 4X7TA 3ARDB 1EJOL 2P8LA 2Y07L 4UTBH 4FQ2H 1T66C 3ZTJH 1LP9A 3NTCH 1I7UA 3HE7C 4EUPA 4LSUL 5IBLD 3O45B 1HNGA 4LOUC 4G6FD 4RZCB 4PR5A 3C6LD 2B2XL 3TA3C 2MCPL 2YMXH 3HFMH 3TGXA 5IEHA 3HC0A 4NQVB 1JE6A 2XT1B 3AY4C 3R0MA 3M17A 2JELL 1NGPH 3EFDH 3NCEB 4ZO9A 1FH5H 3O2VH 4PJHB 1OTUD 3T0WA 3ELAT 3RIAK 3SCMD 2PR4L 1CE6B 4GQ9H 2IH1B 5J3HC 3QISA 3E3QC 1YN6B 2AABL 4M43L 3SKOA 2RQ8A 2HLAB 4MWFB 3P4NB 1EEQA 1T22A 5GZND 7CGTA 4KHXH 3SGEI 1QHPA 4QHMB 3QG7H 4QXTA 1LO4H 4OZFH 1FL6B 4MJIE 3QUYB 2VZ3A 1A9EA 5FDWB 4NCDA 4YQXL 3VD3A 1MIMH 2W60B 2OL3H 4UT6L 1A7QL 2YPVH 2NY7H 1FO0B 5T1DH 1Y6NR 2Z8VC 2NY3B 2JCCB 4DGIH 2FEEL 1OT2A 3GJEB 4WNQA 4YDIH 1M6OA 5HYQA 1NGXA 5IG7A 4X6EB 4U1MB 1PSKL 4Q58C 1AD0B 1ND0B 2W0LA 1T0NA 2HKHH 2RB8A 5DD1H 5JDSB 1E4WL 3RVUC 3CZFB 3F6IA 1RQ5A 4ZFGL 4WTXA 2UVEA 4M5YL 2EE9A 1QRNA 2AKRB 1Q72L 3QFJE 5KVGH 4PJFE 1S9YA 2J8UE 3GZKA 2GJ6B 1A1MA 5H94B 1FVEB 2XKSA 1CVRA 3VFRA 3GHBH 4ZPTB 2C5DC 3QH3A 5F9JA 3U82B 1MWAH 5LWYH 3LHPL 2F54E 5IBLC 3ARFC 3HRPA 1AC6A 3TJHC 4XMPH 3ARWA 5DHVA 4X7SH 3LS4L 4P5TD 3LD8C 5IFHH 1S3KL 4NN7B 2XG4A 4YGAB 1WT5A 3LKOA 1LEGB 4XHQA 5FUOH 4JFYA 1OAZL 3D85D 2O5YH 2Y9RT 3ARED 1VADA 3SCMC 3ZYOA 4HK0A 5HHNB 1AGBA 4U33A 3VFVB 3VFWA 4YEEA 1VGKB 4TVPH 3KJ4C 5LGHL 3HAEB 3DV6A 4M1CD 2X9WA 4G8IB 3DUSB 4OF0A 4LCUA 2XTLA 1L7IH 1MREH 1I8MB 2IBZX 4YZFE 2DLHA 2HWZL 4MVBC 1LE5A 4P0DA 4L4VA 1HIML 1RUAH 4K3GA 4X83A 5TDPB 3AMLA 3IETB 4ZO6A 5HYJB 3KLAB 3LKRB 4YHNB 5KSAD 2AXGB 5I8KL 2XG5A 1NCNA 1CI5A 2XICA 4QHKJ 4X6FA 4HXBL 4ZD3L 4F37K 2VXTH 2NZ9D 1OLLA 4P59H 1RU9L 3JWNC 2FJGB 4OFDA 1IAOA 2HMID 3U9PL 3ULVC 3VFMA 3F7VA 3VG0H 5JIKA 4JFQA 2MCG1 5I1CL 5JTWA 2MKLC 3L3IB 4MZ3A 4S0TD 4UQ3A 4GKNA 3NH7H 1HN1A 2AK4E 2P5WD 2PYEE 4HPOL 2GSIA 4OD2A 1ETZB 4IIQC 4JVPA 3EYSL 3TCXA 2X1QA 3QG6A 5CP7A 2X1XR 1V5JA 4NQSA 4QT5A 1UCTA 4NJ9H 2AJSH 3MNWB 4M93C 4ZXBA 2KKQA 2VSDA 5L8KB 1MJJA 4I5BA 3IGAA 4ZUWB 3OX8B 4P5TC 5ILTH 1CG9A 4LDOB 4LARH 3R8QA 3G6AA 3MRQB 1CGVA 3AREC 2ARWA 2VDLH 3QUXA 5GHWL 3W0WB 4JQXC 1N2RA 1YY8B 2PF6A 3OWEA 1TLKA 3MLXL 4JFDE 4M1CC 1L9MA 2D9QB 1SJHA 1U8NA 4LHJB 1RMFH 1TJGH 4K23L 5KN5A 1ZTXH 4RMVA 4HGWA 4P5KB 3TO4D 3IXAB 2NX5E 3BD5A 3W2DH 4WI2A 4P2RA 3WL9A 2ITDA 3PHSA 1IAIL 3I6GB 4ODXB 4R4FH 1SJEB 4CL7A 5HDBF 3TC9A 4AEHL 3TA3B 3O6FD 5IKCB 3EDFA 5KSAC 5C0BE 4I18A 4LSQH 4JQIH 1W0VB 1EFQA 5IBTL 1TJHL 4QRUB 1GZPA 3FZUC 4NZRH 1FGVH 4H8WH 4Y5YC 1OGAB 2AQ1A 1IQWH 4ORZC 2NZ9C 1V3LA 1QFOA 1RI8A 1JHLL 1AO7A 1KIPB 2Q3ZA 4BFIA 4U6TA 2DOCA 1JI2A 4F80A 3U9UA 2HMIC 4XCYB 4XBPB 3F5WB 5D1QA 2XFXA 3SE3C 3DNKA 3ECBA 3B9EA 5JPNB 3OKMB 1A6PA 3MBXL 5DJ8A 3OKKB 1Z5LB 2VITA 3RVXD 2OX5A 3O3BB 1RZKC 3G6DH 1AXSB 3H3KA 1GGCH 1IFHH 3I3BA 1CDUA 2B4CH 3V7MA 2X4TB 3FB5B 2RBLA 5JOEA 1ZVSB 5BW7C 1CL7I 4QTIL 4Q9QL 5BS0A 3LEXB 2L0DA 3OSKA 4WW1B 1RZJC 4EOWH 1FV1A 1D5XA 1RZFH 4KROD 4Y4KD 5BZWB 4PRHA 3D18A 1TTGA 2O61B 1F4XH 4FTVE 1OP3H 1A2YA 3NFSH 1EO7A 5DRWB 1HINH 1IBGL 4NPYB 1MVUA 4R6UA 4U7KA 5GQBA 3FQNA 1RAMA 4LCWA 2XNAA 4B0MM 4PJIF 2VR5A 4RFOH 5AYQA 1TZIB 1YQVL 1ZOXA 3IU3B 4P2OD 3KAAA 4YGVA 1G7QB 4OLVH 5MENB 1I1RA 3L3GB 4G6FB 3C6LB 3O6FC 3SY0B 1CFSA 2DQEL 3LD8B 4E9LA 2GK0A 1KLFA 2AK1L 3ESUF 1TZHB 5IQ9B 1F3DJ 5KJRH 3FN9A 1NGYA 1D5BA 3SCMB 1A9BB 4LLAA 3ZTNL 4I3SL 2Y6SD 1YDPA 2G9HA 1MLCA 2HJLA 3KJ4B 5DR5L 4QRRA 5L9DH 2QQLL 3L3HA 3Q48A 1KPVA 3ULUH 4ZNEA 4DW2L 1QO3A 2M26A 1UFUA 3IJYB 2WP3O 3HZYA 1G0DA 1D6VL 4J3TA 1NGWA 5IB4A 4CVZB 3RVXC 4BH8B 2GQHA 4H1LB 1ADQA 4XB7A 3VFUA 1N0XL 5DUMH 4MA8H 2ZOKA 1G7IB 1MLBB 2BOCA 5TGBA 3GSXB 4MAUL 2BVOA 5FB8B 1KCUL 4I3RL 3ZYIA 1ED3A 1S8DA 4U7MA 4LLUB 1MRFL 2IADA 2ESVD 1FDLH 2XWBB 3VWJA 9CGTA 5EBGA 1DBKL 4DUVA 2C3WA 5T5FL 1KXTB 1X7QB 2R69L 4PV8B 2Z4QB 4R4ND 4YHKL 1PX3A 3OXSA 5B22A 2VISA 4DJMA 2W0FA 4DK6A 5B21A 3QXDA 4ACPA 3HR5B 4P2OC 1WFUA 1I9EA 4PG2A 1T4KB 1KNOB 5D7JC 4KKBC 1M7IB 2H32H 4P5TB 4UT7L 4XNQB 1WTGT 3PWNB 5JXAL 5IQ7L 1J0HA 4NJAH 1A4JB 1EDQA 3IS1X 1U0QA 3D85B 2A2QT 4TQEH 3QR2A 4YXHL 2VLJA 3BPLB 1U42A 3MRHB 4HGKC 4AIZB 3MFFB 1G9NL 2ZJSL 4JB9L 1KJMA 35C8L 1VFAB 1TETH 1CYGA 4ELKB 3H9ZA 1A02N 4FXGB 2NXYD 4LGSB 5LQBH 1IAIM 5HYSG 2JLLA 1TTUA 3CVHA 3GRWA 4WVRA 5C09A 4APQA 3KPQA 5ECJE 3SE8L 3DGGB 3ABZA 1WC7A 3LKPA 3PWJB 2Q3AA 1VKXB 2DICA 2BNRB 4FNLL 3NZHH 5DYOB 4U6XA 5KSAB 4X98A 4OF5A 4P57A 1OB1A 5B8CB 5CJQL 1JYXA 5HHQB 3IKCA 2FH8A 3T77A 1R5IA 4K9EC 4OV5B 4KC3B 4GSDL 5CJOL 5FYLD 2UUDK 5B38B 1ZHLB 4PJDB 4XPTH 1CXHA 5D96B 3KXFA 5D4QA 4BUGA 1EHNA 1OAQH 5CIPH 5I1EH 4LP5A 5JW4Q 4O58L 3ROLB 1NCWL 4JPKH 1ADQL 3Q1SL 1EZVX 2CD0A 3MMEB 5HHME 4LASL 1KEMH 4PRIE 2X4PB 1RURL 4LK4A 3AY4A 1FLRH 5DLMH 4R4NC 5AYUL 2HN7B 5DA4A 4QOKE 3VXUE 1AQKL 3BAEH 3MLTB 4GAGL 3FCTA 1XZ0A 3TNMB 1IEAA 5HGHA 1MFEH 4O2EA 3V5DB 1YEHL 3VXME 4TVSa 1AY1L 5C0AB 2DQHH 4LHUA 2Y23A 3I9GL 5GJSL 5GRUL 5IW3A 3B9KD 3K8MA 4DVRH 4PGCA 3SKUD 4RRPA 4IMLA 1FC2D 3PXJA 3CFKA 4XVJL 4NKIH 2V7NB 1XF3A 5EUOB 1N4XL 5E2VL 3PQYD 1ZEAH 2IG2H 3BZ4A 3RWFA 2NXYC 5E08L 4MHHI 3KYOA 3BJ91 1NPUA 2XPGA 1LO3L 3TO4B 1EO8L 5LAXA 2OL3B 4XCCH 2BSTA 2CLRA 1DSFH 4MB5A 1H0DA 3F12A 3EFFA 2R29H 3CVIL 2DTSA 3GJFB 5AD0A 1J0YA 4N0RA 1NEZG 3S37X 1C5BH 2C3XA 3D0VB 3BGMA 5D2NA 3GBNL 3CVHL 2VH5L 3GRWL 4U1SA 1S78D 2I60H 4PJAB 1QG3A 3ZE0F 5SX5K 2P47B 2V6HA 2WM0A 2VJXA 1HOCA 3U36A 1N6UA 1LEIA 1A6AA 3ARFA 3WN5C 1HSAA 5GSVA 5ESAB 4NYLA 4BQCA 5BJTA 5E8DL 2QHRH 2YD5A 2BNUB 4XNZC 3T08A 3C08L 1OARL 2GITA 2EICA 3RWIB 1TCRA 5I8CA 1HXMA 5D72H 3MLVL 5IBUB 2OYPA 3MRKB 4M6OL 1BGXH 1II4E 5IP4A 1LP9E 3LZFL 4L3EB 3CH8A 5IHLB 1P7HL 4HWBA 1X9QA 4U1NA 1QPXA 4LSSL 4PB9H 5CJBA 2WBWB 3B9KC 5I30L 2A9ML 4PJBB 3H6JA 1REIA 4HAGA 3FAWA 4G43B 2YBRA 5ITBH 2BY2A 2HG5A 3OJ2C 4EI5A 4KROB 4Y4KB 3FN3A 3H9SD 3TH2T 5DJYB 1DFBH 5I15L 2VDKH 3VD9A 5DMGD 3SPVA 5DMIL 5CJ5A 2H26B 3LEYL 5MEPB 4TYUA 4R26L 1UKQA 1QOKA 3TPUB 1ES0A 3KPMA 1TZGL 3VFSA 4LBEA 3H7LA 1JYNA 1C7TA 4MA3B 5SV3A 4JFZH 2AEQL 5E7BA 3QDHA 3HZMB 5K59F 1VCAA 2VR9A 4U1JA 3RPIA 4P2OB 4NGHL 4HFUH 1J05A 3U6RA 3G08B 5EU6B 3OF6D 4NNYA 4HMDA 4R7DB 1TCMA 4H88H 2DM7A 2X7LB 2ZCKL 1IGMH 5DJ6B 3V5HB 4YDJB 2JF1A 1CD9B 1XAUA 4WHYG 1YC8A 4NN5B 1NBYA 1PGRB 5FECB 3ROOB 1LK2A 3ZDZF 4TPRH 3TT1L 2X4OB 5DFTA 3BKJH 4UINH 2WWMC 3UCRA 1K5NB 4YAQA 3Q6FB 1BD2E 1FSKC 1QRNE 3ALXA 3P73B 5E5MB 1N3NB 1OAKL 4AH2B 3T0EB 3TBYA 4JDZA 5T5NG 3MROB 2I07A 3MRJA 3SDAD 5DFWH 2FSEA 3BP6A 5EC2A 5D7SH 2AI0L 1HH9A 3DHMA 4OKVA 2HA1A 2WP3T 1D9KD 1X5GA 3BYYA 1U8OA 4PJHF 1F4YL 1UXSB 2OJZH 5IOPB 1I3UA 4HKBA 1KT2B 2DF3A 5C2UB 2ESVB 3QULB 4GMSH 5DMGC 2A77H 4AL8H 1INQB 1CXLA 3QYCA 3MV8E 4HF5H 4DUXA 2CMRH 1INEH 2E8ZA 4FQXD 4HWBL 4XH2A 1U8HA 2K1MA 4HH9B 4PGEA 4Y5YA 5I9QB 1HQRA 4UT9L 1UKTA 4FHBD 5TQ0H 5JW3L 3MV01 4E5XB 1MI5B 4L4VE 2Q20A 4XNUL 4RFEB 4W6XB 4Y5VA 4Z7QF 1CLZL 2A0LD 1C1EH 1Y18A 2DI7A 3RWDA 1YEEL 1CU4L 3EDEA 3RVTD 3SE3A 4NUGL 1H3XA 2JJTA 1YPZA 4XPHL 3VI4E 5C0DA 1NKRA 2VZVA 1GAFL 4NQUA 3UBXB 5H37G 5I1GL 4Y1AE 1RIHL 1NKOA 4HXAH 1F97A 5F1IA 2NXYB 4FZ8H 4UDUA 3W11D 5JPMB 1CGTA 2EKSA 3KYNB 3O2WH 5IF0B 1E4KC 1V05A 5JLZB 1ZLUK 5I71B 3MXWH 2VDPL 4FQJH 3AS1A 4HUXB 1P1ZB 4DFHA 4RWYL 1IAKA 1R24B 5KAQF 3MC0A 5CD5D 4G6KL 2G2RA 3H42H 4LLDB 1A1OA 3UMTA 4J8RA 1A3LH 3OG6B 3BW9A 5EO0A 4JRYA 3SDAC 3VI3F 5JUEH 4M1DL 4ALAL 4LLVA 1PY9A 3GSRB 1V7NL 4KRPD 3HTLX 5B39A 1QLRB 1JUFA 3PDOA 4XP4L 1KJVB 1MCPL 5KSBA 4JY4B 5GGSY 4XPAL 2YPKA 1A6TA 4KI5E 1N5AB 5A3ID 3FFDA 2JK5A 2Z91A 3MUZ1 1CT8A 4RDQF 4GW5B 5C08E 5F9OL 5HGDA 5B3NA 5LG1A 4U6VL 3NCJH 1CE1H 4KQ3L 1YY9D 4HZAA 4HHAA 2YEZB 5AUMA 5ENWA 3GHEH 1S7UB 2E6PA 4BZ1L 3GMOB 4P2RE 4HULB 2A0LC 1UZ6E 4Y8AA 3PV6B 1JF1A 5DZLA 4JFFA 3CLEH 2CDFA 3DSFL 3HN3A 4OLYL 4QWWC 3GSQA 5DA0B 2XQYG 1WAAA 2ICEB 1CDYA 3WIHL 3L3OA 4FFZH 1X5AA 1UJ3A 1DEDA 4NQXA 4ZOCA 1RUMH 1DQDL 2P5EA 4JN1H 2VXSH 4HBCL 5C3LD 3AUVA 1AO7E 4XBEH 3QDJA 3MPCA 3OAZH 4QHNA 2FHBA 2Y4SA 4UB0H 4QXUL 2HJFB 5IJVB 3HC3L 4NIKB 4WI9A 2F74A 3QEUA 3O3DA 3QAZB 5HDQL 4MDJA 4HKZB 1FFNA 5CD5C 3I50L 3TIEB 5FCSH 3RA7L 3U7WH 2N7BA 3V6ZA 3X13A 4FQHB 4ZUVA 4NQCA 3RX7A 5D7LA 5DRNB 5D8JH 1PYWB 1N6QH 2IJ0C 3MCKA 1U8JB 1T80A 3L1OL 4TTGA 4JRXA 4XP6L 4CMHB 3TNNA 1T20B 5DQDL 2N4IA 3RTQD 4XXCC 2CO6B 2JB5L 5D7JA 1XGUA 3MXVL 1CXKA 2VOTA 4JDVB 3FMGH 1FSKB 1FYTA 1VESA 1IZKA 3I84A 2BSRA 4ZS7L 3MV7E 4H0GA 4LCWE 3T09A 1YY9C 4NM8L 1QR4A 2PO6C 5JQ6L 2H32B 5A16B 4LLWB 1HE7A 3BZEB 1RULH 4HDIA 1BLNA 1U95A 5J12C 5INCA 5L0QC 2QQQA 4WUUD 2Q7YB 2BZDA 2F58H 1SBSL 3WLBA 2DJUA 2BY3A 2HFFA 4P4KB 3TH4T 2E9IA 3WKNA 4L5FH 2YKLL 4KDWA 4ZFOB 3EJZC 2GSGB 1P9MC 3PWPB 4Z8FL 3H9SB 3X3GL 4Z7NF 4DZBB 4U6HA 3V9FA 5I18H 1B0RB 1F4WL 4AZ8A 5HI4D 4N8PA 1J86A 2CIIA 3MCG1 3O6KL 2DQJL 3JWDL 2AJZB 4WU7A 4QRRE 3RDTC 3A6CL 4MD4B 1EAPA 4HD9A 4ZNEE 2OP4L 4WV1A 4NUJB 3CDFA 4JFHD 4S1DC 4X80H 1KN2L 2D4FA 3CK0L 4GKZB 5F8RC 5A2KH 5FGCB 3P0VL 5IHUH 3LHPH 5DUPL 2J1KA 4HIIB 5IR1A 1NBZB 3DRQA 4BJLA 3BEVB 2UY6A 3OAUH 4IRSD 3T3ME 1BFOB 3BKYL 4YO0A 2P24B 3BPCB 3RI5F 3UPRB 1L9NA 2Y06H 5EBMB 4YXKL 4PRBA 1YEGL 1AGCB 5CIPB 1F11A 4JG1L 5JXED 1S7WA 1DJSA 4C56A 5E9DE 1BFVH 1IC5L 4JO2H 32C2A 3T1WA 3GB7B 2D31A 5CILL 3BE1H 5CGTA 5I8EA 4WJ5B 3O6LL 4HWNA 4MNGB 3WO4C 4DK3A 3P9MB 2JJUA 1LEKA 4EN3A 4YPJA 5GS0L 1ORQA 2X41A 1HIMH 3IDGB 2UZYB 3BEWB 4HEPG 2H45A 2IQAB 4P46D 4LF3B 1TTFA 2PTVA 4XMKL 4EIZC 4ETYA 1QKZH 1A5FL 2KUTA 3TLRA 2GYSA 4NZTL 4YHZH 3HNTL 1C08B 4KV5F 3GK8L 5DQ9A 3F8UB 1D9KB 4FXLA 1IT9L 4G6AC 1IAMA 5DDHB 4X6DF 3UTPE 1RUKL 3QCVH 3U9PH 4CGTA 4K94H 5HI4C 4GBXA 2BOBB 3B3IA 3B2UD 2XKNB 4TUOB 1U3HA 4FQXB 5FOJA 1F5WA 1BQHB 4IDLA 2D7PA 3RWGB 2BSED 4FQQB 2XQBL 4HPOH 2ZKHH 5C09E 1P2CB 4LFHG 1BQLL 1JPFB 3JTSA 2EYSB 3AAZB 4NKOB 3GSNB 4JJ5B 1L6XA 1RJLA 4KTEH 4P2QD 4XMLH 2OR7A 1PLGH 1QSFD 3WN5A 4IRSC 2NW2B 2ZZUT 1DTUA 2P8PB 3D3VB 3C8KB 3VGHA 3WUWA 5E8PA 5DGQA 3NZ8A 3I75A 4ISVB 4XNYH 1A7PH 2GFBA 1PKOA 3PUCA 5JXEC 3G5XB 3U4BL 4HUUB 2F53D 3ULVF 5H35A 3O3AB 1MOEA 1FZMB 3KXFE 4IOSD 2E7CA 2WINA 5H37H 5C7XL 3UC0H 1JZ5A 1WBXA 1NCTA 5GSRB 3DLQR 4Q9RH 5DD6A 1MQKH 1X4YA 1RZIA 5DMYA 3R0NA 2GT9A 5EZIH 1GHFL 1WZKA 2DL2A 3PP3K 2W91A 4JRWA 4LVEA 3VG9B 1QYGL 5IVXA 5BXFB 4S2SB 1S7SB 2AJXL 4P46C 3THMH 5J6HA 2DMCA 5DJZB 4JFEA 3O3EA 1OP5K 3X12B 4BELD 4RIRB 5EBLA 2R0ZH 1K3IA 1YEDA 3PQYA 1CGWA 5ISZE 3GKWL 4KRPB 4ODBD 3FTGA 1WBYA 3BPNB 3CC5B 4J6RH 3PABA 1FN4A 3CCHB 1QD0A 1XFPA 3OGCA 3BRFA 4OM1H 4WWKC 2R2BB 2VLRA 4V1DD 3GSVA 15C8H 2I24N 5ID1A 5D7IE 2ADGA 1U8KA 2NNAB 3V4VH 3WUZA 1Z9MA 3NA4A 3QUKA 2PTUA 3LKQA 3OQ3B 3RVVD 2FX9H 4YHLL 3BP4A 1B4RA 1HZHH 4D0BB 1QBAA 4RWHA 4ESKA 3Q3GA 5TDOB 3K4ZA 4ODHH 1KLUB 4U1GB 1FAKT 4LNVA 5AG8A 3PGFH 1B90A 3NAAH 1JN6A 5F1NB 4M7LL 2HVJA 1TDQA 4CADA 4FZEH 1I1CA 3TWCL 4JHAH 1V3MA 1NSNH 2C1OA 3FB7B 3FT4B 1IM9D 3INUL 1YNKH 2EE3A 3QQ4A 4PJGB 5DEGA 2DKSA 4PJDF 1SYVB 4QEGA 3RZWA 5I1DB 3BHBA 5D2NE 4F58H 2Q8BL 1FVDB 4W6WB 4FP8H 3GMQB 3O11A 1Q0YH 4ODSL 1EFXA 1I85C 4PJEE 4XPFH 3C2SA 4M1GL 5DEFB 1NGQL 5TE4L 3LOWA 1YNTB 4R0LA 1YPZF 3L3JA 2OS7A 1EGJH 2QTEA 2XTJD 4UU9B 4Z95L 4KQ4L 1ZT7A 2DLIA 3G04A 1K8IB 2H2PD 3MR9A 1Q8MA 3ULSB 1AD9A 1LHZA 2DKUA 4UZGA 4FXKB 3O8XB 1AH1A 1UJTA 4A6YL 3BIKB 3B9VA 4FFVC 5F88A 1WVZA 3C5ZD 3L3KB 4DAGH 1G1CA 1KPRB 2VLKA 1FE8L 4LAQH 1IZJA 1WFTA 3MLZH 4HIXL 3O0RL 1CN4A 5T1KD 5C8JB 4YDVA 4AT6A 5TDNA 1FZOB 1U3YA 1F02I 2XZAH 2A1WH 4S1SH 3PHQA 3RTQB 1MFAH 3VH8B 5F7KC 2BVEA 1IKFL 5DR5H 2C4FU 4MXWH 3WO4B 1FC1A 1HQ4B 2Y36H 2CH8A 4FA8A 3RVVC 5AZEL 2ENYA 4YDLC 5SWQB 1RJZA 4RQQA 3FO9A 1MFCL 4MNHB 4C58B 2NY2B 2R1XA 3BXNB 4YHPA 1K4CA 2DLEA 4Y19D 4XC1H 1CGSL 3GMPA 3MOAL 2VDNH 4WUUB 4CVWA 3OKOA 2IPTL 3CAFA 1CXEA 3GMMB 4FQIH 3OKDB 4NC1E 4MYWB 1JF5A 4GW1B 4KVNL 2CK2A 4N0UB 5T3XL 3EOAB 3C2AL 4N9GA 4MJ2A 1GIGH 4OKDA 2CRIA 2QQKL 3VXSD 5DGRA 5EORL 3WIFA 5EC1A 5DHYB 1UM5H 1ZWIB 3CPLB 3SDAA 1JWMA 4GMTL 1CQYA 5L7XH 5FYKD 2XTJC 4L8SA 1B2WH 4ELMF 5IIEA 5D5MF 1A6WL 1JWUA 2IFFL 4EVNA 3GI8H 1DQJB 2VABB 3PWLB 5ETUB 2P49B 3ZE2F 3W9EB 4G5ZL 3QIBB 3K2UL 2QQNL 4IRSB 4OCLC 5AAWA 3C5ZC 4UT7H 4U4BA 3U1SH 4PB0H 1MRCL 2Z8SA 4I0PA 3TN0D 2W92A 1KV3A 1K2DA 3S4SA 1IC7L 5IESL 1OLZA 1A6VH 1WQVT 4IDJL 4JAMB 4OF8A 2QHLA 4LGPB 5C0JA 1NAKL 35C8H 3REWB 3GKZA 1DUZA 4XZUA 3NOIA 1ORSB 2I26N 1JYWA 1FNEB 4ONHB 4ZAKD 2R2EA 1CFBA 4HG4J 4N9OB 3OJVC 2MQCA 4XAWL 4JGMA 4J4PD 2EEDA 3IFPB 3P11L 2WW8A 5TH2B 1FG2B 2RAMA 3UTQA 3QIUD 4KMTL 5CBEA 4GW4B 4NZUH 1I1FA 1ZK9A 3KJ6L 4RAUA 4KZDL 3G6JB 3OB8A 2HP4A 4IS6A 4TUKH 5KVDH 4NKMB 2QSCH 2V9QA 3WFCH 2XWJA 3LIZH 1M05B 4HMEA 3RQ3A 3VA2C 3BDYL 5F96L 3JBG7 5HD8D 4NBXB 5C0GB 4O4YH 3U0PA 3MJ8B 4YC2C 4LVNB 3T2PA 4U3HA 1QFWH 4IJ3B 4KGLA 1XGQA 1MHPH 4JJHA 1BIIB 3V4UL 2H1PH 3SKNA 2ZUUA 5C0CD 1TVBB 3HB3D 5J1AB 1RIVH 3QDGA 4GG8A 4P5MB 5C0IB 3SGJA 2ZOLA 1DBJL 3UJIL 3IAPA 5E7FA 1QSFB 3ETBF 5FXCH 2KQNA 2WBJA 4PJ9C 1X4ZA 2WQ8A 2QKIA 3EOBB 1PBYA 4JKKA 1OPGL 3N1GC 5CLTA 4Y2DA 5D9SA 5F3HA 3TN0C 4DKDC 4QGYA 4F7PA 1FP5A 3QA3A 1KN4L 2F53B 5KSBE 5ADOH 1TNMA 5F3BB 2HKFH 5ICXB 2PO6A 5JORB 2UUDH 4LU5H 2DQTH 3RGVD 3FN0H 3WJLA 1UM6L 4MQ7B 4NFCA 2GJZA 4KRNA 1HH6B 2ATPA 2EXYD 4E0RA 2V5RA 5IB1A 5HY9B 4TNWF 1JMXA 1T7XA 1X5FA 4RISL 1Z0NA 4GAJL 3U4EA 1QHOA 1MJ8H 4JN2A 4HJJL 3DVNA 4LSPL 3WDJA 1CGUA 4Z5RA 3P4NA 3TV3H 5CD3A 1VACB 4GRLD 3MCLL 4JFOA 4ODUB 3VFGL 3QIUC 4QHMA 2W9DH 4ODWB 5HGGS 1QBMH 5JW4N 1KBGH 1S7QB 3QUZB 3RDTA 3WO3B 2GUOB 5ESQB 3ARGC 4XCEA 3TESA 3QJHB 2PETA 5GGRA 3QZWA 4L8CA 1WAAE 4U1KA 4V1DB 5T1LD 5FAAA 4PGDA 2MWCA 2OK0H 4M03A 2M2DA 3OXRA 4HS3A 3UEZA 1JTOA 2JCCA 4UV7L 1QLEH 4OZHA 4PREB 5HD8C 1WITA 4X6EA 1T1ZB 3S9DB 1G7PA 1AD0A 4GJTB 4ZPVA 3PGCB 1A1NA 4N8VG 2I5YH 2FZ3B 3CZFA 3BX7C 4RAVB 1J8HA 2V2WA 1NGZB 3C87A 4WTWA 1K8DA 2K9UA 3KPTA 2BCKA 2J4WH 4LLMA 3OR7B 4P9HH 3HB3C 5HHXL 1X6LA 1HI6B 1ZANH 4LCYA 3K8LA 1XGYH 4DOHB 4NRZA 3LQZB 2NPLX 3CFEA 1JHKH 1IM9B 5DRZB 3UJJL 4M48L 3ZDXE 1G9MH 1W72B 3P9WB 5D7LE 1ZT4A 1K6QL 4JRXE 4HUKB 3RNQB 1FNFA 1QFUL 1FL3A 3NMEA 4D3CH 2CO7B 1KYOJ 4OAWB 2D7TL 2EO1A 3QWRA 2EXYC 5SWSA 2VDML 4X8JB 4EDXA 2BVPA 5I16B 1BVZA 3HAEA 4LCCB 1U8IA 4L4TE 3J7HA 4H20H 2LV4A 4MX7B 3LN9A 3W39A 4PJ8D 5GGSB 4F7CB 4G8GA 4U7SA 4O9HL 1FVCB 1UM4L 3ESVF 2O5XL 3P30L 3F58L 3C5ZB 1I3RB 2H3NB 2FX8H 5TDPA 1JTPA 1CLOL 3VJ6A 2JJVA 3PIQB 1P69B 4RX4D 1QPPA 5IVXF 5HYJA 5T1KB 1XF4A 3MA9H 4IRJD 4NNXA 3B9AA 3IJHB 4PS4H 1UB5B 4YX2H 2L7JA 4R4BA 2VWEC 4PJCB 3E6FB 1KB5A 1MHCA 4MSWA 4YE4L 1P4LA 4PRPD 3SGDH 3TCLA 4Y8DC 1R5VA 3VXQB 5FCUL 3HRZA 4Y19B 1FO0L 2QJDA 3DX8B 4NNPL 1A0QH 4Y5XC 5D6CB 4Z7WB 3HI6H 1X3DA 4GAFB 4Z7UA 4NO2B 4HUVA 4NHCL 5T3ZL 1OW0A 3TO2B 1AI1L 5DK0B 3D9AH 3T0XA 1I3VA 2QADC 3PDGA 1OY3B 3C8DA 3BKML 4ZUWA 3OX8A 3VXSB 4WW2C 4P46A 3T4AB 4C56E 3FFCE 4Z77A 1YYML 5AWNH 4CJ0A 2YXFA 1BZ9A 1CFNB 1G6RH 2A6KB 3N1MC 1GOHA 1A3RL 4G8EB 3FO2B 3AVEA 5MEQA 4PJ8C 2BDNL 4WWKA 3UAJD 1QEWB 1LE9B 1UWXK 5IK3B 2X09A 1F6AB 1I1AD 3BO8A 4GRWF 3HZKB 3GMRA 1TQBC 5E6YA 5I0ZA 5ID0B 3HCVA 1MCHA 2JIXA 4MQSB 2E9JA 3TN0B 1NC2D 3OR6A 3M45A 4P23C 3U2SB 1CBVL 4OD3L 4PTTA 4HKXA 3LQAH 5ANMB 1AFVH 2ZG3A 1G7LA 4IRJC 5E94A 5E8OB 4UBDD 1UCBH 1A14H 3AB0C 5D2LA 1I9RH 4Z0XA 4JPWL 4LPXA 4ZAKB 2X4SB 1NCDH 1CDJA 1INDH 4KY1L 2HT4C 1AGFA 4OI9A 4OJFH 1KELL 2HT3D 1J5OH 4MB3A 3GMNB 2YC1A 3OKMA 4UIMA 1L4IA 1SM3H 4OLWL 3NCBB 4WFHE 3HE6A 1I85A 1GOFA 2XXMB 3EKCA 4OQTH 1ZLSL 3OKKA 1XCTB 2I9LB 3VFNB 2DQUL 1MF2L 2Z35B 2QSQA 3DXAD 2IANA 1ACYH 5E1HB 1MPAL 2PXYA 3SOBH 3TYGH 1WZMA 1AXSA 2IPKA 4FMFA 4F2MA 4NO5B 4JY6A 5DJ0B 2X4TA 4JLRB 1E4XH 2CQVA 5F97E 3DMMA 2VDRH 5GGTH 1E6OH 3LKNA 2B4CC 3G9VA 3BD4A 4X4MA 5C0ND 4HPYL 5FGRA 5HHPA 5E6ZA 1SMOA 4GXUN 3BGFB 3ES6A 3FOLB 2OXHA 3MJGX 1OCWH 1YYLL 2ZNXA 3MGOA 4CN4A 4YBLC 3G5VA 1ZLUH 3K1KC 1A7RH 2D7MA 3UAJC 1ZVYA 4U1HB 4MNQE 4NN6B 5D1XB 1E6JL 3HG1B 2OSLA 1T21A 5EU4A 2F8OA 5I1LA 1AIFA 4HK3J 3S37L 5GZOD 4DQOL 4M7JL 2Q76A 5DFVD 3WEXA 3WIHH 5E6IB 1UWGH 4ZUUA 2VLRE 5MERB 3RGVB 4TSCL 2VIRB 2FL5B 3CX5J 1H3GA 4KK5D 4OZGE 5D71H 5BQ7B 3ARQA 3GSOA 5T3XE 4Y4FB 2APVA 3BP7A 1P7QD 5EZLB 4UOW1 3G5ZB 4F15C 2HT3C 4PJ5E 4U1IA 4GRLB 3LS5H 1OSZB 4PBVC 2ADJA 1UYWL 2HFTA 3GNMH 5I17B 3OKEB 4ZYKA 3WE6B 3WFBH 1CICB 2YR3A 4XC3L 3CSGA 5CHNB 4TN9A 4G9FE 3UX9B 4H1LA 4HLZG 1B4JH 3C60D 2VO5A 3UZEA 4DGVH 5EFIB 5T1LB 1BVKB 4Z7OE 5EUKB 2OR9L 3NPSC 1RFDL 3BUTA 3HMWL 1FFOA 2CDGB 3HNVH 4OUUA 3V0VA 2VXVL 3RL1A 3JWOH 2X70B 1QZ1A 2OTWB 4XCFH 4HWUA 5HVHC 3NIFE 5C0NC 1NFDA 2APFA 5DD5L 5C3TA 2OCFD 4L9LB 4FN0A 4LLUA 3QFJD 1N5YH 3QI9D 2KQMA 4XVSH 3RUGA 5TF1L 1JV5B 2IEPA 2OJEB 4QRPA 5D1ZD 1S5HB 2F54D 1PFCA 1KPUB 3KPRD 4LLQA 2VXQL 3MOBL 3GO1H 3WSQL 1U8PB 3OBAA 1NAMB 5JHDE 3M1BB 1YUHB 5AZ2H 3QQ3A 1NDMB 1ZSDB 3DBXB 1CR9L 1T4KA 1KNOA 1MRDL 4WHTB 5DFVC 1A7NH 3CFCH 4NHUA 4AJ0A 2NY6D 5FM8A 3QO1A 4XXDB 1FZJA 4GQPH 1A4JA 2DYPD 3SDXA 4LPWA 4X5LA 5DVLA 3JWDH 5A40E 4AIZA 1WLHA 2WUBH 4MCZB 5HHVL 5JZ7C 5JHLL 4IOFD 4FXGA 1EXUA 4PJ8B 4XTRD 1KXQE 4LVHB 4J3WA 5F89B 2BY0A 5DUPH 4POYA 3SGKC 3V6FA 2VAAA 5EZOH 3DGGA 3BKYH 1H9VA 3TIDA 3QEGL 3MRMB 3FQWA 3H7BA 3EBAA 3V52H 4NQDE 5IHZB 5IWLC 5B8CA 2DLGA 3HPLB 2ZPKH 1UWEH 4F7TA 2X9XA 1GYAA 3QCTL 5EA0L 1P84K 3SQBA 1FORL 5DUBA 5B38A 1YEKL 1JGEB 3BT2L 1LILA 3QFDB 4PJ9A 3HLAA 2V7HB 4PRPB 2AK4D 3QI9C 5IMMB 4M7KH 5GIRA 3HUJB 1PG7L 4C83A 1KCSL 3FQRB 4OCSL 4JY5L 4OZHF 4JM4H 4WO4D 5BRZA 5D93B 1MSPA 4I77H 2YA2A 5D1ZC 1E27B 2DQFA 1DQLL 1BZ7A 4R8WH 4PV9B 1IGFL 4LRIA 5F6IC 4PJ7A 1G0YR 3MO1A 3PWVB 4UOW0 3SDYL 4RMUA 4PLKD 3QHFL 5C0AA 2RFXA 1FRGH 5DTFB 3ZZ1A 3FT2B 1MH5B 5CSZB 1IAII 2C1PA 4Z9KB 2GTZA 1GGIL 1RIUH 4JFDD 4OBSA 1FNGA 5E00B 5KVFL 3A6BL 2NLJA 4JO4H 3FONB 3ARGA 4XBGA 5JR1H 3RKPA 2MFNA 1KTLB 3BIBX 4IOFC 5KSVB 3BYTA 2YK1L 4X6CE 4XTRC 4OZFA 2UWEB 1JMZA 4XHJD 1I1AB 3DETD 3IF1A 3L5WA 4LEOB 2EDNA 2OL3A 5C0BD 5I76B 1DQML 3MRNA 4HIEB 2EDBA 1LO5B 3SDDA 5EH1A 2F8VA 4YR6B 2E7HA 3MNVB 4HT1H 2YPLA 4I2XB 3LY6A 3ZLQC 3DX7B 1CFTB 3U7AA 4WU5B 1BEYL 4MDIB 1R3KB 4PP2A 5C6PB 2W0KA 5FFLA 3MRFB 3NCYS 4FQ1L 4QYOA 5F7EH 2DBLL 1GGBL 2ZUXA 1BAFH 5K9KB 3S98A 4B5EA 4JDTH 1U9KA 4WCYL 1H8SA 3O41A 3T0AA 1GHFH 5HPOA 3CIQA 4BQ9A 4GG6F 3HI1B 3PWUA 2FCBA 4F15B 4G9DB 5ESAA 4QNPE 3O6MH 2ZG2A 5FUZL 1ZGLA 4YPGB 5FGBC 4AG4L 1MWAA 5I1AA 1UQSB 3S5LG 3DXAB 1MCCA 4JO3L 1FBIH 3DO3A 1YEFH 1BBJB 3AXLA 4X6BB 4LSRL 1LO0H 4WEMB 1MAKA 1XGPB 4DN4H 4LLYB 5JOFB 3F65A 4XPBL 3IFNL 4KH2A 3O4OC 1RUPH 4PLKC 2LTQB 3R4DA 4LPTA 5E2JA 4Z18A 4Z7UF 4JVUA 4UTBL 4FQ2L 4HJ0D 2NZIA 5JW4R 4LCIH 4FTVD 4RFNC 3NTCL 4X9FA 4L8DA 4OLEA 3NN8B 3JUYA 2FR4A 1M71B 1QBBA 3C6SB 3ZYJA 4NBZB 2YMXL 3HFML 4O51A 4MQTB 2VB5A 1NGPL 1NJ9B 3EFDL 1FH5L 3O2VL 4HEME 4XHJC 4F57H 1XGRB 1KACB 2AEIT 3DETC 2G75A 3OAYK 5CJ8A 3DV4A 4PTUA 5HGBB 2ZCLL 2E9BA 1T5XA 4GQ9L 2XWTB 5F7WC 1NLDH 5EU6A 1T2JA 3DYPA 4KK6D 4NSKB 1U8MB 3LAFA 3IVKB 2I9TA 3V8OA 5ERWB 2XZZA 4KHXL 5DJ6A 5KW9L 4ODSH 3QG7L 1UZ8A 4GRMA 3V5HA 1LO4L 2CKBH 2EE2A 3V8CA 3W5NA 3KPOA 2JCCE 4RMWA 4Z7VA 4RCAA 1MIML 5T3ZE 2R0WH 2OL3L 4LNRB 4UQ2A 2YPVL 2NY7L 5T1DL 2HTKD 1JGLH 4K3EH 3VD7A 1P7QB 4I9WD 3CJJA 3QHZH 3JZ7A 2F19H 4JFPA 4DGIL 5IMKA 5D2LF 3QQ9D 3Q6FA 1S7VB 4NRYB 4WW2A 1FGNH 4OCRH 5CKGA 1YN7B 2J6EH 2HKHL 4LMQI 5DD1L 4QHUB 2GJ6E 3T0EA 5FA3B 3C60B 4S1RH 2DLFH 5HDLA 5KVGL 2OQJA 3IDNA 3QB7C 4HLZH 3OTTA 1MIEH 4ZSOA 2R9HD 5K93A 3GHBL 2VMFA 4HJ0C 4YHYB 2YZ1A 1MWAL 1HHHA 3DGCR 5LWYL 1G6RB 1W0WB 1T2QH 1MCWW 1WJ3A 4PJFB 3QI9B 5FO8A 4Y16D 1XGTB 2J8UB 4WWID 4XMPL 4OZIB 5IVZA 4P23A 2ZUYA 4X7SL 4UNUA 5IFHL 4K3HA 3P4LA 4HZLB 3DYMA 1INQA 2Z92B 5L2KA 1WWAX 4CW1B 2F54B 2IALA 2EYTA 3KPRB 4G8GE 5KS9B 1H3PH 2EH7H 2EC8A 4DCQA 5DQJB 1UACH 2QSVA 4BZYA 4DTGL 2QR0B 4EUPH 2P45B 5DVNA 1BF2A 4BFGA 1WISA 4KK6C 2BC4A 1L7IL 1MREL 5HYJE 2IAMD 2NY6B 1ZA3B 4MA1C 2AJUH 3B5GA 1CGXA 1U92A 1RUAL 3KHQA 4QRQA 3P3YA 3WDIA 5KAQG 5F9DC 3WXVH 3RBSA 3L5XL 3L5IA 1JPGA 1NCCH 2YA1A 2HTKC 5I8OH 4NOBA 4K8RH 5I1KH 1R3HB 4EKXA 3L5HA 2VXTL 3RAJH 4X0KB 4ORGB 1H5BB 1QVOA 4P59L 1I8KB 4AEIH 5DJXB 1RJYB 3P4OB 1BVLB 5IB5A 3RWHA 1D5IL 3VG0L 3IDJA 4F7EB 5HHOB 1IC7H 3HAEG 3JV4A 3JUZA 3TT3L 3NH7L 5I75B 2XY1A 2FRGP 1NAKH 1Q1JH 1FAIH 4YFDB 2A73B 2P48B 4EI6A 1BHGA 3DROB 3KLHD 5DHXB 1BP3B 4NJ9L 2AJSL 4PJXF 3KWWA 4R3SB 1J11A 4QCIA 2D4DA 4X5XB 5ILTL 5CP3H 2ED7A 4HFWB 5FKAA 3L95B 3I2CH 4XP1H 3QUMB 3VXUD 4G8FB 4WO4B 4KAQH 1B9ZA 4LARL 3VXMD 2BNQD 2NYYD 2VDLL 1KTDA 1SY6A 5SX4I 4BKLA 4N0FB 6CGTA 4WGWB 3RUGF 2EDYA 1V7MH 3KDMB 2E8YA 4WEUD 1DL7H 1TVDA 2W07A 2ED8A 3O4OB 1RZGA 4NFBA 5DC9B 5I0DA 3NGBC 1J1OH 1RMFL 3STZB 3SDCC 1DLHB 1ZTXL 2PTTB 3W2DL 4RFNB 3BDYH 1F58H 4JFDB 1DBAH 1OGAE 2DWEB 4PJCF 4R4FL 5D2LE 3T3PE 3N85H 3SO3C 3VDAA 1NLBH 2H8PB 4LSQL 5BV7H 3N9GH 3DX9A 3I02B 3QWOA 4M02A 1AQDB 4NZRL 1FGVL 4H8WL 4HAFA 1D6EA 3LV3A 3VRLF 5KTEH 3REVB 1IQWL 5IJVA 1JPST 3MV9A 5MI0B 5C0BB 1HSBA 4F37F 3OHXA 3NACH 2FIKA 4DEPC 2CDEB 3ZMRA 2FYYB 3K81A 1FHGA 3IFLH 1KJ2B 2A38A 5F7DA 2DJSA 5DJDA 4M8QB 3G6DL 4RMRA 3ZDYF 3STLA 2AAVA 4OFKA 4H25B 1QLFB 3GI9H 4K3DH 1ZLWH 3KLHC 1GGCL 3CSYB 4X4ME 2B4CL 1QQDB 5I73C 4EEEA 3D39A 4OGAD 2EIZA 4M7ZB 4BSWB 3VXRA 1M7DB 2X1PA 3EJJX 1T03H 2H6PB 3S96B 4EOWL 1RZFL 3PJSB 1A4KB 2ICCA 4J3UA 2Q6WB 4HH8A 5BVPH 3FOMB 1HDMB 1F4XL 5GRJH 5A16A 3LRHA 3NFSL 1H15A 2WIIA 1ONQA 1ZGLM 5MENE 1HINL 2A6IB 3FRUB 2PW1A 3D2UA 4P4KA 1HXYA 1GZQA 2XRAH 4MJIA 4RFOL 1T04A 3LH2H 1ZHKB 4FTVB 4XP5H 2P7TA 3SGKA 4F8QA 3VXOB 3PWPA 4OLVL 4ZFFB 3NFNA 3F7RA 4PJ7F 2NCMA 3MREB 3JV0A 2CIKB 1Q9OA 1B0RA 1FQ9C 3I6KA 2BXZA 4K7PY 5IWLA 4BSJA 4UIKH 2AJZA 1U2HA 3BDBA 1HEZB 5KJRL 5GJTH 1KG0A 2AV7A 4NUJA 5IW1B 1S9XA 4LP4A 4C59B 4I4WA 2NY5H 2C7UB 3IXTA 1LO2H 3D69B 1MAMH 5L9DL 3ULUL 5FO7A 5HPMB 3V6OE 1IC1A 4Y4HC 1B0GA 3N50A 4NT6A 2R2HB 3C5SB 1KC5H 5FYJH 1CIDA 3HNSH 1G7HA 5DEZA 2NXZC 4UV4H 2D7TH 4W4OA 1ZHNA 4PBWD 4HKJB 1TQCC 1QRND 5DUML 1NFDE 2JB6A 3GB7A 3T0DA 1AGDA 4MA8L 5DK2A 5E8EA 2DWDB 3RUGE 4F33B 4FABH 4WJ5A 4MNGA 4B7LA 1BWWA 4KK9D 4WDIA 4XPGH 3WFDH 4F3FB 4QRPE 4OTXH 3LSOA 4WI4A 4KI1A 3WFHB 3WFEH 4LKCB 1F3DH 4PGBB 1FDLL 2IH3A 3EO1B 2AXFB 4WEBL 5CZVH 1HHJA 1I7RB 3MJ9H 4F7MA 4P99A 5IGXH 1CCZA 3BZFA 4QKXB 3EGSA 1JK8A 2Z8WC 4QTHB 2HFEB 4P2CG 1LMKA 3BOVA 3SDXE 2WIMA 3RP1A 4Y16B 4H1LG 3SKMA 4PRAB 4WI5A 5KOVC 5GPRA 5L2JA 1OF2A 3UYOD 2X89D 4NJAL 4JFXA 4L4VD 4KPHH 1MEXH 4NQTA 4TQEL 4D8PA 2FLBT 3U46B 3UO1H 4C57C 1WICA 1TETL 1HILA 4CKVX 3UPCA 1QR1B 5K9OB 3GMLB 3NGBB 5LQBL 1YEJH 4RSVA 2BNRE 2AK4A 3C5JA 3PNWA 4MJ5A 1SYSA 2IAMB 2PYEA 3B5HA 8FABA 3D3VA 2CXKA 4Y1AD 3DVGB 3MJ7B 5FGBA 1FG9C 3QNZB 2SEBA 4YFEA 1OSPH 3RVWD 3B8SA 3NZHL 5I66B 2A74B 5M95B 1FJ1B 3Q0HA 3VXNB 1KXVC 1P7KA 5C9JA 1H3WM 3E2HB 2A6JB 1FIGH 3AS2A 1C12B 1Q38A 5GRWA 4EJ1C 1NMAH 4OCYH 2OZ4A 1TITA 1IGCH 1FNLA 1JRHH 4LEXL 2B8OT 12E8H 4KK9C 4Z7VF 3WBDA 5BRZE 1OAQL 3OKYA 2DQIH 5I1EL 1Q9LA 2FJHB 3BISA 4YNYA 2IWGA 3RY4A 4BFEA 1Y6KR 1A6ZB 1OGTB 5DJZA 3MUGA 4PG9A 4DEPB 3LRSA 2G60H 3C9NA 4MXQD 2NQCA 1KEML 4WW2F 3V7AE 2NX5A 1FLRL 5DLML 5C0AE 5HI5D 4GUPA 4X5WB 4PJIB 2W9EH 4KK8C 1RY7B 1GGYA 1EEYA 1TJIH 3BAEL 2XOTA 4HS6B 4JCMA 5EU3A 4BYHA 5C08D 1MFEL 2OXGA 3GDBA 1BOGB 4D2NA 4BQ6A 3MODH 1IKNA 1DUYA 2DQHL 5EUOE 3VXTA 3U83A 5DZOA 2AEWA 4DVRL 1JNJA 2I25N 5F44A 1F90H 3MRCA 4P2RD 5B38G 3VXMB 2BNQB 4NKIL 2G5BA 1ZLSH 3AU1A 1OTTC 5DRXB 3MA7A 5SX4H 2CLZB 1DEEB 1ZEAL 2IG2L 3HI5H 3D48R 1NFIB 1ZV5A 4LIQH 2CKBB 1LNUB 5DVMA 2HFGH 1WZ1H 4GS7B 5IFJA 3ZTJG 4WFGD 2F8XC 5DURD 1AO7D 1CDCA 4XCCL 4K7PH 3EYFA 3RVWC 1DSFL 1G7MB 1FVDA 5D1QD 3W9DB 2VDOH 3KYMB 3GIVB 4PJAE 1A22B 3V7AG 3GGWA 1Z9OA 2R29L 4LKXB 3RY5A 5GRVL 3GSNL 1C5BL 1T6WA 4G42B 3VFTB 1T1YB 1CXIA 1HHGA 1UXWA 2R15A 2I60L 4YHIA 5DS8A 5HGAA 3OKLB 1LD9B 2YOCA 2FLRT 4JZOA 4QF1A 4X4XB 2EC9T 4ENEC 2VNCA 4MZ2A 3OZ9H 2Y5EA 3S37H 2QHRL 3FHQA 4L3EE 1T0PB 5BS0D 1EX0A 3QJFA 4KI5C 2YUWA 2EIBA 5HI5C 1YJDH 4N5UA 3T4YA 5TE6H 5D72L 5C8JA 4LQ1A 5GGQH 1BGXL 4OLXH 1I4FB 1J1PH 3QNYB 3S35H 1AKJA 4PB9L 4X7TB 2GW5A 5J9PA 3NIDF 4LCWD 1IMHC 5FKPA 3MLYH 5HYFA 1RJCA 2UWEF 1D7FA 2P8LB 5ITBL 1R3JA 1EMTH 1SQ2N 1LP9B 4EUPB 1I7UB 1WFOA 2X4NA 1J9CT 4PR5B 1DFBL 1M4KA 4OIAA 2VDKL 5JA9A 3JXAA 4CMMA 4LAJH 5IEHB 3HC0B 5EU6E 3QEQA 3M17B 1KYOK 2WLYA 2NY4D 1W8OA 4JFZL 1IL1A 1RVFH 4N0UA 2ADFH 4HFUL 5DT1L 1YECH 1WEJH 4L4JA 5ITFA 5IBUG 4QRSA 3O4LA 4QRRD 5D1QC 3SKOB 1T6VN 4H88L 1L7TH 4IEFB 3VD5A 3ZSSA 1IGML 1T22B 3M8OH 4RGMC 3BRDA 5HYSA 2AW2A 4S10A 4QXTB 3U4AA 5GGVH 1NCUA 1A9EB 3IAQA 4HW6A 4KJYA 1WV7T 4TPRL 4TSBH 2X5PA 5CZKA 3BKJL 3KYKH 4UINL 1MUJA 5EB9A 3T0EE 1XF2B 3C09C 3QIBA 5IMOA 4WNQB 5HYQB 1M6OB 4G7VH 1NGXB 4XX1E 5IG7B 5C0RH 4FG6D 1T7VA 3LEVH 4P2YA 1E28A 4GXVH 4NOFA 4ZSOE 4K55A 2XACC 4JKLA 3VWJD 2AJ3A 2IFGA 3JV6A 2X9YA 1QRNB 3UPAA 3WXWH 2FWOA 2ESVE 5D7SL 1A1MB 3SDCA 3V95A 5HYEA 1MCEA 1V3JA 3VFRB 3QH3B 5F9JB 2OJZL 5L2KE 2V2TA 1EHAA 2MPAH 3KLSA 4GMSL 5K9JH 3DI3B 5DHVB 5K9QG 1JZ2A 2A77L 1MI5E 4HF5L 2CMRL 1INEL 1FFRA 1J18A 1T83C 3LKOB 3BP5A 4F8TA 3QIWC 2NY4C 4JFYB 3BJLA 3UTPD 2H9GA 2VLJD 3NPZB 5TQ0L 1VADB 4HK0B 2W1NA 5BV7B 1AGBB 4NKMA 2V5TA 3VFWB 1C1EL 3DV6B 4GAYA 4LCUB 1LE5B 5C09D 1F3JA 3CXDH 4L4VB 5MEOA 2A6DA 5F9WB 4NWUH 1P5UA 4XVUD 4Q2ZB 4HXAL 3J8F7 1TXKA 1TVBA 3V4PH 1K4DA 4U31A 2DDQH 4FZ8L 4CUCA 4JHZA 4PRIA 4Z76A 4X6FB 1LDPH 3ULVH 1A6UH 3MXWL 4FQJL 1NEZA 4UOJA 4QOKA 2Q7NA 3KXFD 4M61A 1IAOB 1Z3GH 4M4RA 5FYLE 5GRXG 4KMLB 3F7VB 3VFMB 1S9WA 5EO1A 3H42L 4PJFF 4JFQB 1N64H 1A3LL 2D7NA 3K80A 4UQ3B 4GKNB 2G5RA 4CVXA 1B88A 4MQ7A 4S1QH 1T1WA 3QG6B 5CBAA 4NQSB 4QT5B 3FB6A 3UBXG 4G3YH 4PG2C 2VQ1A 3B8YA 4ZXBB 1HKLH 4RGNE 5ISZD 2HRPH 5J3HD 1MJJB 4I5BB 3IGAB 5DVKA 3TBVB 4ODUA 1CG9B 2VDQH 4OV6F 4OBRA 3FQXA 3NCJL 1CE1L 3BPOC 3QUZA 2PYFA 2VXUH 3G6AB 2OI9C 3QUXB 4Z6AT 2YD1A 3GHEL 1N2RB 2WMPA 1EHXA 4YZFF 3CLEL 1TIUA 1U8NB 4M5ZH 3ULUE 5KN5B 1X44A 1X5ZA 4HGWB 4I0KA 4P49A 4Y4HA 1KCKA 5IV2A 3WL9B 2ITDB 3K1DA 1JNLH 2KZ1B 3KR3H 4FFZL 1EK3A 1RUML 1E4JA 4XVUC 2VXSL 3RVUD 1R6VA 4XBEL 5IJKA 4I18B 2R56H 5E99H 1GZPB 4NRXA 4UB0L 1KSRA 4F9PC 1JP5A 3IRPX 5EU5A 2FJFA 1I9JH 4ZUSA 2XZCH 3LQZA 2NW3A 4UILH 1UADC 1J87A 5DURB 1AO7B 4BFIB 1OQXA 3EYQC 4N8CH 3UTZA 3ARSA 3U9UB 2XFXB 3TBWA 1RZKH 3ARFD 3TJHD 2YHGA 3MNZA 3U7WL 4POZC 1FFPA 4YUEH 1CQKA 5DJ8B 3D39E 2VITB 4YBHA 3GSUA 3LN5A 5D8JL 1IEHA 1N6QL 4GT7A 3VXRE 4X8JA 4TRPH 1TPXC 5HSFA 2J7LA 2ZCLH 1RPQA 1RZJH 4MX7A 4UAOC 3WS3A 2ZP0T 1XCQA 3DOSA 2VN4A 1JYVA 1H3TA 3C09B 5TPWH 3FMGL 4N68A 1QA9A 3ZT7A 3EDKA 3FRPA 5BS0B 2P44B 2LU4A 4MVBD 1FV1B 4EI5D 1D5XB 5KW9H 2Z93A 3PIQA 4PRHB 4D0DA 3P4MA 3D18B 1JHTA 2UY7A 3BUYA 1A2YB 1RULL 4PLNC 3PWPE 5HI3D 1EVUA 1MFDH 2F58L 3H9SE 1MVUB 3FQNB 3EDDA 4LCWB 1DBMH 2XNAB 2ZUQB 4N0YH 4WY7H 4L5FL 1XIWC 3MFGB 3WMSA 1DN2A 3UTTB 3GJFH 4YGVB 2BVQB 1RK0A 5I18L 5DJ2B 3V0WL 3ULVD 2YS4A 1CFSB 2ITCB 1CLCA 1BD2A 3D0LB 3I85A 5C07A 3BMVA 2GCYA 2NY4B 3IDMA 4X80L 5D2NC 2F15A 1KLGA 1NGYB 1D5BB 1MCIA 2PCPB 2GTWA 3ARTA 1CK0H 2DRUA 4NKDB 1IM3A 2EDTA 1IJ9A 1YDPB 5IHUL 1MLCB 2HJLB 3O3UN 4QRRB 3L3HB 1KPVB 1KIQA 3CD4A 3CFBA 3H9YA 3OAUL 3VMNA 1QO3B 1W0YT 1RHHB 3HZYB 2Y06L 4M6MH 5IB4B 4L3AA 3NFPA 5J8OA 3IFOA 1CFVH 5FA4A 3L3DB 4U49A 4MNGE 5TQ2H 1BFVL 3VFUB 1QFHA 4JO2L 4FFWD 4DTGH 3MSPA 5GS2H 2IPUK 3MV8A 5E4IA 3BE1L 3E1F1 1MCOH 2ZOKB 4IM8A