2MMXA

Nmr study of 6ajl2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
111
structure length
111
Chain Sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V1-22 protein
publication title Solution structure of 6aJL2 and 6aJL2-R24G amyloidogenics light chain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mmxA00
3ILPB 4GXUN 4HIHA 1HOCB 2AW2A 3RAJL 4NQDB 4U3CA 1CLYH 2D31A 2P44B 3KPPB 4RNRB 3WNNA 4WU7A 3RU8L 3WIIL 3HAEG 4K3EL 3T1FA 2BXYA 4K7PL 4JFZH 2L7UA 1NPUA 5D7KE 4HG4J 4KDWA 1JNJA 1IGJB 3CK0H 2VLMD 4PJGE 1EMTL 3OJVC 5FOJA 5D9SA 1YMHA 4NUGH 5F88B 3FQTB 4JZJB 5ACZA 5JOFA 3QG7H 4YHML 1WT5A 5AYUH 3SGEH 5HHQA 3LEYL 2OJZL 3TO2A 2VDOL 2HJLA 1DL7H 4MAYD 2XWBA 3RL2A 1HNFA 4YPGA 5EBWB 3WNKA 2IANE 2NY0B 2AABH 3SDXF 1Q0YL 3SO3C 1BF2A 3CDFA 3W0WD 1ZWIB 4I18C 5DXWA 3F7VA 4H25B 4KQ3L 4Z7VB 1FFRA 1ORQA 3HG1D 3UTPE 4KI5F 4HBCL 5SWZA 1BVKB 1FL5B 3RUGF 2DQEH 2MCPL 1FFNB 5CWSA 1DANT 1KG0A 3OB8A 4H0HB 1XF5A 2WWMC 4PJDA 1ZEAL 1NGXB 4Q2ZA 3GSWA 4GG8A 3ARPA 4GKZB 3T04D 5D1ZA 2DN7A 1B90A 1LDPL 2DS4A 4JPWH 1GOFA 3FN9A 3LKOB 4KUCF 4LLMA 5FGRA 3ZKQD 1P84J 4XCEB 2R1XA 4H5SB 1R3HB 3ZDZE 4ZUSB 3RGVB 1QP1A 4UUJA 2O5YL 5DD3L 1X5AA 1FIGH 4PJXF 2XNAB 4JCLA 4X98B 4HAGA 2PTTB 2R4SL 1MFNA 2NXZB 4LIQH 3DGCR 5ALBL 5DRWA 5DA0B 2IBZX 4O2CA 4QHUB 3VXNB 1OTUD 2Z35B 5GGSY 4QTIH 4ZOBA 4KKBD 3WL9A 3U6RB 2VDQH 5IROC 1A2YA 1OAYH 2Y5TB 2P24B 2B0SL 2DJUA 4DN3H 5C3LD 4KU1A 3HNSL 5C0RL 3R1GH 3FHAA 4I1NB 2ZP0T 4PJ8A 2OJEB 3V4UH 3LMJH 1J0IA 2UYLA 4JZNA 4O00A 4ISVB 4PREA 5CINL 2A1WH 3MODH 2YRLA 4PJ7A 3AROA 3B43A 1E27B 4J3SA 4XVSL 2LFGA 4F7EB 3D3VD 1NGWA 3CFEB 1AXTH 1HWHB 1CGSL 3T4YA 3FB8B 1XR9B 1T22A 4N90E 3HR5B 1BX2B 2RGSA 4GRLD 5F7KC 3C6LD 2IC2A 2PNDA 5D2LF 5FK9A 1MCRA 5D1QC 1V8HA 3IXTB 4EUPH 4FFVC 4IHOB 5D7JA 1G0YR 2YN3A 2YXFA 4NRXB 3UTZA 5JHDB 4AMKL 1ACYH 4X6FB 4OZFA 3L5JA 1KOAA 3QHFH 1CDUA 3BN9C 4NRZB 3QCVL 4JO1L 5DJ8A 5D1XD 3LQAC 2EDXA 2ZSVA 4Q6IA 6FABL 1R24A 5IF0A 1LMKA 3U9PH 3MLVL 1KIQA 1DVFA 1PQZB 4OSUL 3U1SL 4TUKL 1MJ8H 1XGUA 2NY3C 1JPGB 1YYML 2VLKE 3CFKA 3K8LA 5I1KL 5DTFB 1KB9K 2OL3A 2W65A 4X6CE 3O45B 3K74B 3DTXB 4LLQA 2D4DA 2UUDK 4TNWF 1HHHA 5E1AB 2F53D 5HGDB 3S88L 3T2QA 4M8QA 5I1JH 1T03H 5HVHC 5IVNA 1GL4B 4N1HB 1MFCL 2HA1A 3OX8A 3T0EC 4HKZA 5L9DL 4XPGH 4UBDD 4P4KC 1QLEH 3MLWH 2O61B 1LEGA 4BH8A 5TGBB 3T1WA 4LVEA 2EC9T 1U8OA 5FM5O 1JWSB 3GSQA 5F7WC 1JPTH 5GRUH 2B2XH 2XZQH 3IF1B 4QHNB 5JMOC 3TIDA 3MV7E 3KPSB 4LCUA 4KV5E 4KRPC 1NMAH 3MBEA 2YPLA 3F65A 4JHWL 4FFZH 2V5RA 5SX4I 4G8FB 4LSUL 1S7TA 3MCLH 4I18A 1NFDE 1U8JB 3HAEB 4JFOA 2AJYL 3DNKA 5DEFB 4XC3H 1CF8L 2ERJC 1H8NA 2Z9TA 1I3VA 2ZCLL 1OSZA 3GKWH 4YDJA 1BWWA 3CSPA 3NOIA 4MB5A 1P7QB 1W8OA 3MXVH 1E6JH 3EIFA 3IDYC 1IAIM 5DRXA 4WFGD 3V95A 4OBSA 3BRGC 4JJ5A 2YK1L 1NSNH 5BJTB 4RISL 1FN4A 2ZKHL 3HE6A 4OGXL 1YA5A 2HFEA 3P0VL 3FCTB 3VI3F 2JF1A 4G8GB 5F7EL 5DJCA 5KTEL 4QOKE 4OM1L 5LGHH 5FCSH 1GZPA 1TJIH 4S1QH 1PG7H 1OARH 1OTSC 2IF7A 2HLAB 2D7PA 3IDXH 3GNMH 4X6DE 2P49B 5C07D 4XBEH 2I9TB 2VDRH 2X4SB 1V7ML 1RIVL 2KKQA 3BQUC 3GI9L 5GRZA 4OV5A 2EDLA 2QJDA 3FB5A 1FYTD 1P7HL 2Z4QB 3VU2A 5IBLC 2CKNA 5CBEA 3T4AA 1AGFB 5DMJB 1ZAGA 2IMMA 5IROA 3W5MA 4PY8I 5C08E 2OMNA 1BGXL 2VQ1A 3H9SE 3BRFA 1DTUA 2ZUTA 1QD0A 3ELAT 1EHLH 3RL1B 1FL6A 4Z78A 1BBJA 3WMSA 5TFSH 1S9WA 4MJ6B 2FSEA 4YX2H 4HC1H 2B1HH 2EIEA 1U92B 1QNZL 4PG9A 4UAOC 5DHXB 3H7LA 5JZ7C 4XP9L 5HVHB 4EOWL 5JR1H 3L3DA 3STBA 3NCBB 5L88H 3PDDA 1XGQB 1AGCB 4MGXA 2R2HB 4ZS7L 4ZNCD 1QLFA 5FGCB 4XXDA 4WJ5A 3HLAA 4ZXBC 1WAAA 4GBXC 4NQCB 1P4IH 3C2AL 2D2OA 3IDIB 5GS0C 4IBLT 4M5YH 5IUSA 4RFEB 1YNTB 3WIFB 2FDBP 5D1QA 4OZGF 1L6XA 3O4LE 5L2JA 4R26H 1T0MB 4LU5L 3DX8A 3SPVA 3INUH 2C3HA 2RIKA 2DIBA 5ESQB 3KPRB 3CIQA 4H88H 3ULVL 1NC4D 5ICYA 1L0QA 2J3SA 4MA8L 4DZ8A 4HPYL 4X99B 4TNVK 4JY4B 4AEEA 5JQ6L 4IDJL 2XY2A 3GB7B 4APQC 4XX1E 1OCWL 3TBTA 4AM0A 1YN6B 4P59H 2B5IC 3U48A 4UQ2A 4YO0A 4LP4A 4C56B 2CGRH 4PGCB 4DVRH 4YHIB 4Z95L 2NY2C 5K9JH 1T4KA 4PRHB 4F7CB 3C08H 4N9OB 2W38A 4YBLB 5C2UB 4RFNB 2R56H 5K59E 2GCYB 2ZOKA 1OT2A 3AAZA 3SO5A 1A4JB 1YEEL 2GK0B 3KYKL 3W9EB 3QXDA 3PNWA 4OF7A 2B39A 1QG3A 4HGMA 3SGEI 1CS6A 4MB4A 2A74A 4K2UL 4NZTH 5FCUH 4LLVB 4P4KA 3BQUB 3QZWG 1J86A 4PJIB 4NJAH 3U7YL 4NPYB 2AJUL 1MHPH 5DC0A 4FQJH 3DO7B 5IB1A 2OTWB 4MXWH 5MENE 2HN7A 3LN5B 1QSVA 4NNPH 3HHRB 4BQBA 3RAJH 1N2RB 3D39D 5M7QA 4XHQA 3IDMB 3OJ2C 2FYYB 3L6FA 4L3CA 3RU8H 3WIIH 4HH8A 4K3EH 4QRSB 2DM7A 4EJ1C 2E7BA 1NBZB 4QHMA 3HUJF 3E3QC 4JFXB 1J12A 3TYGL 4ODXB 3GBNL 4LIQE 1EMTH 4HUMB 3VWKA 5EU5A 2BCKA 2D03L 4ZTPL 4ZDHB 5JXED 4YHMH 4HX1A 3BZFA 3LEYH 1JNNL 3VFNA 4IDLA 2VDOH 3IU3B 4ZNEA 2YZ8A 5CIPB 1RVFL 5GGVY 3QUMH 4IJ3B 3FO1A 3BMVA 1Q0YH 4I4WA 2P48B 4U1SB 1XFPA 4EIZC 3UCRA 4NUJB 3HRZA 4JM4L 2NY1B 3R06B 3PP4L 4KQ3H 1JGLL 1BMGA 5DS8A 1RZFL 4HBCH 1UZ8B 3ZKMD 2DQTL 3WSQL 3QFDA 2Y1VA 3O41B 1ZEAH 1XF4A 5HGBB 4ELKB 1LDPH 3IDJB 3U2SB 3WFBL 2YZ1A 5E2TL 4XCCL 4X5XB 4CVZB 5IB4A 4PJCF 4AH2B 3OXSA 1SQ2N 1QSFB 3K80A 1E4WL 3OXRA 5DJDB 3ZE0F 1MPAL 4OFYA 1YY8A 1DUYB 3CXHJ 1P5VA 4LQFL 2O5YH 5DD3H 3WD5L 1O0VA 2I5YL 1HHGA 3WLWC 2R4SH 4HT1L 4WEBL 1J05A 4HWEL 3Q48A 2CIKA 5L7XL 1SMAA 2DJ4A 4XBGB 3MJ7A 4QRUB 4CADA 1JF1B 3B8SA 4ZUUB 3SY0B 3G08A 1GH7A 3S4SA 1OT1A 2GT9B 3RKPA 2WUCL 4PJFB 5FGBC 2QKIB 4ZXBA 4GBXA 1UB6A 1XH3A 3HNSH 5C0RH 4ZOAA 1UH4A 1KCUL 4L29B 4ONGL 4L3EB 3WCYA 4JFYB 5CINH 5FUZL 3NCMA 1C5BL 2D0HA 1NUFA 1WZKA 3PHSA 43CAA 5J13B 4PRAA 1KXTB 2QEJA 3WYRA 3ZYZA 4NDMB 1VEOA 5CZVL 3VFVA 5I9QC 1EJOL 3OR6A 1CGSH 4JFFB 1WF5A 1VFBB 3NGBC 2HYMA 2WWKT 5H2BB 1TZHA 4APQA 4LCWB 2NX5A 4NO5B 4HWBA 3RZCB 3MYZA 2G2RA 4OCXL 5JW5A 2FGZA 3ZDYE 1OP9A 3L1OL 4NFDA 3Q3GA 4EEEA 2AGJL 2HTLD 5HHME 4AMKH 2X89A 1CD1B 2XN9A 5I73C 3FFCA 2DF3A 5CJOL 3MC0A 5DI8B 3BPOC 3VFGL 2MFNA 1BD2A 3GBML 1BVLB 1I1CA 4CN1A 4UTBL 3ARVA 3QCVH 4JO1H 3EYSH 4RAUB 4QY8B 1ZK9A 3VA6A 2H2SC 4YE4L 3G5YA 3MLVH 4XP6L 4Y1AA 4OSUH 5F96L 3V8CA 2VDNL 4TUKH 3U1SH 4WY7L 4C55A 1U3ZA 1YYMH 1F02I 3A6BL 5H37H 5I1KH 1J5OL 5F7FA 1Z5LA 2BFVL 4L4VD 1UGNA 2JCCA 4OCMC 5DJ6A 4ONOA 4Y19D 1S8DB 2Z92A 2GUOA 3S88H 2DRUA 2ADIA 4P2OB 4DZBB 1MUJA 1MCEA 2H32H 5FXCH 4F7TA 4NBZB 3TN0D 5MERA 5GSVB 2O26U 1EHAA 4B7LA 1HQRA 2OTUA 4KUZL 5DD6B 3QZWB 3ESUF 1QTYT 1QYGL 4HIJB 5DO2C 4C4KO 4JM2D 1MHHA 2FX8L 4G9FD 3B6SB 2FH6A 1LK3L 4I0PC 4R6UA 1IILE 2VDKL 1Y18B 4JHWH 3I3BA 3U9UA 1FZOB 3DYMA 4LSUH 4OAWA 1I8IB 1NCWL 3PL6D 3RWFB 3CX2A 1LGVA 1JL8A 2AJYH 3NBNA 4PRPE 1ZLSL 2NNAB 4XPBL 1FO0A 1IKNA 2ZCLH 4KHXL 3NGBB 3V6OC 4DKDC 3PGFL 2VWEE 3IJSA 4YR6A 1NGQL 3BDYL 1ODAA 4WFFD 1M7DA 4J4PD 3AXLB 2YK1H 3FRUB 4FZ8L 1BJ1J 2ZKHH 4OGXH 3MNZB 1AP2A 4LAJH 5GRJL 3V5HA 1RHFA 3ZDXE 3MZTA 4MNQA 3P0VH 5D7LD 5KOMC 3FN0H 5F7EH 3H6JA 5KTEH 1O7VA 4OM1H 4JO3L 2QTEA 2XRAL 3BPCA 5DHYB 4BSWA 1AD0A 5EFIB 4EN3C 1V7MH 4Z77B 5GGVL 2OM5A 1RIVH 1AQKL 4X4YA 3GI9H 1NAML 1NJ9A 1VDGA 5BS0E 7FABL 2A6IA 3T3PF 1BFTA 2DMBA 1TMCB 1QFHA 4G6FD 4V2CB 1MQKL 3DMMB 1WTGT 5JNYA 5FGBA 3DXAD 1BGXH 4U1IB 5DHVA 1IEHA 2IG2L 3N06B 4BSVA 5E6IC 1ONQA 2GAZB 4HDIB 2YSSB 1HEZA 1DN0A 3WHXA 4X7SL 1EUUA 2VJXA 1QNZH 1FNGB 4XP9H 4ZFFB 1OAZL 4RMSA 4RDQF 4ZS7H 1TTUA 3TVMD 4OQTA 1D7FA 1C08A 3OSKA 4RGNC 2DI8A 3E6HA 1QHOA 1PX3A 5B8CA 3TPKA 3P9LA 3C2AH 3QDJD 2OQJB 4JFQB 1MAKA 1JTOA 1C12B 4QXTB 4O2FA 1LO5B 1KIRB 4HS8L 4WI3A 5IQ7L 4JFED 4LU5H 1QRNA 4XXCC 4O51A 4ZODA 5D5MA 3HC4L 4HH9A 4WO4C 3GRWL 4HQQL 1NKRA 4KTDL 5ELIA 2FZ3B 4KDTC 4KKAD 4MJID 4RQQB 4QGTA 3N9GL 4P49A 2IBZY 2H26A 2VZ3A 5DGRA 5EU7C 4MA8H 4HPYH 5JQ6H 3LKQB 1P9MC 3EHBD 4KFZC 1FFOA 3MRBB 1EEYB 1OCWH 2CQVA 1F6AA 3QG6A 4MWFA 4YDLC 1ADQA 2VZVA 4Z95H 5BO1H 1W72A 5ERWB 4PRDB 4D9RD 1GCFA 2R1WB 4E41E 1IZKA 1KJMA 2VLKA 2NXYD 3QUKB 5D7KD 3PJSA 5DJZB 3RFZC 4NQXA 2ZNWA 4X6CA 4E9LA 5L2KB 5DLML 1FZMA 3QNYA 2I60L 3NFSL 5LVEA 2OZ4A 2OI9B 4PJ9A 4Y88A 2EEBA 3V4VL 2Z91A 4K2UH 1ZE3C 5C70A 3NZ8B 3B83A 3KYMB 2IAND 3GMQB 4U1LA 4XRCB 5HBBA 4CBPA 1UEYA 3U7YH 5E2UL 3SJVD 2AJUH 3MRJA 4NKOA 1GSMA 3GSNA 2EKSB 5IMOA 1T7XA 4PD4K 2FRGP 4OD2B 1G7PA 3DHMA 1F3RB 3BUYB 3C8KA 3UPCA 4JY6A 25C8L 1BIIB 4I0PA 4PJ5B 3QXAB 5F9DC 5FFLA 1J0KA 5I1DB 3P4OB 2X5PA 4YDKL 5E03A 1MCFA 4P9HC 3QXTA 3RPIA 1U8NA 5ID1A 1OF2A 5TDPB 3TYGH 4NKMA 1ES0B 1OTUC 5CEXA 3GBNH 3PGDA 4KKBC 4HIEA 1YMMB 2D03H 4ZTPH 1UYWL 3VH8A 2C1OA 5CEZL 2R39A 4RBPK 1I9IL 3EJJX 1RVFH 4MD0B 3PHOA 1X5XA 3QXWA 3L9RB 2FEDD 4D9QE 2CLZA 3UC0L 4GMSL 2CIIA 1KJ2L 5BCAA 4E5XA 3W9DB 3KYNA 2APWA 4JM4H 1I3RA 3LH2L 3PP4H 5C0DA 1JGLH 5DF0A 4QOKA 5SWQA 4XNMB 1RZFH 3RWEA 3P73B 4EN3A 1BFOB 3PUCA 4RA3A 4X6DA 5EWIL 3WSQH 4XP5H 3QIWD 3T08A 3GSXA 4GRLC 1F4XL 3ES6B 4J1UA 2IMNA 4NRYB 4D9LL 3H7BA 1FNLA 5FB8B 2CDFB 1RZKL 1NC2D 3WFBH 3DUUB 4XCCH 5DRNB 5E2TH 1FPTH 4MAYB 5KANI 2XZZA 1E4WH 1BZ7B 4PJAB 3O11A 1MPAH 4MA1C 5C08A 3H9SA 5E6IA 4LQFH 1J8KA 3AREB 4TPRL 3WD5H 1MFAL 1MH5A 3MJ9L 5E8EA 3W0WB 4JRXD 1ZV5A 4QNPE 4HT1H 4WEBH 5J1AB 4YXHL 4HWEH 1NH6A 1Q9OB 3HG1B 4PLKD 4HK0A 4QXUH 3HI5L 5C7XH 3MJ8B 5H35A 1KB5A 1UH2A 4XCNA 4YC2C 5EU6E 5HHXL 1BLNA 2WUCH 4L8CB 3KS0J 3K0WA 3LB6D 4OIBA 1JPST 1S7QB 3ARYA 3O9WB 5FOBB 3O3EA 1TQBC 2GIYA 1J1OL 1KCUH 5EZJA 2PN5A 1EXUA 5IFJB 2YBRB 5D2NE 5DR5L 1M1SA 1S9YB 5C8JB 4DOHE 5FUZH 3K81A 1C5BH 2KL6A 3P4MA 3CLFL 4XXCA 1I7TB 5DVKA 3ET9F 1D5ZA 4WO4A 4DW2L 2HT4C 4KDTA 3VFTA 3F7YA 2X7LB 5CZVH 1EJOH 3TJEL 3GMOA 2AV7A 4OZHE 3EDJA 4UBDC 1M05A 2AEPL 2EDYA 1J1XL 1P9MA 2F5BL 2NY5C 4RMRA 1AXSA 2E6QA 5FAAA 5C09E 4DGVL 4F15B 1DUZA 4HJ0C 4OCXH 4Z7UE 1Q9WA 4YFLI 4P5KA 3HCVB 4NC2B 1GGIL 2ID5A 2JK5A 3L1OH 5LAXB 1JPFA 3PWLA 1AXIB 3MLRH 1MF2L 3PHQA 4X7EC 1A1OA 4FN0A 1YY9D 5GISH 5CJOH 4HUKB 1F3DJ 3GBMH 5DQ9A 2ITDA 4UTBH 3GKZA 3D3VB 1CG9B 1NMCC 4U7SA 4XNUL 3OMZA 3KLSA 4YE4H 1OQOA 1AQDA 2F54D 3MV7D 2RCSL 2VDNH 4NKDA 3C6LB 4TVPD 3BXNA 3RA7L 3A6BH 1J5OH 1MVUB 4HV8A 2BFVH 4ZUWB 1P1ZB 3O6LL 1U8QA 1KFAL 4NO3A 2VLJE 3UPAA 3SDDD 4MA1B 3M45A 2LABA 2X10A 4WHDA 3MLTA 1WFNA 4FQXB 4N0CC 3JUYA 4CMMB 3FQNB 5D1XB 1N59B 5INDB 3W2DL 1MLCB 4I0KA 3IKKA 3QEGL 1JNLL 1CGYA 5B4MC 4KUZH 4YC2B 3E8UL 3PE9A 1QVOA 2GSGB 4OD3L 5F9JA 3G04B 3LEVL 2KQMA 1QYGH 3NIGF 5IW1A 3VG9B 3PQYA 3BFOA 2FX8H 4JZOB 3RWIB 2ZUYA 4KHTL 1LK3H 4U0RB 1I1FB 1S7RB 2F53B 2VDKH 4LSTL 4IEFB 4CJ1A 1KLGA 1CDIA 3RJDA 1NCWH 3S36X 1FYHB 1ZHNA 5FYKU 1ZLSH 1CQYA 4XPBH 2PO6C 2E5EA 3ARZA 3ME0A 4KHXH 3MRQA 3PGFH 1F42A 1MRDL 1N8ZB 1NGQH 3DSFH 1LEKA 5JPNB 1MLBA 3BDYH 1NAKL 4Y4KA 5E24E 5TQ0L 4WGWB 1A6TB 4J3OC 1NDMA 4FZ8H 2R4RL 5GRJH 3FO2B 4HLJA 4RWYL 2EIZB 3R8BB 4Z7OE 3LD8B 2FNBA 4JO3H 2JIXD 2XRAH 1QOKA 2F8VA 2N1KA 3G5XB 4GO6B 4GAYA 4LVHB 5E1HB 3S35X 2BDNH 5GGVH 1FBIL 1NL0L 1NAMH 7FABH 2OTPA 1HIML 1RFDH 3NFNB 4KZEH 3T09A 4IOIA 3SCMB 4HFWA 4HS6A 3BGFC 3ARBC 1MQKH 1TTGA 3GM0A 2ICEA 4M6AA 1QZ1A 5ACMA 4OLVL 2IG2H 1SJHA 1C5CL 1A7QH 1V7NL 4XVTL 4NQSA 3RY6A 1ORSB 1DEDA 5DJYB 3HKFA 5BV7L 2HT3D 1HHKA 4N0UE 2YEZA 2GSIA 2A38A 2ICWB 5C1MB 5KVGL 1X5JA 4X7SH 3P2TA 5C07B 4MXVF 1K8DB 5JTWA 3QNZA 5BOZG 3KPQB 5T1DL 3IFPA 1CXEA 5I66B 4XAKD 4Y8AA 5DDHB 1OAZH 3SQOL 2J8UB 4ORGA 3E6FB 3MRHA 2EC8A 4Z7VF 4JKPL 5E4IA 1I85C 1I9JL 2X1XR 4EVNA 4PLNC 5T1MA 1UM5L 1BQHB 1FYTB 4ODWA 3NPSB 5KSBB 3KPLB 4YAQB 2O93L 3WNOA 3EO1A 1PSKL 3L5XL 4K7FA 3DGGB 1JWUA 3QO1A 4HS8H 5IQ7H 4RMWA 2ZOLA 3G5ZA 3HC4H 3GRWH 4HQQH 4KTDH 1T20A 3EYOA 4F7PA 4S10A 2AV1A 2F15A 2ADGA 1OGTA 5EUOB 4U1HB 4NQUA 4DFHA 2BNQE 3N9GH 5EBMB 3BZ4A 5K9OB 4WU5A 2IALB 2XKNB 2XWTA 1JZ2A 1LNUA 3UROR 1JV5A 4P46B 3V5KA 2F19L 4AIZA 2VZUA 2DQCL 3H0TA 4Z76A 4H0GA 5JW3H 1EFXD 4PJEE 1B6UA 2J88L 1C1EL 3MCKB 2CXGA 5SWSE 2GJZB 3WXWL 1DCLA 1JIBA 4BZYA 4G9DA 4L4TA 3WFEL 4XCYA 4WENB 2R2EA 3JUZA 1OW0C 1UH3A 5DLMH 1JRHL 1U36A 3CFBB 3MRCA 4LLYB 3QJFA 3MRMB 2I60H 3NFSH 5EO9A 1NC4B 4ZYKB 3SDXE 1IQDA 1IC5L 3ZKMC 3V4VH 1IGFL 3VA2C 2FX9L 2BERA 2YS4A 4LDEB 4NSKA 1ACZA 4Y5VC 4PBWD 1FNEA 3CX5J 3OAYH 4U6HB 4P5MA 1TVHB 5E2UH 3D2UD 5HJ3B 1WWCA 4NNYB 4FQQB 3BGFB 3X14B 1G9EA 1PKQB 4OI7A 1MNUL 1WBYA 2HVJA 2ICWJ 2SEBA 1YEIL 3I6KB 4S1RH 1WC7B 1QO3A 1U91A 25C8H 4NCDA 4Y16D 2P8MB 4K71B 3BIKA 5IV2B 4HPOH 2YD8A 2FLBT 3DIFA 4GRWB 4R7NA 1HINL 4YDKH 1D5MA 5DD1L 5EU3A 4JAMB 4NHUB 4Q7DA 2PO6A 5HYIA 2W59A 3QWOA 5T1KD 2NTFA 3LSOA 1UYWH 4JDZB 4M4PA 4HC1A 2ARJB 1NFIB 4JGUA 2RAMA 3CFDA 1Q1JL 4U3XA 2OSLA 1Q9KA 4HMCA 1I9IH 2YC1A 3MRFB 2GTWA 5KSVA 3UC0H 4GMSH 3U4BL 3D39B 1KJ2H 1XGPA 3T2PA 2PR4L 1QFWL 4PJBB 5IMMB 5C0CE 5ICXB 5A40E 3FO9B 2VAJA 4NC0B 4ZSOA 3LH2H 3IS0X 4TUJB 2HFFB 1SY6A 4PUBL 3K3QA 1RU9L 1UKSA 4PY7B 5IJKA 1R3KB 1CR9L 2K9UA 5DQJA 5FV2A 1HK6A 3EOBA 4QYOA 1GZPB 4WW1A 3ALPA 5DVLA 1F4XH 3UP1A 3WDHA 4XAWL 1AO7E 4KTEL 5BS0A 2BRRL 1QLRA 1RZKH 3GSUA 3ARBA 4NN5C 3S4SG 3T8XA 2HTLC 2R23A 4P2RD 4R4BB 5D2LE 4YXKH 4MNGE 4R96A 3V7AG 5KN5B 1XR8B 2R0ZL 4NYLB 4TPRH 4UDTB 4XHJD 1NLDL 1MFAH 3MJ9H 1G84A 4K9EC 1ZGLP 1VGKA 4P2CG 1I1YB 4G6KL 4UB0L 1T5WB 1T1YB 5A16A 1V3MA 1IVLA 4R7DB 2LVEA 3ARFD 4ODTL 3ZE2F 1GC1C 3TBYB 5HHXH 5ESVB 5IESL 2VC2H 1I85A 1Z0MA 4PG9B 2CJUL 2XQBL 3MV9E 4EI5D 2BP3A 4R4FL 1B3JA 2HT2C 2ATKA 3QQ4B 5DR5H 2DQJL 2OXGA 4OZIB 2MCG1 5HHOA 1T0NA 5E0QA 3CLFH 4WUKL 1BPVA 2VLLA 2WINB 4DW2H 2VABA 3LV3B 2EDBA 2VXTL 3MRGA 1WUNT 3TJEH 1DN2A 3LDBC 1MCCA 5ITBL 1HZHL 2AEPH 3MUY1 1J1XH 1NCTA 1J0JA 3GIZL 5CBAB 1L0YA 4DGVH 1ZTXL 5J11B 2MMXA 1TXKA 4OKDA 3VXUE 3GSOA 3B9KD 1PLGL 4Z0XA 3UTSA 4DZ8B 5IIEA 1FORL 2X1PA 4GS7C 1YC7A 1X5LA 1MF2H 3NCYS 4LOUD 3MROA 1KNOB 3GSRB 4DN4L 5CILL 1I1AD 1TJGL 3MNWA 4CDGC 3WUWG 4MA3B 4FXGA 5TH2A 3PL6C 3OKMB 4WHYH 5BZWB 4XNZC 1W0WA 3BW9A 1DBKL 1JGEA 2EYSB 3H8NA 1M7XA 5ITFA 1JK8B 1FJ1B 1ZHKB 3JV6B 3PWVA 3EFFB 5KJRL 2RCSH 5ANME 4Y5VA 5DFVD 5I75C 3RA7H 1RUAL 3V6ZB 4J4PC 4X6BA 3CUPB 1T5XA 1D5IL 4OFIA 1E4JA 3O6LH 2AK4D 1KFAH 4PRPD 2Y25A 3EGSA 4XZUB 1J8HE 4NZDA 1OTTC 4BFIB 1EX0A 1CDYA 5TPWL 3BHBB 2Y06L 3W2DH 3ULUE 2VO5A 4WWKD 5CJ8A 1A6VL 1JNLH 4YUEH 5F97E 3MGTA 5D93C 4FA8A 4AEHL 3E8UH 1F4YL 4OD3H 3RIFF 3LHPL 3O6FB 4QRPA 4P0DA 3VE0A 1RUPL 3LEVH 3JV4A 4J23A 1N6VA 2X4OB 2WANA 4YHYC 3FFDB 4OUOA 4G6ML 4TUOB 2Q3AA 3PWPA 3P11H 2YWYA 4LSTH 2PCPB 2R69L 4RZCB 3U4EB 3LRGA 1MCNA 4HWZA 1KN2L 3LS4L 4J3VA 3TN0B 3QUXD 1JN6B 2Q86A 1JZ6A 5E8OA 2FWOA 1HSAA 1MRDH 1IEBA 4NO2B 1NAKH 5CHNB 5TQ0H 1KF9B 1JHLL 3GJFK 4LASL 3WHE1 2CLRA 1HHJB 2BY0A 5K9QI 5F3HB 2R4RH 2VISB 4JM2B 5FGSA 4LHUD 4G9FB 4KGLA 4RWYH 4F80A 1T66C 2RQ8A 3FOMB 4JKKA 4KKAC 3KLHD 5AD0B 3OAZK 3O3BA 5D7IE 3OGCB 5I6XB 3OKDA 4QRQA 5C0BB 1OPGL 5CMAA 5IB4B 2FATL 3DX7B 3NA4A 1JVKA 4XNZB 5FO9A 2BSTB 4L1DA 3STLB 1ZHLA 4E0RA 3MLSL 1FBIH 1D5XA 1NL0H 1UZ6E 1HIMH 5EO0B 2UZXB 3RVTD 5BQ7B 5J57B 4M7LL 2NY6D 5TDOB 3ULVC 3KXFE 5I75B 1GRWA 4NN7B 4FQPA 5B3JF 1FH5L 5EU6A 3TO4B 4CADB 4JQVC 4JREB 5GRVK 4L4VA 1NANH 4OLVH 3UTQA 1C5CH 1H3PL 1JCKA 1V7NH 4XVTH 3LS5L 4DKAA 5D7LB 4Y19A 5BV7H 1VGEH 3CDYA 4KJPD 3D0LA 3MR9B 3UYRL 3ARDA 2GFBB 3UBXA 8FABB 5T1DH 2YD1A 5IQ9A 1Z9OA 2BC4A 4MD5B 1ZS8B 4BQ9A 3BSZL 1H5BC 3MMEA 3SQOH 4E41D 3RHWK 4U1KA 5CUSH 1I9JH 5JOPD 1TIUA 2CUHA 2VZ1A 1UM5H 1CFNA 2H32A 15C8L 5K33A 35C8L 1AGDA 1SEQL 3DXAB 1MEXL 3Q5YA 4LNVA 1PSKH 4PB0L 3L5XH 4ZAKB 4JY5L 3IRPX 1HCFX 2A6KA 3GGWB 4IS6B 1JGVL 5AAMA 1U8PB 1KSRA 5F44A 2Y36L 1KEML 2Q76A 1JGDA 3PL6A 2A0LD 4HG4K 5TE4L 2FJFA 1B0RA 2F19H 4WFEE 4WI2A 3TVMB 2C3GA 2DQCH 5EB9A 3VXMD 3HUJE 4ZPTA 3QDJB 3V6FB 1HH9A 5IVXE 2J88H 4U6VL 1S9XA 5DMKA 4J4PA 4F2MA 4L8SB 2UZIL 3ROLB 4PJFF 3WXWH 4P23A 2FEDC 4LCYA 3X11A 4AT6A 3MRKA 1SJXA 3ZE1F 4JFEB 3BP4B 1G6RA 4ODHL 3WFEH 4JLRB 1U93A 4IRSD 4NKIH 5J6HA 4MJIB 1JRHH 1Z5LB 1G0DA 5F1NB 4GH7B 3WUWB 4X6EA 5F9AC 1IC5H 5HI5D 1RK0B 1IGFH 3FOLA 1CT8A 1IBGL 2FX9H 1R3IL 3QIWC 4FMFA 4ELMA 4D9QD 4HGKC 4D8PA 4JHBA 4POYA 1F3JA 4QHLA 3DRTA 2CPCA 5KAQF 1Z3GH 4KI5C 1P84K 1MNUH 3DX6B 1UCBL 5GGQL 1D9KC 3VH8G 2NXYB 1YEIH 2OTUB 1AHWB 1OAQL 3F6IA 3TA3D 1QSEE 5IMKB 1JZ4A 4N8CL 4PR5B 1YEDB 4PJGB 5KSAC 2C4XA 1VFOA 3LRSB 3FQWB 2P5WD 2Q20A 3DVNB 4PLKC 3ZE0E 1HINH 1VESA 3L5IA 5DD1H 4IRJA 3SN6N 1NBYA 4NQEE 5TDNA 1FG2B 2C3VB 2IANB 1GYAA 4M1CD 5MEPB 3ZMRA 3QDGE 3SJVB 4EQ3A 1JYNA 3C5SA 3MRRB 1Q1JH 5EOTA 4DTGH 2AVGA 4M48L 3VRLF 5LWYL 2Y7QA 3QH3A 2ESVD 4M02A 5C9KA 2LVCA 4FTVE 3ROOA 5EC2A 1FGVL 3Q6FB 3U4BH 1TZIA 1RUKL 3FT3A 2PR4H 1QFWH 2ZUUA 3ETBF 2VSDA 3DHJA 2EEAA 4PUBH 1RU9H 3MO1A 1TNNA 3SKNA 3BWAA 1CR9H 5C0GB 4TVSa 4LLDB 2DBLL 4BKLA 2PXYD 2D3VA 1K3ZA 5BVJB 2VLRE 5HDBE 2WUBL 3OB0H 4PV8B 4XAWH 2VXQH 4KTEH 3SGKC 2BRRH 2H6PA 1VERA 3ZSTA 3PABB 3UZQA 4JQVA 4Y4FD 1FVDB 2DQDL 3OKEA 3N1FC 1NDGA 1ZA3A 2R0ZH 1NLDH 5C09D 3CSBA 2EO1A 2EH8L 5LBSH 4G6KH 5E5MA 1C16B 4UB0H 1MCOL 4N0UA 2XZCL 3BGMB 1B0WA 3QIWB 2GJ6E 4ODTH 1H5BA 5IESH 2BOBB 4BELD 3FAWA 5C6TL 4CVXA 1T83A 2CJUH 2XQBH 3GHEL 3OF6A 4R4FH 1PY4A 1NC2B 4M6ML 4ONFL 1H0DA 2DQJH 4DK3A 4XX1G 4AENA 3E6HB 4WUUE 3G5VA 1JJUA 4WUKH 4N0FB 3HC3L 4Y2DC 4ZFGH 1I4FB 5HHNB 3QQ9D 5IBTL 1KTDA 3AU1A 1W0VA 4HEME 5ECJE 2VXTH 2XTJC 4MQTB 1U95A 2EE9A 1OB1A 1CGXA 4GG6A 1WWAX 2EDWA 3D9AL 4NM8L 5ITBH 1GJIA 2UVFA 2HRPL 3GIZH 3TZVC 1VFAA 1IC4L 2VLJD 3HPLA 3LQAL 4FQHA 1PLGH 2DQFA 1IC1A 4LMQE 1FORH 1X4YA 3SKOB 4HULB 3OKKB 3QHTC 3CZFA 2IPKB 1HHIB 4M03A 3HE7A 5A1AA 4OFDA 4GW1B 1K8IB 4DN4H 2E7CA 3G6AA 5CILH 1X6NA 4LMQI 4X0KB 1H15B 3OKLA 3QI9A 1MAML 4D0DB 2DQHL 1SJEB 2Q3ZA 4PS4H 5D6DC 5HY9B 3GIVB 4P2QE 2BOCB 5J6GA 3KPMB 4LKCA 4NO0D 5KJRH 2OR7A 4DGYH 2A73A 3SDXA 2Z31D 2IH1B 2VZSA 4O4YL 2NW3A 5I15L 4R8WL 5F9WC 1RUAH 5F1OB 1IGCL 2GI7A 1ZHBB 5EIQA 1D5IH 5IMLB 3MFFA 1BQUA 1S5HB 2W9LA 3RUGA 3VXSE 4D0BB 1D9KA 3MRJB 3MRPA 5FYJL 1CE6A 3I84A 5I1HL 2BVQB 3GMMB 1CFSB 4HXAL 2FGWL 5F7LB 5TPWH 4HKXA 4JRXA 5KSAA 2Y06H 1LE5A 2FJHA 1A6VH 3C8KB 4WDIA 3BOVA 3MV7B 4OT1L 3UTTA 5A2JH 4AEHH 5E2WL 1OM3L 1F4YH 2F74B 2WIIB 3H9HA 3LHPH 4PJXA 2C3XA 1Z9LA 4G80A 3QB7C 5CP7B 1U8NB 5ID1B 4NNXA 2VR5A 3ULSB 1I3UA 1NFDB 4LPUA 1R5IA 4XVUD 4FNLL 1AR2A 4G6MH 3S34L 3SDDB 2HT3C 2CO7B 3VH8B 2G75B 2GHWB 4ZTOL 3A6OA 2FL5A 5J9PA 1ZT1A 2DI9A 2R69H 4LNRA 3P0YL 1WBXA 4N68A 3C8HA 3HMWL 3LS4H 5LQBL 1NANI 3HZKA 4ZO7A 4EUPG 5DURB 2P5EE 4V1DE 2NY7H 2VE6B 2BMKB 1JI2A 2P8LB 1IE5A 1JHLH 1A1NB 4LASH 3MYJA 4GW5A 4X6DB 4CMHC 3AFLA 5EG6C 2VKXA 2X44D 1ITCA 4EQ2A 5HGHA 5ADOH 5AWNL 4MYWB 5DJAA 4P3DB 5FV1L 4J1UB 4LLWB 2AKRB 2DD8L 1OP3H 1UJ3C 5D2LA 1OPGH 4N8VA 2WNGA 4E42A 3G6JE 3MLSH 2PYEE 1I3GL 4HLZH 4MCZA 2F54A 4Z5RA 4CW1B 4JQIH 3QO0A 1ZGLB 4M7LH 1HH6B 1FNHA 5E8NB 5K93A 4I3SL 4NQDD 3S96B 4MDJA 1FH5H 1XIWC 2HWZL 1LE9B 1H3PH 3D85D 4LKXA 5GGUB 4Z0BL 3LS5H 5FA4A 4U33A 2JIXB 3ZKSD 4Z8FL 3UYRH 3PXJA 5I1LB 3O3EB 1ZGLM 4Y2DA 3DURB 1FRGL 3BI9X 3M07A 1AKJD 2VR9A 3L3IA 4RMQA 1JTPA 4LHJB 4H1LA 3C09C 1CVRA 3BSZH 3P4MB 3O4LB 3AM8C 3BYTA 5EN2A 1IC7L 3QFJE 2IPUG 4WV1C 3S36L 3TZVA 1FC2D 15C8H 1MHEB 35C8H 1JRHI 2NY0D 4M62L 4CJ0A 5IJVA 3VFPA 1SEQH 3CH1B 1ZLVH 1MEXH 5EA0L 1K3IA 4JY5H 3EO0A 3GMRB 1RJLB 2XV6B 3BD3A 2QV2A 3ARRA 5LGJA 2B1AL 1JGVH 1C5DB 3ORJA 2AERT 2Y36H 4PJAF 1NQBA 4LSVL 1KEMH 4B5EA 3VXPB 1KPRB 4OZFH 1CL7L 5TE4H 1G7MA 5E9DE 5D6DA 3QA3A 5KS9F 1K6QL 5ISZE 5FM4A 2YPKB 2GYSA 3HFML 2QSTA 2OX5A 2X4RA 2V2XB 1K5NB 1KCRH 5GS1B 3S35L 3RGVD 1RZIB 4U6VH 5JIKA 4PY8J 2UZIH 4MNHB 3GMNA 1CXKA 4BSJA 2NXZD 4Z7WE 1SVZA 4ODHH 1FC1A 5EZLA 5DFWH 3RIFK 2IQAA 2UY7A 5E8PA 2FR4B 5KG9A 2QR0A 1J8HA 1ERNA 3WKNA 4HKJB 1NCBL 3MNVA 2DLTA 3O3AA 4FXKB 5MENB 5DZNA 1IBGH 1S7SA 4N5ED 1LHZA 2MHAA 4KY1L 1B0GB 4PD4J 1AIFA 4JG0L 2IH3B 2M1KA 1T1WA 5LKNA 5C0CD 1EFXB 3DOSA 5F7DA 4PRIE 3QRFM 2WSKA 3K2UH 3FTGA 1UCBH 1FAIL 5GGQH 1MI5D 4EI6A 5GS3A 2R0KL 1NAMA 3CXHK 1JHTB 1OAQH 2XXCB 4ZPVB 4N8CH 1RMFL 4UNVA 4NQVA 1U2HA 3F6LA 3RDTB 3CAFA 43C9B 1P6AB 2ILLA 3PWJA 3I02A 3QWRA 5IW3A 4LSDA 3C09B 1FZJB 4GQPH 3WN5C 2YD4A 4Y89A 2BJML 4N0YL 3D2UB 4HIIA 4MSWB 4WV1B 4EI5C 1FE8L 3RWGA 5IVZB 3S9DB 3RQ3A 4UV7L 4M48H 2VAAB 4JDVB 5LWYH 1YUHA 1U8IA 4MMZC 3ZTJH 3ARGD 3DV4A 2FLRT 4DVBA 5BRZE 1RUKH 2BSRB 1A64A 4Q0XL 3F7RA 1IM3B 3HPJA 1BF8A 4Y16B 1XCTA 2DLGA 4L8DA 2NYYC 1CICC 2BXZA 4WI8A 1UJ3A 4GW4B 4G43A 4OZGA 4AQ1B 2IADB 5I71C 1QEWB 2DBLH 3VJ6A 4BZ2L 2UWEE 4UNUA 3GRWA 3QXUA 3MUGA 5HYJE 5T1KB 1R6VA 1WBZA 3OJDB 2WUBH 5ADPL 4EUPB 2LTQB 1EBPA 3WS3A 4P5TD 1L7TH 3B9KC 5GSRB 1VADB 5C6PB 2K1MA 4LHUG 3ZHDA 5EH1A 4X7TA 2D7NA 1XIWA 1R5WA 1DQQA 2DQDH 5I8OL 1YN7A 2APTA 3I6LE 1ZSDA 4M61B 1UB5A 5C0AE 4RGOL 5D72L 2EH8H 1CDJA 3DPBA 1KENL 3JWNC 3C6SB 1YPZE 3VXUD 3IFOB 1XGRB 2XZCH 1AD9A 3LRHA 1N5YL 1AY1L 3U0TA 1K4DB 3VMPA 3JV5A 1XGTA 5DFVC 3O8XD 3CXDH 3AM8A 4PRNA 3VGAC 1ETZA 4TULL 1DQJA 3BP6B 4LEOB 4XT1C 2WBJC 1HKLL 3GJEA 5C6TH 3TFKD 3BIBX 3GHEH 5KVDL 3D18B 3BP5B 5E00B 4OQTL 4M6MH 5KZCD 2W0FB 4ORGB 3EDEA 4ONFH 2PETA 5GJTL 5IB5B 4LARH 1YDPB 1N3NA 4M9OA 1QQDA 4AEIL 3GUTB 5IBTH 4JN2A 3CSGA 2QSQA 1I7RB 3QO1B 1D6VL 2HKFL 1IGIL 4MZ3A 4WWKC 2AXFB 3D9AH 1IGTA 4NM8H 4NZJA 3SGJA 5A3ID 2C5DC 3K4DA 5A2IH 3ARFB 4L8BA 3VDBA 3RWJA 3MGOB 1IC4H 3IJYA 4DCQA 5HHMB 5F7NC 3LQAH 4ONHB 1OGAE 1A22B 4EI5B 1RAMA 4G8GD 4H20L 3I9GL 3UJJL 3PGCA 4Y4HB 4S2SA 3HUJA 1UXWA 1X5GA 3EYQD 3KYOA 3S3SA 4QRRA 3ULUD 1FNSL 1W72L 2MKLC 5F71A 1XF3B 3JTSB 1C7TA 3NIGE 4TSAL 1MAMH 3M8OL 2DQHH 3DVFA 1VEPA 3V0VB 1NEZA 4QWWC 5EC1B 1N6UA 2YRPA 3VRJA 3QUXC 1BOGA 4YGVA 1WFTA 3BH8B 3DROA 1T0PB 4JHAH 5I15H 4R8WH 3BPLB 2J8UF 1HCVA 3B9KB 4HIXL 4YEEA 5I8KL 3SDAD 3OL2A 4PGEB 5J8OA 1M71B 1HXYA 1ZLUH 1KACB 4FRWA 2CK2A 1WFUA 4CNIB 5KSBF 5FO7A 5B39A 5HYQB 4P2RA 2A6DB 4PJDE 4PTTA 1I1AB 5FYJH 4HUVA 2WAHA 5I1HH 3AS0A 1AGBB 3CU1A 1QSEA 4HXAH 5GZND 3RTQC 2SEBB 2FGWH 1A7RH 1RI8A 4NQCD 3VXRD 4PJCA 4KK9D 4OJFL 5EUOF 4YXLL 1T1ZA 5T3ZD 5EDXA 5IM7B 4OT1H 3RVTC 1A4KB 2WZPD 2NY6C 3MJ9A 3WN5A 1KPUB 1OM3H 3VGEA 4OCWL 4UMGA 5EU3B 4G7VL 1F97A 3OKOA 5JUEL 3KPRD 2AK4B 2NTFB 3U30C 1SYVA 4FNLH 4PRPB 3S34H 2P42B 5DRZA 4KJPC 2XPGA 4ZTOH 1YNKL 2OSLB 3P0YH 3KXFD 1CICA 3CLEL 4C56D 3HMWH 3QUZA 4WWKB 5LQBH 3IYLW 1DBML 1MSPA 1N26A 2EXWD 1Q9LB 1DQML 1G6VK 4PJ7E 1PKOA 3FQXA 4HZLA 5SX5H 1AH1A 3HZMA 4S1SL 5HGAA 4X9HA 2DYPD 5EPMB 2VLRA 2AJZA 3HB3C 1T7YA 2VITB 1RZGB 1U8KB 2BSSA 4NGHL 3VWJD 5AWNH 5GHWL 1X3DA 3WE6A 4NBYB 1SJVA 1S9VA 4HUWB 2IGFL 2E8YA 5I76A 4HHAA 5E2JA 4GRMB 4UIMB 3OHXA 5CEYA 2A0LC 4K8RD 2BNUB 4EXKA 1VPOL 2L0DA 3O6KL 2K7QA 3MOAL 1LK2A 3L3JB 4C54A 4B41A 3IXAB 5H37G 2YD5A 3OR7A 3UBXG 5FHAL 4GRWF 1UVQA 2XFXA 3FQRA 3NIFF 3OQ3B 3DI2B 3OAUL 1B6DA 4I3SH 1KB5L 2GJ6A 4PV9A 2X4QA 2WBJA 4HJGA 5KOVC 3WLBA 4DEPB 5ENWA 3HC0A 4MDIB 2C7UB 2HWZH 4LHUB 4PGBB 4Z0BH 2FD6L 4IRSC 2Q1EA 1NCAL 1HSBA 3IDGB 5GS0H 4LRIC 4YHPA 3L3HA 4WTZA 4WUUA 2YA0A 1FRGH 5HI5C 1S7WB 1YJDL 3VFWB 3OJMB 2AP2A 4PJBF 5GGRB 1JTTA 2XICA 1IZJA 3B5GA 3LKNB 3B2VL 3QP3A 4RWHA 3IAQA 1IC7H 3S36H 3RNQB 3ARTA 2X4UB 3QEHB 1CLOL 1INQA 3TCXA 3FONB 1ITBB 4M62H 1E6OL 4HKBA 2KZWA 4A6YB 3TH4T 1MWAB 1T80A 1HQ4B 4B7IA 5EA0H 3LVEA 5INCB 2G9HA 4P57B 2X41A 5B38A 2B1AH 3EYUL 5F6IB 3V5DB 1E4KC 4KK5C 5C0JB 1AC0A 4LSVH 4ZMAT 3SDCA 2AXGA 1DQTA 1GXEA 1CL7H 5MP6L 1AE6L 3QUXA 4JRYA 2IBBA 3WKMH 4E41B 3HFMH 5CGYD 4ODVL 4TYUA 5JHDE 2YPLE 1WK0A 5TF1L 3TIEB 3S35H 4HFUL 3QUMB 2F9BT 4WI6A 1LEIB 1MIML 1A02N 1NEUA 3MLPA 4U6XB 1ZLWH 3C2SA 2W92A 3MRDB 2Z8VC 1TETL 5DUBB 4F8QA 3IRZA 1P2CA 5HI4D 4JKLA 4NQED 4ZUVB 3VGFA 5DQDL 4OZIF 3CDGA 1OSPL 3QCUL 4QRTB 4CN4A 1KC5L 1UM6L 3MV8A 1TVBB 3RTQA 2WMPA 1NCBH 3MLUH 3ISWA 2NW2B 3K46A 2PXYC 4OGAC 5J56B 1EEUA 1QFUL 2R9HD 5DZLA 4FTVD 1U3HD 1UG9A 3LZFL 1U58B 4L3ED 5L8JB 3B4NA 2YPVL 3KWWB 4JG0H 2ADJA 4P9HL 5J06A 1TNMA 4KAQL 4N0RA 4Y4FC 1FAIH 2R0KH 3C60C 3QULB 3AY4C 4MCYB 2ATPA 2I9LB 5FKPA 4BZ1L 4JVWA 5EORL 1RMFH 4IRSB 2JJTC 4R0LA 1WCBA 3V7MA 3D0VB 2DWEB 5FUCE 2ZSWA 4LCWD 2FIRT 3IGAA 3OPZL 5FO8B 1IAOB 3KPSE 4I9WE 1F45A 2BJMH 3G6DL 4N0YH 1Q94A 1E28A 1G7LA 4Z7NF 4F7MB 3RVUD 3EAKA 1FL3A 2P5EA 2P7TA 3MREA 4UV7H 4OUUA 4PGDB 5H94B 4LF3B 1LD9A 4B53A 3TA3B 3ALXA 4AG4L 3WFHA 4XNQB 2GY7B 1WAAE 1T6VN 3FRPA 3CCHA 2BNRD 2NQCA 1T1XA 4POUB 5BOPA 1RK1A 3I6GA 4Y2OA 1YZZA 2VQUA 2DQGL 4BZ2H 3MV11 3NVQA 3PWUB 3K1DA 5GQBA 1RULL 2MTPA 3QUYD 5IHZA 5GGTL 4BUHA 3VXMA 4M7KL 2HJFB 4XNXL 1MJJA 4P2OD 3JVGA 3M1BA 2W60B 5LG1A 1VCAA 5I8OH 1FV1B 2XWJA 3W39B 1A9BA 1KPVB 5IG7A 3FB7A 4RGOH 5D72H 4UU9A 4LRIA 1KENH 5F1IA 2FO4B 2CO6B 5IK3B 5IOPB 1GZQA 4XGZA 1AY1H 1N5YH 3WJJA 2PXYB 4XPTH 4K7PY 5D2NB 5EBLA 2MNUA 2CRZA 2V5MA 4DOHB 4RIRA 4TULH 4U1JB 1HKLH 1XF2B 1CXIA 1EZVY 5KVDH 3V52L 3T65B 4M5ZL 2JJSC 2BC4B 1Q72L 4OQTH 4F9PC 3IDNA 1DLHB 1UQSA 3TYFA 2NY5L 1NGYB 3LN4B 3P9MA 5GJTH 4P2QD 1P4BL 4OZHB 3T0EE 1Z0NA 5HHPB 1CFNB 3LKPB 2H32B 5FGCE 4JO4L 4AEIH 1SEBB 5C09B 4I5BA 1K2DB 4JM2F 1XT5A 3Q5OA 4W81A 3D5OF 4G8IA 3WDJA 1IM9A 1D6VH 2P5WA 4Z7UB 3VG0L 2HKFH 1IGIH 3K1KC 3QJHB 4W70A 5FYJE 1RJYB 1RIUL 5I1AA 4RAVA 1IEAA 4U1GC 1JPSL 4WGVB 3VXSD 3L3OB 4JPIA 4YFDB 2CKBA 3U0WL 1FVEB 1RJCA 3HS0B 3U82B 2CMRH 1UENA 4H20H 3I9GH 3UJJH 3GSVB 5ID0B 4UQ3B 4PJHB 3UPRA 4XVUC 3NIDF 1X6LA 1FNSH 1W72H 2ESVA 3QIBB 4JFDA 4GUPA 3GM8A 5D6CA 3VXQB 3KJ4C 2EYRA 4GKSA 5IHLB 4TSAH 1MHCA 3M8OH 3NABH 5F6HI 9CGTA 2BVUA 4DFIA 3REWA 2KUTA 4ZNEE 5F9OL 2Q7YA 4PRHE 1A6ZA 3W81A 4U1MA 3FKUS 5IEHB 2YD9A 1G7HB 3FJTA 1VB9A 4UDUA 2VLJB 4QHKI 2IAMA 3A67L 4HIXH 5I8KH 3B5HA 3TBVB 1OOAA 3WO3B 5T5NF 2DWDB 1CN4A 1R3LA 3E1F1 32C2B 3UAJD 3WEXA 3BWUC 1FSKC 3C60A 3GSNH 5DJXB 3RWCB 1T04A 1URLA 1HKFA 3CC5B 5K9KB 5BZDA 4V1DD 2AJSL 2JJTA 2X70B 5L8KB 4O2EA 3RWHA 1GGBL 1CGTA 2RFXA 3QEUA 5ALCL 4Y5YC 1V3KA 4YXLH 4OJFH 1UXSA 4ZFZA 3QYCA 1J0ZA 3NFPA 4RRPA 1QR1A 2Z8RA 1R3JA 2Z31B 1WWBX 4OCWH 1M7IA 3AS2A 4MX7A 3BEVA 4XMLL 4P3WA 2NZIA 3F12A 3OKNA 4HGWA 4G7VH 3GJFA 2H3NB 1RJZA 3BO8B 3VI4F 1XGYL 5JUEH 4NN6C 3L3GB 1MCPL 1W8NA 4YNYB 2VERN 3WFCL 4BH7A 1YNKH 5MHSD 1VKXB 4PP2A 2VNCA 3CFCL 4ENED 4UIKH 3CLEH 3RWDB 4YIQB 4JZJC 4OIIL 3M17A 5C0FB 1P4LA 4N8VG 4OLWL 1M6OA 1DQMH 1WZLA 4QTHA 5HYSB 4FP8L 2NY0C 4S1SH 4HUUA 1IL1B 5DD5L 4MLIA 3X13B 2BVTA 3C5ZA 4XH2A 5DSCA 5FKAA 2QSCL 2ADFL 1IGYA 5GGSB 5L2KD 5FUOH 4NGHH 3IFNL 2I07A 3BH9A 2IGFH 2HLFD 4KJWD 5DEGA 5EU4B 3UXFA 1BJMA 4X9FA 2NX5E 2X4PB 4X4XB 4ZQKA 1HDMA 2ARWA 3QFJD 4K3GA 1QPPA 3O6KH 1ED3B 1VPOH 5ACLA 3J7HA 3MOAH 1KT2A 1RZ7L 2DM4A 3CVHB 4PJGF 2V2WA 2PTVA 5J3HD 2MJWA 1QSFE 1VACA 5FHAH 4HUXB 4NO0A 2XN9E 4N9GB 3FFCE 3OAUH 1BD2E 3RGVC 4N0UB 4P4RB 3GMLA 1KB5H 3KHQA 4IRZL 4QF1B 2C1PB 4PJ5D 2JJSA 3IT8D 3TLRA 1X4XA 2NXZC 4PTUB 3IDUA 1T89C 3FQUA 3DBXB 4Y1AE 3VFOB 4CVXB 1NCAH 2WLZA 5EIIA 3QIUA 5B22A 3EYVB 3B9EA 2EYTA 3ARUA 4PJFE 4KJQD 3ZE1E 1YJDH 1DJSA 4Y5YB 2JCCE 2IBGA 2G60L 1KJVB 2XOTA 4N5EC 2FHCA 3CX5K 2BVYA 3DETD 5DK2A 1CLOH 1UWXK 1F3DH 1E6OH 4OCRL 2A77L 1KGCD 2BNQB 3ZDZF 3WO4B 2J4WH 2V7NA 4U05A 3LKRA 3HZYA 3D85B 1OGAA 1U8MA 4WW2C 3L95A 4BJLA 4NN6B 3E3QE 2QADD 3EYUH 3VXTA 3U36A 3DUSB 5DYOB 3ARQA 3AGVA 1EAPA 1AKJB 5ETUB 4PJEB 1AE6H 2WQ8A 5MP6H 4KQ4H 2DTSA 2V9TA 4PRID 5CKAA 5SWSB 3WFDH 1RHHA 4ODVH 3QEQD 2AEQL 4OLXH 5TF1H 4I48B 1F11B 5HXMA 5C0EB 3ARED 3HI1B 1GPOL 4K55A 1MIMH 2E9BA 3O2DA 4D0CA 3SE8L 1U9KA 2CDGA 1VHPA 3N85L 3VGDA 4LPXA 1TETH 3R0NA 3O3DA 1H3XA 5BXFB 2NLJA 5DQDH 3IETA 5CP3H 1TQCB 5IB3B 3VRLE 1OSPH 3PP3H 3QCUH 1KC5H 1UM6H 3EOAB 4QLRA 1P53A 3PDGA 3KDMA 1QFUH 3O9WD 4MNQE 5HD8D 2GITB 1U8HA 4ODBD 1U8LB 3LZFH 4P5TC 2MKWA 3ILPA 4NWTH 1HOCA 4P9HH 3UEZA 4X4MA 4KAQH 3KPPA 4RNRA 5KVFL 5KW9L 2K7PA 1OL0A 4W6WB 1XZ0B 4PYHA 4BZ1H 3KLAB 1LO2H 5K9QG 4YEFA 3K8MA 4ETQB 2XXMB 1I8LC 2BVOB 5C6WH 5HYJD 4NJ9L 4NNXB 4G5ZL 1IGJA 3OPZH 2XKSA 3L3KB 1TFHA 3WHE0 2KPNA 2X4NB 2VRAA 5F88A 3CMOL 3FQTA 4JZJA 3IU4L 4XTRC 3O8XC 1G7JB 3G6DH 3I6LD 1L9MA 5C0AD 5EBWA 3MV01 5C0CB 5C0IB 3QDME 2CSPA 1I7UB 1OP5K 4AL8L 3DYOA 2JELL 2W9DH 3UJIL 1MI5B 1ZWIA 2MPAH 4WW2B 4H25A 4Z7VA 4AG4H 1H8OA 2HG5B 5CD3B 1FLTX 2DL2A 1CXFA 2NY4D 1WZ1L 1BVKA 1FL5A 1FFNA 1AO7B 1FGNL 3TBWB 1FZKB 1NGXA 3TCLB 4TTDD 5A3IC 4KMTL 2DQGH 2X42A 1M4KA 2PW1B 4GKZA 1QRNE 4K94L 4KK6D 4K9EL 5D5ME 1RULH 3LKOA 5I17B 8CGTA 1MQ8A 5D2LB 4MNGB 2E7LC 1OWWA 4XCEA 5GGTH 3WIHL 1R3HA 4M43L 4ZUSA 3RGVA 4M7KH 2LE9A 4XNXH 3K2MC 4FQ2L 1AGEB 4FQXD 5E4EB 1A6WH 1CIDA 1GC1L 2XNAA 3QDAA 4FQLL 3SE4A 3ARGB 1TJHH 4X98A 2PTTA 3NTCL 1T89A 2X9XA 1NFDF 2NTSP 4YZFF 3QRGH 4LVOB 3OV6A 4TOYL 4QHUA 3B5TA 1WFOA 1RZ8B 3VXNA 3NCYP 4IMLB 3MV9B 2Z35A 1LO0H 4KVNL 5E99L 5SV4A 2P8PB 1YEJL 2Y72A 5A2LH 2Y5TA 3U0PB 3QCTH 2P24A 1KV3A 3P4LA 3P4NB 4Z7QE 4I3RL 2OJEA 4P5TB 3SDAC 4ISVA 3JTTB 3I50L 3V52H 4M5ZH 1Q72H 2FBJL 1H3TA 1E27A 2NY5H 4OBRA 3IKCB 1P4BH 4F7EA 1UACL 1CZ8L 1JNHB 3MRLB 3CFEA 4C58B 3HZVB 5L0QB 1PY9A 4JO4H 4URTB 3FB8A 1ZMYA 5GZNC 1XR9A 1RZJL 3VG0H 3VXUB 3HR5A 1BX2A 3S5LG 3EW3B 4J12A 3D48R 4KK9C 1MFEL 1RIUH 5JIIA 2R0WL 1WCQA 3N0PB 5SWZD 4CU6A 1JPSH 3IXTA 3O8XB 1EH9A 2EE3A 3GK8L 4OF0A 4I2XB 3BEWB 4NRXA 4OKVB 4PB9L 5JHDA 4EDXB 4X6FA 1WIPA 2OP4L 5KZCB 3TV3L 1HILB 5D1ZD 5D4QA 2VDLH 2VIRB 5MEQB 4F33B 3V6OE 4JGJA 4XC1L 5ANMB 4U4BA 3O4OB 4K3JL 3ALWA 2YD7A 1G6RL 1EDQA 3VRIB 3SCMD 3BAEL 1BZQK 1K9TA 2QBWA 3DX9B 2EXWC 1A9EB 5EZLB 1JPGA 5GIRB 3VD5A 5DTFA 1A1MB 4YBLC 2NR6D 2B7DT 4RFNC 3O45A 5LJYH 3A67H 2J5LC 3DTXA 2Z93B 5E1AA 3VWJC 2WBKA 3SKMB 4PJ8D 3E2HC 2OBGA 4JFHE 3CJJA 3GI8L 1WEJH 1RSFA 2I25N 1T1WB 1D6EB 2AJSH 2O61A 1I8LA 4UT9L 3KJ6L 1GGBH 5ALCH 1Z6JT 5TGBA 1K4CB 5JDSB 3QNXB 4G7YL 2Q6WB 1LP9B 2BY2A 4M93C 5EOQL 1JWSA 5E94B 5E2VH 5AUMB 3L5WB 2K3TA 1B4JL 5I30L 3ECBB 3NN8B 3IF1A 3PIQB 4QHNA 3KPSA 5CGTA 4XMLH 4H0IA 3X12B 3SDAB 4LHQB 4Y5XC 4UINL 1XGYH 5K59F 3STZB 4U6YB 3RZWA 5JPMB 4LEXL 4YHZL 4G8FA 5D7JD 1MCDA 4HIIB 1U8JA 4J8RB 3HAEA 3WFCH 3VXOB 5DEFA 3UYOD 1F8TL 4RGNE 2VTFA 4P46D 4OLZL 5F3BB 1KTKE 3DV4B 1P7QA 4OIIH 3VXRB 1WICA 3T77B 2XTLA 1LILA 4MJ5B 1IGML 4OLWH 5J1SC 3EO9H 1SY6H 1DVFD 1CXHA 4IJ3C 4FP8H 5BJTA 2ZCHH 4WTWA 5HI3D 3RY4A 2Y6SD 1PW3A 5D7IB 5DD5H 3FCTA 1FCCA 2P1YA 2ADFH 2QSCH 2NY1C 4V2BA 2V2TB 5EU7E 2RB8A 3IFNH 2W0KA 4WHYG 2HLAA 3VD3A 2IEPA 4X8JB 2I9TA 2X4SA 2R29H 3KXFB 1S5IH 1A5FL 4FXLA 5L6YH 1UADC 1RZ7H 5FA3B 3T0VA 4WTZG 2Z4QA 5CGYC 1AGFA 2X1QA 2ZUQC 4GRWH 4U2YA 5F72S 4U1NB 1I9EA 3RL1A 5KS9E 3NACL 2J5LB 2DYPB 3L7EB 3BVNB 4IRZH 4QGYA 3HG1E 3VWJB 4MQXC 4MJ6A 2XZAL 4PRNB 2AJXH 4U3HA 1QA9B 1MRFL 1U92A 1OAXL 3E2HB 5HI4C 3GJEB 1MJ7L 1HWGB 1SM3L 3T0EA 1A21A 5I8CB 3MBED 3MZGB 1XGQA 1AGCA 2R2HA 5B38G 1QACA 4LSQL 2G60H 4NQCA 3ZL4H 4XP4L 3EDFA 3IDIA 4M93B 1U3HC 3CPLB 4FG6D 1YNTA 4RFEA 3WIFA 5DUPL 2VMFA 1X5ZA 5J13C 1T0MA 4OCRH 2A77H 2WWMD 5EUKA 5KVMC 4NCC2 4Y5XB 5ESQA 1B2WL 3KPRA 3IJYB 4K7PH 2JTDA 1N4XL 3HE6D 5GS2D 5F21B 1DLFL 2CXKA 1T3FB 4X99A 5FDWB 4J7RA 3GB7A 4YK4B 1YYLL 4R2GB 1YN6A 3RZCC 4YBHA 4OTXL 3B3IB 5IVXB 4KH2A 3PQYE 4C56A 2UUDH 4PGCA 3S5LB 4YHIA 4DGIL 2OJZH 3KPNB 4PRHA 3WLBB 4F7CA 1VSCA 2ZG3A 2AEQH 2LU7A 2AK1L 2GCYA 3D3VE 4W6YB 4BYHA 3LQZB 1A4JA 1KJ2B 2QHRL 2GK0A 4P48A 5EOCL 3SE8H 3W9EA 2XG4A 5C2BL 3N85H 4KC3B 3LCYA 4I9WD 2D7TL 3TWCL 2MCPH 1PFCA 4B50A 4LLVA 3BQUA 5ICZB 4JR9L 3MXWL 5I8EB 2Q7NA 1YQ2A 4NPYA 4M7JL 1EBAA 5BMFL 2ZJSL 3DO7A 2ORBL 2OTWA 2ZUQB 3LN5A 1T2JA 3SQBA 2EDNA 1PAMA 3DRQB 3PWNB 1N2RA 3FZUC 3L7FB 1T1ZB 4P2OC 4S1DD 5KVFH 5KW9H 4R3SB 3IDMA 2FYYA 1VENA 4M7ZB 4Q9CA 4QRSA 5ALBH 4FFVD 4NQEB 1NBZA 4HJJL 3FB6B 4UOJA 1HXMB 4JFXA 4NJ9H 4OLYL 3QDGB 4G5ZH 4ODXA 5DK3A 3MRIB 3MRNB 3NPZB 3I75B 4ZDHA 3CMOH 3BN9D 3QQ3B 3V8OA 3IU4H 2ITCB 2B0SH 5GXBB 1MY5A 5JORB 1ZT7B 1U3HB 3IU3A 4FTVB 4H8WC 5CIPA 4XI5D 4H26B 4AL8H 2JELH 4XVSH 3UJIH 1UC6A 4NUJA 2JB6B 3R06A 4OLUL 4WCYL 2F8OA 4AIXA 1NCCL 1PGRB 5DZOA 1I7ZA 5B21A 1UZ8A 2COQA 1WZ1H 2VLRB 3GEWB 1XEDA 3O41A 1FGNH 1C8PA 3CSYB 5CJXC 4KMTH 5HGBA 4ELKA 1G7IB 2R2BB 4K94H 4ZOCA 2DIAA 4K9EH 3IDJA 3LKSB 3U2SA 3LEXB 4X5XA 4P4KD 4CVZA 4AH2A 4DUXA 4JANB 1QSFA 5JW4R 5AEAA 2PW2B 5DJDA 4M43H 2XQYG 1DUYA 3D25B 4WHTB 3EBAA 4FQ2H 4ZS6C 4FQLH 1GC1H 4ODUB 4TVPL 1DEEB 3NTCH 2X4TB 2BSED 6FABH 4XBGA 1G9NL 4QRUA 3HC0B 4TOYH 2BNRB 5F1SA 1JF1A 5JOEA 4JRWA 3SY0A 4ZUUA 1S3KL 1SBSL 4JG1L 1TCRB 4R97C 3DMMC 4KVNH 2GT9A 2YKLL 4PRBB 4PJFA 1YEJH 3O6FD 2EH7L 2QKIA 4OZ4B 3ZO0A 4L4TE 3FMGL 3FT2B 3QUYB 4I3RH 4L29A 4QT5A 1N6QL 3VWKD 4L3EA 4JFYA 4D3CL 3D87B 3IAPA 4JQXC 5CLTA 4MJ2A 2CDEB 3MJ6A 3UAJC 1KUMA 4NDMA 1UACH 1CZ8H 5AZ2L 2HAZA 4IIQB 1MFCH 4JFFA 5L9DH 4HKBB 5H2BA 5KSBE 1ND0B 4L9LB 4LCWA 3ZHKA 4R4ND 4GKNB 1MFEH 4NO5A 1OTSD 3RZCA 3AB0B 2YOCA 3TJHD 4NP4L 2IWGA 1ZA6B 5FM5M 1S7XB 1QUNA 3LAFA 3DARA 1S7UB 3GK8H 3BJ91 4EBQL 4PB9H 4PYGA 4YHOL 3NCJL 1CD1A 1L4IA 2OP4H 5IBLD 5DI8A 1D5BB 3JWDC 2FO1A 1BVLA 4P2QB 5C0BD 4C83A 3MA7B 3V79C 3BZDA 5FF6B 4RAUA 4OFYD 4JVUA 1ZT4B 4QY8A 5IW6B 4G8EB 4PLOB 1CF8H 4JFPB 4K3JH 4ENEC 1G6RH 5IKCB 4RCAA 3KPOB 5MEOB 4ZFOB 3BAEH 4CGTA 5DK0B 3F5WB 5FYKL 1I8KB 3RKDD 4RA0C 3TO4D 3F58L 3VCLB 3VXSB 2YUXA 3PV6B 4HS3B 4RISH 3TNMB 1PBYA 3U46B 3BYYA 4ZSOE 1PYWB 3RBSA 1QKZL 2CLVB 1S8DA 5DMGC 4LVNC 3RX5A 3UYPA 4P2OA 5GS0D 2H8PB 4P9ML 3IVKB 2OI9C 3GI8H 4CU7A 4CUCA 3VFMB 2XACC 1G7QB 3Q2CA 1N64L 4UT9H 3KJ6H 5GSVA 3CGTA 4YDVB 1X5HA 4G7YH 5J3HC 5DD6A 4R97B 5EOQH 1CFTB 4R0LB 3TNNB 1AR1D 3NCCB 4ZAKD 1B4JH 5I30H 4HIJA 4APQD 2NX5D 1DDHB 5T1LA 2ENSA 4X5LA 3B6SA 5E6ZA 1YEKL 1X7QB 4UINH 3MUHL 4GRWE 1DE4B 5FYLD 1Y18A 2NY2D 3NIFE 3C5JB 1BECA 1FZOA 3QDMA 1DL7L 4LEXH 4YHZH 1I8IA 5T3XD 4EOWH 1QFOA 2X89D 1F8TH 4KJQC 4V1DB 3VGGA 2AABL 3FFCD 2NNAA 4YH6A 1S7VB 2G5BB 3MUZ1 1R0AL 3BD5A 4U0QB 3SKJL 1HI6B 3BKCL 5I16B 5DJ2B 4CDHA 1IGMH 5CJXA 2H2PD 1T2XA 1OQXA 5HHOE 4CU8A 3UZEA 3DETC 3AXLA 2DIJA 2DQEL 3FRUA 2P43B 4Y1AD 1T6WA 1KLUB 1YJDC 1RK1B 3MNZA 2GTZB 4DKFL 1AC6A 1R5VB 3I6GB 4NIKB 4LCCB 4HF5L 4MD4B 5JO5B 3LPGA 1MCHA 3G6JB 3IJHA 5DHYA 3ZSSA 3S7GA 3TF7C 3ULVH 2QADC 4OI8A 2ZUXA 2PYEB 1XCQB 3HMXA 3JZ7A 5JA8B 4IDJH 1A7NL 3UTSE 4BUGA 1OAKL 2E27L 3BKYL 4NC1C 3DMMA 1KIPB 1WZMA 4ERSL 5IG7B 4MAUL 4MAYC 3D69B 2ZG1A 3BGAA 4U1IA 4HW6A 2YXMA 2EDTA 5CSZB 4YHNB 1Z9MA 3NACH 3AREC 1OLZA 2GAZA 4G42B 4HDIA 4JQXA 2YSSA 1YEEH 3KYKH 2J8HA 4LVNB 1Y6MR 2XZAH 3R1GL 1EEQA 1MRFH 1OAXH 1MJ7H 2DL9A 1FNGA 4N8PA 3GMPB 2B4CC 3BP7A 4ZFFA 3QFJB 3V2AR 4TQEL 5IB2B 4LSQH 1KTLB 1MOEA 2GY5A 4XP4H 3O9WC 5HD8C 2AJ3B 4PLJD 2OQJA 2YRZA 4JFQA 5JLZB 1C12A 4QXTA 5DUPH 1LO5A 1KIRA 3UTPD 3REVB 3SBWC 2HMID 4RX4D 3BZEB 2FZ3A 4RAVB 1B2WH 2BVPB 2EDDA 4RQQA 5E9DB 1N4XH 2UVEA 1DLFH 5ISZB 4MNQD 3RIAF 4LLUB 4X5WB 1J11A 5ESAB 1EUTA 4EDWL 3ABZA 3LKQA 3MRBA 4QRPE 1EEYA 3A0OA 1YYLH 2D7MA 4F15C 3V6OA 4OTXH 3VFSB 1SHMA 3WLWD 1KCVL 5IR1B 1JNNH 1LQSR 2DB8A 2HVKB 4WNQB 5ERWA 4DGIH 4PRDA 3PDOB 2R1WA 4QXWA 3PWPE 2A9NL 4Z7WB 1CYGA 2C26A 2X09A 4C4KT 1AI1L 2AK1H 3QUKA 5J4MA 5DJZA 2APFA 4Q9QL 5C2BH 5EOCH 1IAKB 5EO1B 4DJMA 2QADB 3B9AA 2D7TH 2NY4C 2DQTH 3TWCH 4OZHF 1I8MB 4HLZG 4YFLF 3BUTA 3NZ8A 1F90L 3C6LC 4TTGA 3KYMA 4JR9H 3MXWH 4TTDC 3GMQA 4XRCA 3K7UA 4KROB 4PRIB 1SYSB 4KK6C 3EOTL 5BMFH 2ZJSH 5A2FA 2ORBH 1N5AA 1ZVSB 2HJKB 2EKSA 1PD6A 2XA8L 1FFPB 3QEQB 5IEKB 4OD2A 2Y9RT 4N90D 1T7ZA 3BUYA 4FQXC 1BIIA 5J7CC 4I3GA 3QXAA 4PJ5A 2I5YH 1X9QA 3RNKB 5A43C 5D1XC 3RX8A 5I1DA 1UT9A 3P4OA 5L7XH 2OCFD 1QRND 2FEEL 4HJJH 2PYFB 4PJHF 3Q0HA 4UTAL 5TDPA 4OLYH 1ES0A 2DDQL 1YMMA 2WIMA 4L4VE 3H3KA 2V7HB 2VZTA 1PZ5A 3VG9C 5FECB 4Y19E 4P2YA 2A83B 4ONGH 5BRZB 1F4AA 4MD0A 1WSST 1FDLL 3L9RA 4U0RC 3TEUA 3AVEA 5I2IB 5SV3A 1DP0A 5GZOD 1JYVA 5KSUB 3I2CL 4NT6B 5L8LB 3W9DA 4OLUH 2VLKD 4WCYH 4LFHG 2FJGB 3UBXI 1NCCH 4OZFG 4XNMA 2UWEB 4J6RL 3P73A 5HYJB 1TVDA 2Y4SA 1BFOA 3TPUB 1NUDA 1FVCB 3IDXL 3ES6A 4PJ9D 3F8UB 5DEGB 4NRYA 1KCLA 5FB8A 2CDFA 2VN4A 3DUUA 5DRNA 2J1KA 4X8XA 4MAYA 2MSPA 3EYFB 5C0AB 2AGJH 1BZ7A 4PJAA 4K3DL 3LD8C 3P77B 3RHWF 1A6AB 4AYFA 5D70L 4F3FA 3AREA 3VFGH 1YPZB 1BIHA 1CFBA 3W0WA 4LVHC 4TVPH 5KS9A 2EE2A 5J1AA 3EDKA 5DO2D 1G9MC 1Q9OA 3HG1A 5T5FL 4KMLB 3CFJB 2NY4B 3MJ8A 4XP6H 2XI9A 5BW7C 1JWMB 3MOQA 2E6PA 5F96H 4WFFE 3SCMC 1S3KH 1SBSH 4JG1H 1MJUL 4WY7H 5MI0B 2YKLH 4L8CA 3TBSB 1WITA 2EH7H 4Z6AT 1Y0LB 1BZ9B 1S7QA 2R1YB 3O9WA 5F89B 5FOBA 2NR6C 5CP3A 2FIKB 1MCBA 4H1LH 4Q74A 5IFJA 1N6QH 2YBRA 3SHSA 4X7FC 4D3CH 1S9YA 5C8JA 4HMDA 3SBWA 4RGMB 3DV6B 1NFKA 1CFQB 1MAJA 1NGZB 3DVGB 3TC9A 4Z7OF 5AZ2H 2X7LA 4ELME 4HIHB 3MX0A 2D31B 2V5TA 4WU7B 5DURD 5FHBL 3T1FB 3NPSC 4QOKD 2FECL 1WQVT 1CD0A 4NP4H 1J1PL 3HCVA 4JFHD 5LAXA 3TM6A 1EAPB 3ZTJG 2FHBA 4EBQH 5D9SB 1YMHB 4YHOH 5ACZB 1JI1A 5JOFB 3NCJH 5HHQB 1NUGA 2ED9A 4HK3J 4M00A 4TSCL 3TO2B 5J89A 5K9JL 2HJLB 1PEWA 2XWBB 5D7JC 3C08L 3RL2B 3D3VA 4YPGB 1CG9A 2DI7A 2R15A 5C08D 3H9SD 5E6ID 4P46C 2R56L 4NHCL 2EIDA 2H41A 5AG9A 2C4FU 2AQ1A 3F7VB 4GRLA 3C6LA 3O3DB 1ORQB 2IPUK 1LWRA 4KXZH 5FYKH 3TT3L 3T3MF 1MVUA 5SWZB 3F58H 4ZUWA 5CWSB 1P1ZA 1KG0B 4KI1A 1XF5B 2Y6SC 4PJDB 4Q2ZB 3ZYJA 1QKZH 3GSWB 4RGND 2DAVA 1RURL 4GG8B 4KDVA 1MHPL 5D1ZB 4FQJL 4F57L 4LLMB 4P9MH 2ENYA 4MXWL 4FQXA 4CMMA 1KJ3L 2R1XB 3FQNA 4A6YL 3MA9L 4NNPL 1MWAL 2WP3T 1N59A 5D1XA 5GGTA 1MLCA 4K23L 4OGZA 5INDA 4UUJB 1AQKH 4JPKL 4RBPH 1MCLA 3O4LD 1N64H 3ULVE 4WO4D 4D9RE 4XMPL 1F4WL 2GSGA 5DRWB 4DWHA 4EXPX 4O2CB 3G04A 4PJEF 4XP1L 2XY1A 3FL7A 4JZOA 3RWIA 1U42A 5JMRA 1YEHL 3WL9B 1YEKH 5TE6L 1A2YB 1I1FA 4K71C 1S7RA 2F53A 4PJ8B 4JZNB 2UYLB 4PREB 3IS1X 4MS8D 1UWEL 3QUML 1CBVL 3MBEC 4PJ7B 4RFOL 3SJVE 3F7QA 1NMBL 1N8ZA 1R0AH 5JPNA 1NGWB 2WV3A 3SKJH 3BKCH 1A6TA 3T4YB 4FG6C 2F8XC 1T22B 5CJ5A 4EKXA 1QBBA 3FO2A 4DKFH 5CSGA 2EIZA 5FK9B 4GG6E 4HF5H 3BKJL 2DKMA 1G1CA 3G5XA 2EXYD 3HE6C 5D7JB 3EFDL 3UTZB 4OIAA 3BRDA 1U41A 5MEND 1A7NH 3WS6C 4OZFB 1A3RL 1OAKH 1J0HA 3NFNA 5BW7A 1CIUA 5JXEC 2E27H 3BKYH 3SCMA 5DJ8B 4J3XA 1J87A 4WHCA 4ERSH 2ZSVB 4MAUH 4Q6IB 4OM0L 1R24B 5CFHA 3QPXL 5IF0B 1KIQB 1DVFB 3ZHLA 1PVHA 1XGUB 4KRMB 1ORSA 5FUCC 5DJYA 3CFKB 4KRLB 2WQRA 2N56A 2ICWA 2OL3B 5I1IL 2W65B 5F93C 3RDTD 4BM7A 3PQYD 3O6ML 5C07A 2O5XL 1UFUA 1K8DA 3KPQA 4LLQB 3GO1L 5I66A 1HHHB 1NCUA 5DDHA 2J8UA 4TQEH 3E6FA 4WW2F 4MVBD 4M8VA 4WI7A 4M8QB 3ZKND 4XPAL 1PZUB 1BQHA 1FYTA 4KI5E 1A7OL 4BA8A 3OX8B 3RUGE 4HKZB 5KSBA 3KPLA 5E56A 4YAQA 1LEGB 4BH8B 5IHUL 3DGGA 1WIOA 1U8OB 4Y4KD 4S1DC 4JRXE 2CKBL 3GSQB 5EUOA 4YDIL 4U1HA 1HYRC 2EEDA 3TIDB 5EBMA 2QLVB 4LCUB 3UTTE 5K9OA 2DQIL 2IALA 2XKNA 2BX5A 3DECA 4EDWH 4BFEA 4PJXE 3MBEB 2YPLB 4P46A 5J11C 3SO3B 2W91A 2EDQA 1S7TB 4I18B 4OLEA 1KCVH 5CEZH 4JFOB 3EYSL 5M95B 2CUIA 3RVXD 4FABL 1KULA 3D1MC 3MCKA 2A9NH 1ROWA 1OSZB 4JJHA 4YDJB 2GJZA 1AI1H 5DFTA 2D9CA 4XI5C 4Y7MA 1GHFL 4R90L 5DRXB 1H3UA 4RMUA 4UOW1 4Q9QH 4Z9KB 4WVRA 4JJ5B 3CFBA 4LLYA 2EDEA 3MRMA 3CH8A 1FN4B 2FX7L 3HE6B 1NC4A 4ZYKA 2HFEB 2APXA 5EWIH 5DJCB 1F90H 2BK8A 2HT4D 4U6HA 1TVHA 4D9LH 5HJ3A 3GHBL 4NNYA 5F1KC 4FQQA 4OCNC 3EOTH 3X14A 4DKEL 4EZMA 1RIHL 1PKQA 2XA8H 4OV5B 3S8WA 3VD4A 3FB5B 5I74C 3I6KA 1WC7A 3T4AB 5CBEB 4HJ0D 4K94C 2P8MA 2VQ1B 5IV2A 1F6LL 2N7AA 4YXHH 2F54E 1PEZA 3JWOC 4BFGA 3HI5H 1FL6B 4I0CC 4UTAH 4Z78B 4JAMA 4TVPE 1BBJB 4NHUA 2LAAA 1S9WB 2FSEB 5DMYA 5HHMD 2DDQH 2M8XA 3O6FC 4JDZA 2ARJA 2VUYA 3L3DB 1NFIA 4GOSA 4XVJL 4YZFE 1F2QA 4LGPB 4Y4HD 2GJJA 1J1OH 4LRNL 3MRFA 1QLFB 3VWKC 3OTTA 1FDLH 4XXDB 4ODSL 4WJ5B 3HLAB 3D39A 2XTJE 1O5DT 4PJBA 3I2CH 5IMMA 5D1QB 5ICXA 3T0DA 1AFVL 3FO9A 4TUJA 3HR6A 2HFFA 5L2JB 3TN0C 3BD4A 4J6RH 3DX8B 3I3EA 4L4TD 4PY7A 3SPVB 1R3KA 3ULUF 5GRVL 3FN0L 2F5BH 3WS6A 4XCFL 4R4NC 4KWUA 3NCFB 4N0CD 5ICYB 2V9RA 3TJHC 5JXEA 3MJGX 3VFRA 1A6PA 4HD9A 1GGIH 4GSDL 1RZJC 4XBPA 4JM2C 3TBTB 4AM0B 1LP9F 5DT1L 5B4MD 4UQ2B 4YO0B 4K3DH 4R4BA 5KN5A 1JF5A 5D70H 1XR8A 2NY3B 4UDTA 4NYLA 5I6XC 1T4KB 3EDDA 4S0TD 1OW0A 1I1YA 2XIDA 1T5WA 5E08L 4XNUH 3B8YA 1A47A 1T1YA 5T5FH 2ZOKB 3AAZB 1BAFL 1QHPA 4R7DA 4Q9RL 2YMXL 3QXDB 2YUWA 3PNWB 3UX9B 3TBYA 1MJUH 2E8ZA 2R0LL 5ESVA 4NN7C 4X9GA 3RKDC 3TO4C 2A74B 4JREC 3RIAK 3T0EB 2WWKO 5KAQG 4WEUD 1CK0L 5AAWA 2PO6D 4P4KB 3QQ4A 4NCC1 5FYKE 4OZIA 5CAYB 1MREL 5I74B 1OHQA 2B8OT 3BE1L 2WINA 5IB1B 2HN7B 1RD6A 2ZUWA 4KXZI 3LV3A 5D7IF 3VI3E 3QEGH 4MMXC 5EUKB 4KRPB 2VZOA 3N1MC 3L6FB 2EZ0D 4L3CB 5FHBH 1K85A 4UZGA 5CBAA 1UZ6F 4QHMB 3LQMA 1AR1C 1J1PH 4ZAKC 4M6NL 3NZHL 2ERJB 2HTKD 3VWKB 1CFVL 4KHTH 3CVHL 5EIVA 3O0RL 2BCKB 5EU5B 1KNOA 3GSRA 4HX1B 5BS0D 3BZFB 5FEBA 5BO1L 2EE6A 3VFNB 3ARBD 4TSCH 3IDYB 4MA3A 4O5LL 4XAKE 4JPVL 5I18L 3OKMA 1CDCA 3N1GC 4YBQD 6CGTA 5BZWA 3ZLQC 2EYSA 3FO1B 3O2DL 4NHCH 4I4WB 3TVMC 1JK8A 1FJ1A 1ZHKA 3JV6A 2FB4L 4OD1L 3EFFA 3HRZB 4GFTB 2EICA 2ZG2A 1NLBL 3TH3T 3I85A 5CGMA 5TE7L 4O02L 2FCBA 5DS8B 3V6ZA 2H2PC 3VD7A 3TT3H 4L8SC 3CUPA 4PJIF 3QFDB 3U7AA 4CVWA 1XF4B 1Y6NR 4FFWD 3BESR 1RURH 4XZUA 1XMWA 3MTRA 4OZGE 4F57H 2F58L 4BFIA 1KJ3H 3OXSB 4QXGL 1U0QA 1MCIA 5H8DA 3OXRB 4A6YH 3MA9H 1MWAH 3BHBA 3EHBC 1YY8B 5HHOD 4K23H 3WIHA 3SDYL 4JPKH 2PF6A 1F5WA 1KCKA 4XMPH 1HHGB 1J05B 3RX7A 1F4WH 2CIKB 1FNFA 5HDLA 3P30L 3O6FA 4UAOB 3MJ7B 4QKXB 3K4ZA 4XP1H 5IVXF 2NXYC 1AHWC 1INEL 3G08B 2X4OA 3QDHA 4IOFD 1YEHH 3S4SB 2W07A 3FFDA 5IP4A 3P3YA 2RJMA 5TE6H 4YPJA 4ZXBB 2D9QB 3UTSD 3KGRA 4GBXB 4TUOA 5JXAL 4N5UA 1UB6B 1XH3B 5KVGH 2PCPA 4X7CC 3SGDH 4RZCA 3U4EA 4WRLA 1RQ5A 4X9BA 4OCSL 1UWEH 2VOTA 3TN0A 1CBVH 1JN6A 4PBXA 4RFOH 43CAB 4PRAB 3LOWA 5F6HJ 1NMBH 4JKPH 3EOYG 4TSBL 3EUUA 3PXHA 4NO2A 3VFVB 3OR6B 5CHNA 4PLJC 2H9GA 1I7ZB 1HHJA 1IKNC 1X5FA 1KYOJ 1TZHB