2MN4A

Nmr solution structure of a computational designed protein based on structure template 1cy5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
MTPEQREFLPEILAEIIANLDPTKILEELLRRGLLTPAELQEVLDLKTPEEQAKKLIDFILKLSPADVQARINVLRAHGYQALADKLNKYLTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein design with a comprehensive statistical energy function and boosted by experimental selection for foldability
pubmed doi rcsb
source organism Synthetic
molecule tags De novo protein
molecule keywords Computational designed protein based on structure template 1
total genus 25
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2014-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mn4A00
3YGSC 2DBFA 1E41A 1WMGA 2OF5H 2N00A 3EZQB 4A2WA 2KN6A 2KM6A 2YQFA 3MOPA 1FADA 4M9XA 2P1HA 3MOPK 4DWNA 4M9SA 2DO9A 1CY5A 2NAQA 4N1LA 3J63A 2DBDA 2MPCA 3EZQA 2HM2Q 1YGOA 2MB9A 1DDFA 2N1FA 4I16A 2A5YB 2N83A 2N7ZA 4IZ7B 4UZ0A 4EWIA 4LWDA 2D96A 4O9FA 3LQQA 1CWWA 2BBZA 2NSNA 2N80A 2L6AA 1D2ZB 4N1KA 4D8OA 4A2QA 1DGNA 4JUPA 2MN4A 2O71A 3T6PA 4E9MA 1WXPA 2DBGA 2DBHA 3YGSP 1D2ZA 4O7QA 2LWDA 4RHWA 1A1ZA 4ZBWA 4NQKA 2YGSA 3MOPG 2BBRA 4P4HA 1E3YA 2G7RA 1C15A 2M5VA 2YVIA 4O6XA 2NZ7A 2OF5A 2MS8A 4M9ZA 2F1SA 1UCPA 4QOBA 3LQRA 2L9MA 4FH0A 1WH4A 2MS7A 2LS7A 2LWEA 1ICHA 2B1WA 2A9IA 2GF5A 4IZ5E 4F44A 3J6JA 3CRDA 4JQWA 3QF2A 2YU0A 1N3KA 2IB1A 1PN5A 4P4HI 3CL3A 1NGRA 4F42A 4N1JA 4RHWE 1A1WA 3KATA 2N97A 2VGQA 1Z6TA 4O9LA 4IZAB
chains in the Genus database with same CATH superfamily
3YGSC 2DBFA 1E41A 1WMGA 2OF5H 2N00A 3EZQB 4A2WA 2KN6A 2KM6A 2YQFA 3MOPA 1FADA 4M9XA 2P1HA 3MOPK 4DWNA 4M9SA 2DO9A 2MJMA 1CY5A 2NAQA 4N1LA 3J63A 2DBDA 2MPCA 3EZQA 2HM2Q 1YGOA 2MB9A 1DDFA 2N1FA 4I16A 2A5YB 2N83A 2N7ZA 4IZ7B 4UZ0A 4EWIA 4LWDA 2D96A 4O9FA 3LQQA 1CWWA 2BBZA 2NSNA 2N80A 2L6AA 1D2ZB 4N1KA 4D8OA 4A2QA 1DGNA 4JUPA 2MN4A 2O71A 3T6PA 4E9MA 1WXPA 2DBGA 2DBHA 3YGSP 1D2ZA 4O7QA 2LWDA 4RHWA 1A1ZA 4ZBWA 4NQKA 2YGSA 3MOPG 2BBRA 4P4HA 1E3YA 2G7RA 1C15A 2M5VA 2YVIA 4O6XA 2NZ7A 2OF5A 2MS8A 4M9ZA 2F1SA 2XV9A 1UCPA 4QOBA 3LQRA 2L9MA 4FH0A 1WH4A 2MS7A 2LS7A 2LWEA 1ICHA 2B1WA 2A9IA 2GF5A 4IZ5E 4F44A 3J6JA 3CRDA 4JQWA 3QF2A 2YU0A 1N3KA 2IB1A 1PN5A 4P4HI 3CL3A 1NGRA 4F42A 4N1JA 4RHWE 1A1WA 3KATA 2N97A 2VGQA 1Z6TA 4O9LA 4IZAB
chains in the Genus database with same CATH topology
3YGSC 2DBFA 1E41A 1WMGA 2OF5H 2N00A 3EZQB 4A2WA 2KN6A 2KM6A 2YQFA 3MOPA 1FADA 4M9XA 2P1HA 3MOPK 4DWNA 4M9SA 2DO9A 2MJMA 1CY5A 2NAQA 4N1LA 3J63A 2DBDA 2MPCA 3EZQA 2HM2Q 1YGOA 2MB9A 1DDFA 2N1FA 4I16A 2A5YB 2N83A 2N7ZA 4IZ7B 4UZ0A 4EWIA 4LWDA 2D96A 4O9FA 3LQQA 1CWWA 2BBZA 2NSNA 2N80A 2L6AA 1D2ZB 4N1KA 4D8OA 4A2QA 1DGNA 4JUPA 2MN4A 2O71A 3T6PA 4E9MA 1WXPA 2DBGA 2DBHA 3YGSP 1D2ZA 4O7QA 2LWDA 4RHWA 1A1ZA 4ZBWA 4NQKA 2YGSA 3MOPG 2BBRA 4P4HA 1E3YA 2G7RA 1C15A 2M5VA 2YVIA 4O6XA 2NZ7A 2OF5A 2MS8A 4M9ZA 2F1SA 2XV9A 1UCPA 4QOBA 3LQRA 2L9MA 4FH0A 1WH4A 2MS7A 2LS7A 2LWEA 1ICHA 2B1WA 2A9IA 2GF5A 4IZ5E 4F44A 3J6JA 3CRDA 4JQWA 3QF2A 2YU0A 1N3KA 2IB1A 1PN5A 4P4HI 3CL3A 1NGRA 4F42A 4N1JA 4RHWE 1A1WA 3KATA 2N97A 2VGQA 1Z6TA 4O9LA 4IZAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3YGS C;  2DBF A;  1E41 A;  1WMG A;  2OF5 H;  2N00 A;  3EZQ B;  4A2W A;  2KN6 A;  2KM6 A;  2YQF A;  3MOP A;  1FAD A;  4M9X A;  2P1H A;  3MOP K;  4DWN A;  4M9S A;  2DO9 A;  1CY5 A;  2NAQ A;  4N1L A;  3J63 A;  2DBD A;  2MPC A;  3EZQ A;  2HM2 Q;  1YGO A;  2MB9 A;  1DDF A;  2N1F A;  4I16 A;  2A5Y B;  2N83 A;  2N7Z A;  4IZ7 B;  4UZ0 A;  4EWI A;  4LWD A;  2D96 A;  4O9F A;  3LQQ A;  1CWW A;  2BBZ A;  2NSN A;  2N80 A;  2L6A A;  1D2Z B;  4N1K A;  4D8O A;  4A2Q A;  1DGN A;  4JUP A;  2MN4 A;  2O71 A;  3T6P A;  4E9M A;  1WXP A;  2DBG A;  2DBH A;  3YGS P;  1D2Z A;  4O7Q A;  2LWD A;  4RHW A;  1A1Z A;  4ZBW A;  4NQK A;  2YGS A;  3MOP G;  2BBR A;  4P4H A;  1E3Y A;  2G7R A;  1C15 A;  2M5V A;  2YVI A;  4O6X A;  2NZ7 A;  2OF5 A;  2MS8 A;  4M9Z A;  2F1S A;  1UCP A;  4QOB A;  3LQR A;  2L9M A;  4FH0 A;  1WH4 A;  2MS7 A;  2LS7 A;  2LWE A;  1ICH A;  2B1W A;  2A9I A;  2GF5 A;  4IZ5 E;  4F44 A;  3J6J A;  3CRD A;  4JQW A;  3QF2 A;  2YU0 A;  1N3K A;  2IB1 A;  1PN5 A;  4P4H I;  3CL3 A;  1NGR A;  4F42 A;  4N1J A;  4RHW E;  1A1W A;  3KAT A;  2N97 A;  2VGQ A;  1Z6T A;  4O9L A;  4IZA B; 
#chains in the Genus database with same CATH topology
 3YGS C;  2DBF A;  1E41 A;  1WMG A;  2OF5 H;  2N00 A;  3EZQ B;  4A2W A;  2KN6 A;  2KM6 A;  2YQF A;  3MOP A;  1FAD A;  4M9X A;  2P1H A;  3MOP K;  4DWN A;  4M9S A;  2DO9 A;  2MJM A;  1CY5 A;  2NAQ A;  4N1L A;  3J63 A;  2DBD A;  2MPC A;  3EZQ A;  2HM2 Q;  1YGO A;  2MB9 A;  1DDF A;  2N1F A;  4I16 A;  2A5Y B;  2N83 A;  2N7Z A;  4IZ7 B;  4UZ0 A;  4EWI A;  4LWD A;  2D96 A;  4O9F A;  3LQQ A;  1CWW A;  2BBZ A;  2NSN A;  2N80 A;  2L6A A;  1D2Z B;  4N1K A;  4D8O A;  4A2Q A;  1DGN A;  4JUP A;  2MN4 A;  2O71 A;  3T6P A;  4E9M A;  1WXP A;  2DBG A;  2DBH A;  3YGS P;  1D2Z A;  4O7Q A;  2LWD A;  4RHW A;  1A1Z A;  4ZBW A;  4NQK A;  2YGS A;  3MOP G;  2BBR A;  4P4H A;  1E3Y A;  2G7R A;  1C15 A;  2M5V A;  2YVI A;  4O6X A;  2NZ7 A;  2OF5 A;  2MS8 A;  4M9Z A;  2F1S A;  2XV9 A;  1UCP A;  4QOB A;  3LQR A;  2L9M A;  4FH0 A;  1WH4 A;  2MS7 A;  2LS7 A;  2LWE A;  1ICH A;  2B1W A;  2A9I A;  2GF5 A;  4IZ5 E;  4F44 A;  3J6J A;  3CRD A;  4JQW A;  3QF2 A;  2YU0 A;  1N3K A;  2IB1 A;  1PN5 A;  4P4H I;  3CL3 A;  1NGR A;  4F42 A;  4N1J A;  4RHW E;  1A1W A;  3KAT A;  2N97 A;  2VGQ A;  1Z6T A;  4O9L A;  4IZA B; 
#chains in the Genus database with same CATH homology
 3YGS C;  2DBF A;  1E41 A;  1WMG A;  2OF5 H;  2N00 A;  3EZQ B;  4A2W A;  2KN6 A;  2KM6 A;  2YQF A;  3MOP A;  1FAD A;  4M9X A;  2P1H A;  3MOP K;  4DWN A;  4M9S A;  2DO9 A;  2MJM A;  1CY5 A;  2NAQ A;  4N1L A;  3J63 A;  2DBD A;  2MPC A;  3EZQ A;  2HM2 Q;  1YGO A;  2MB9 A;  1DDF A;  2N1F A;  4I16 A;  2A5Y B;  2N83 A;  2N7Z A;  4IZ7 B;  4UZ0 A;  4EWI A;  4LWD A;  2D96 A;  4O9F A;  3LQQ A;  1CWW A;  2BBZ A;  2NSN A;  2N80 A;  2L6A A;  1D2Z B;  4N1K A;  4D8O A;  4A2Q A;  1DGN A;  4JUP A;  2MN4 A;  2O71 A;  3T6P A;  4E9M A;  1WXP A;  2DBG A;  2DBH A;  3YGS P;  1D2Z A;  4O7Q A;  2LWD A;  4RHW A;  1A1Z A;  4ZBW A;  4NQK A;  2YGS A;  3MOP G;  2BBR A;  4P4H A;  1E3Y A;  2G7R A;  1C15 A;  2M5V A;  2YVI A;  4O6X A;  2NZ7 A;  2OF5 A;  2MS8 A;  4M9Z A;  2F1S A;  2XV9 A;  1UCP A;  4QOB A;  3LQR A;  2L9M A;  4FH0 A;  1WH4 A;  2MS7 A;  2LS7 A;  2LWE A;  1ICH A;  2B1W A;  2A9I A;  2GF5 A;  4IZ5 E;  4F44 A;  3J6J A;  3CRD A;  4JQW A;  3QF2 A;  2YU0 A;  1N3K A;  2IB1 A;  1PN5 A;  4P4H I;  3CL3 A;  1NGR A;  4F42 A;  4N1J A;  4RHW E;  1A1W A;  3KAT A;  2N97 A;  2VGQ A;  1Z6T A;  4O9L A;  4IZA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...