2MN4A

Nmr solution structure of a computational designed protein based on structure template 1cy5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
94
structure length
94
Chain Sequence
MTPEQREFLPEILAEIIANLDPTKILEELLRRGLLTPAELQEVLDLKTPEEQAKKLIDFILKLSPADVQARINVLRAHGYQALADKLNKYLTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein design with a comprehensive statistical energy function and boosted by experimental selection for foldability
pubmed doi rcsb
source organism Synthetic
molecule tags De novo protein
molecule keywords Computational designed protein based on structure template 1
total genus 25
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2014-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2mn4A00
4O7QA 3J63A 1CWWA 2M5VA 2N1FA 2A5YB 2BBRA 2B1WA 1NGRA 2L6AA 4DWNA 4RHWE 1FADA 3CRDA 2DBHA 4EWIA 2OF5H 2MS7A 2YQFA 4JQWA 4O9LA 3EZQA 2IB1A 2NAQA 1A1WA 4ZBWA 4NQKA 2NZ7A 4A2QA 4F42A 1DDFA 4M9ZA 3YGSC 4E9MA 2N97A 2DBDA 4D8OA 2F1SA 1WH4A 2GF5A 2MB9A 4P4HA 4O6XA 2A9IA 2MS8A 4M9XA 1Z6TA 2LS7A 4JUPA 3T6PA 3MOPG 3MOPA 2MPCA 2KN6A 2NSNA 1DGNA 4N1JA 1CY5A 1D2ZB 2N83A 2D96A 2DBFA 2DBGA 2YU0A 4IZ7B 3CL3A 4P4HI 1YGOA 4FH0A 2DO9A 4LWDA 2G7RA 4N1KA 1UCPA 3LQQA 4QOBA 1C15A 2BBZA 4RHWA 4IZAB 1WXPA 4F44A 3YGSP 2O71A 3EZQB 1A1ZA 1PN5A 1E41A 2YGSA 3MOPK 4I16A 4A2WA 2N7ZA 1ICHA 3KATA 4N1LA 2YVIA 3LQRA 4O9FA 4UZ0A 1WMGA 2HM2Q 2VGQA 3QF2A 2N00A 2P1HA 2LWDA 2OF5A 3J6JA 1N3KA 2N80A 2MN4A 1D2ZA 4M9SA 2LWEA 1E3YA 4IZ5E 2L9MA 2KM6A
chains in the Genus database with same CATH superfamily
4O7QA 3J63A 1CWWA 2M5VA 2N1FA 2A5YB 2BBRA 2B1WA 1NGRA 2L6AA 4DWNA 4RHWE 1FADA 3CRDA 2DBHA 4EWIA 2OF5H 2MS7A 2YQFA 4JQWA 4O9LA 3EZQA 2IB1A 2MJMA 2NAQA 1A1WA 4ZBWA 4NQKA 2NZ7A 4A2QA 4F42A 1DDFA 4M9ZA 3YGSC 4E9MA 2N97A 2DBDA 4D8OA 2F1SA 1WH4A 2GF5A 2MB9A 4P4HA 4O6XA 2A9IA 2MS8A 4M9XA 1Z6TA 2LS7A 4JUPA 3T6PA 3MOPG 3MOPA 2MPCA 2KN6A 2NSNA 1DGNA 4N1JA 1CY5A 1D2ZB 2N83A 2D96A 2DBFA 2DBGA 2YU0A 4IZ7B 3CL3A 4P4HI 1YGOA 4FH0A 2DO9A 4LWDA 2G7RA 4N1KA 1UCPA 3LQQA 4QOBA 1C15A 2BBZA 4RHWA 4IZAB 1WXPA 4F44A 3YGSP 2O71A 3EZQB 1A1ZA 1PN5A 1E41A 2YGSA 3MOPK 4I16A 4A2WA 2N7ZA 1ICHA 3KATA 4N1LA 2YVIA 3LQRA 4O9FA 4UZ0A 1WMGA 2HM2Q 2XV9A 2VGQA 3QF2A 2N00A 2P1HA 2LWDA 2OF5A 3J6JA 1N3KA 2N80A 2MN4A 1D2ZA 4M9SA 2LWEA 1E3YA 4IZ5E 2L9MA 2KM6A
chains in the Genus database with same CATH topology
4O7QA 3J63A 1CWWA 2M5VA 2N1FA 2A5YB 2BBRA 2B1WA 1NGRA 2L6AA 4DWNA 4RHWE 1FADA 3CRDA 2DBHA 4EWIA 2OF5H 2MS7A 2YQFA 4JQWA 4O9LA 3EZQA 2IB1A 2MJMA 2NAQA 1A1WA 4ZBWA 4NQKA 2NZ7A 4A2QA 4F42A 1DDFA 4M9ZA 3YGSC 4E9MA 2N97A 2DBDA 4D8OA 2F1SA 1WH4A 2GF5A 2MB9A 4P4HA 4O6XA 2A9IA 2MS8A 4M9XA 1Z6TA 2LS7A 4JUPA 3T6PA 3MOPG 3MOPA 2MPCA 2KN6A 2NSNA 1DGNA 4N1JA 1CY5A 1D2ZB 2N83A 2D96A 2DBFA 2DBGA 2YU0A 4IZ7B 3CL3A 4P4HI 1YGOA 4FH0A 2DO9A 4LWDA 2G7RA 4N1KA 1UCPA 3LQQA 4QOBA 1C15A 2BBZA 4RHWA 4IZAB 1WXPA 4F44A 3YGSP 2O71A 3EZQB 1A1ZA 1PN5A 1E41A 2YGSA 3MOPK 4I16A 4A2WA 2N7ZA 1ICHA 3KATA 4N1LA 2YVIA 3LQRA 4O9FA 4UZ0A 1WMGA 2HM2Q 2XV9A 2VGQA 3QF2A 2N00A 2P1HA 2LWDA 2OF5A 3J6JA 1N3KA 2N80A 2MN4A 1D2ZA 4M9SA 2LWEA 1E3YA 4IZ5E 2L9MA 2KM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7Q A;  3J63 A;  1CWW A;  2M5V A;  2N1F A;  2A5Y B;  2BBR A;  2B1W A;  1NGR A;  2L6A A;  4DWN A;  4RHW E;  1FAD A;  3CRD A;  2DBH A;  4EWI A;  2OF5 H;  2MS7 A;  2YQF A;  4JQW A;  4O9L A;  3EZQ A;  2IB1 A;  2NAQ A;  1A1W A;  4ZBW A;  4NQK A;  2NZ7 A;  4A2Q A;  4F42 A;  1DDF A;  4M9Z A;  3YGS C;  4E9M A;  2N97 A;  2DBD A;  4D8O A;  2F1S A;  1WH4 A;  2GF5 A;  2MB9 A;  4P4H A;  4O6X A;  2A9I A;  2MS8 A;  4M9X A;  1Z6T A;  2LS7 A;  4JUP A;  3T6P A;  3MOP G;  3MOP A;  2MPC A;  2KN6 A;  2NSN A;  1DGN A;  4N1J A;  1CY5 A;  1D2Z B;  2N83 A;  2D96 A;  2DBF A;  2DBG A;  2YU0 A;  4IZ7 B;  3CL3 A;  4P4H I;  1YGO A;  4FH0 A;  2DO9 A;  4LWD A;  2G7R A;  4N1K A;  1UCP A;  3LQQ A;  4QOB A;  1C15 A;  2BBZ A;  4RHW A;  4IZA B;  1WXP A;  4F44 A;  3YGS P;  2O71 A;  3EZQ B;  1A1Z A;  1PN5 A;  1E41 A;  2YGS A;  3MOP K;  4I16 A;  4A2W A;  2N7Z A;  1ICH A;  3KAT A;  4N1L A;  2YVI A;  3LQR A;  4O9F A;  4UZ0 A;  1WMG A;  2HM2 Q;  2VGQ A;  3QF2 A;  2N00 A;  2P1H A;  2LWD A;  2OF5 A;  3J6J A;  1N3K A;  2N80 A;  2MN4 A;  1D2Z A;  4M9S A;  2LWE A;  1E3Y A;  4IZ5 E;  2L9M A;  2KM6 A; 
#chains in the Genus database with same CATH topology
 4O7Q A;  3J63 A;  1CWW A;  2M5V A;  2N1F A;  2A5Y B;  2BBR A;  2B1W A;  1NGR A;  2L6A A;  4DWN A;  4RHW E;  1FAD A;  3CRD A;  2DBH A;  4EWI A;  2OF5 H;  2MS7 A;  2YQF A;  4JQW A;  4O9L A;  3EZQ A;  2IB1 A;  2MJM A;  2NAQ A;  1A1W A;  4ZBW A;  4NQK A;  2NZ7 A;  4A2Q A;  4F42 A;  1DDF A;  4M9Z A;  3YGS C;  4E9M A;  2N97 A;  2DBD A;  4D8O A;  2F1S A;  1WH4 A;  2GF5 A;  2MB9 A;  4P4H A;  4O6X A;  2A9I A;  2MS8 A;  4M9X A;  1Z6T A;  2LS7 A;  4JUP A;  3T6P A;  3MOP G;  3MOP A;  2MPC A;  2KN6 A;  2NSN A;  1DGN A;  4N1J A;  1CY5 A;  1D2Z B;  2N83 A;  2D96 A;  2DBF A;  2DBG A;  2YU0 A;  4IZ7 B;  3CL3 A;  4P4H I;  1YGO A;  4FH0 A;  2DO9 A;  4LWD A;  2G7R A;  4N1K A;  1UCP A;  3LQQ A;  4QOB A;  1C15 A;  2BBZ A;  4RHW A;  4IZA B;  1WXP A;  4F44 A;  3YGS P;  2O71 A;  3EZQ B;  1A1Z A;  1PN5 A;  1E41 A;  2YGS A;  3MOP K;  4I16 A;  4A2W A;  2N7Z A;  1ICH A;  3KAT A;  4N1L A;  2YVI A;  3LQR A;  4O9F A;  4UZ0 A;  1WMG A;  2HM2 Q;  2XV9 A;  2VGQ A;  3QF2 A;  2N00 A;  2P1H A;  2LWD A;  2OF5 A;  3J6J A;  1N3K A;  2N80 A;  2MN4 A;  1D2Z A;  4M9S A;  2LWE A;  1E3Y A;  4IZ5 E;  2L9M A;  2KM6 A; 
#chains in the Genus database with same CATH homology
 4O7Q A;  3J63 A;  1CWW A;  2M5V A;  2N1F A;  2A5Y B;  2BBR A;  2B1W A;  1NGR A;  2L6A A;  4DWN A;  4RHW E;  1FAD A;  3CRD A;  2DBH A;  4EWI A;  2OF5 H;  2MS7 A;  2YQF A;  4JQW A;  4O9L A;  3EZQ A;  2IB1 A;  2MJM A;  2NAQ A;  1A1W A;  4ZBW A;  4NQK A;  2NZ7 A;  4A2Q A;  4F42 A;  1DDF A;  4M9Z A;  3YGS C;  4E9M A;  2N97 A;  2DBD A;  4D8O A;  2F1S A;  1WH4 A;  2GF5 A;  2MB9 A;  4P4H A;  4O6X A;  2A9I A;  2MS8 A;  4M9X A;  1Z6T A;  2LS7 A;  4JUP A;  3T6P A;  3MOP G;  3MOP A;  2MPC A;  2KN6 A;  2NSN A;  1DGN A;  4N1J A;  1CY5 A;  1D2Z B;  2N83 A;  2D96 A;  2DBF A;  2DBG A;  2YU0 A;  4IZ7 B;  3CL3 A;  4P4H I;  1YGO A;  4FH0 A;  2DO9 A;  4LWD A;  2G7R A;  4N1K A;  1UCP A;  3LQQ A;  4QOB A;  1C15 A;  2BBZ A;  4RHW A;  4IZA B;  1WXP A;  4F44 A;  3YGS P;  2O71 A;  3EZQ B;  1A1Z A;  1PN5 A;  1E41 A;  2YGS A;  3MOP K;  4I16 A;  4A2W A;  2N7Z A;  1ICH A;  3KAT A;  4N1L A;  2YVI A;  3LQR A;  4O9F A;  4UZ0 A;  1WMG A;  2HM2 Q;  2XV9 A;  2VGQ A;  3QF2 A;  2N00 A;  2P1H A;  2LWD A;  2OF5 A;  3J6J A;  1N3K A;  2N80 A;  2MN4 A;  1D2Z A;  4M9S A;  2LWE A;  1E3Y A;  4IZ5 E;  2L9M A;  2KM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...