2MO1A

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp with dt7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFTAIEADGFRTLNEGEHVEFEVEPGRGGKGPQAKKVRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold-shock DNA-binding domain protein
publication title Structure and flexibility of the thermophilic cold-shock protein of Thermus aquaticus
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mo1A00
4DR1L 2RHQB 1NE3A 4YCVA 4HIOA 3G71A 3GD7A 4JI8L 5LMNQ 4OXPA 4DV6Q 2AHOB 1EFWA 1WOCA 4TQUS 2BA1A 1SRUA 3M9BA 3GTPH 4X64L 5C3EH 1JT8A 4LF8Q 1XTDA 3G48A 1SR3A 1C7YA 5FJ8H 2R92G 3PUXA 2Q2IA 4GOPB 1GVPA 4DUZQ 1VQPA 1NTGA 5K36G 1VQ9A 3Q8DA 4ME3A 1PH7A 3CCEA 5FLXc 4JI3L 2Y0SE 3F1ZA 1Q86C 5HY6A 4DV4Q 1YIJA 1PH2A 1A62A 3K0XA 1WYDA 1HZAA 3T1YQ 3PUZA 4A3CH 3HOWG 2LXKA 2F3IA 3HOZH 5C0XI 1A63A 1EQRA 3IRBA 5GAGC 2CWAA 4A3EG 1M1KC 1TWAH 2HQLA 1E1TA 2KCMA 4MZ9A 2RHSB 3F2BA 2VQEL 3AYHB 4H02A 4JBJA 1IYJB 5IYCH 5M5XH 4YWMA 3KOJA 3G4SA 4BXXG 4LNQA 2JEBI 2ZJPA 1XNQQ 3CMEA 3NELA 3A5ZB 4LW1A 4A3DH 4WJ4A 5AJ3L 3LGJA 2UXBQ 5FJ8G 1L2FA 4WJ3M 4BA1I 3CCUA 4DR5L 4DK6C 2D62A 2HHHL 4DR6Q 2JK8A 1XJVA 1GM5A 1YNXA 4DR2Q 1CUKA 2N78A 4QJFA 4LF5Q 2VUMH 5C0XG 4POGA 2OQ0A 4IPDA 2JA7H 3M4PA 4A3CG 3HOZG 3GTOH 2Z0SA 2PI2A 1IL2A 3S14H 4JV5L 4DV2L 5IYCG 3UDFA 5GADC 3ULLA 3I7FA 2JA9A 4JI5Q 3CCLA 1XMOQ 1X54A 3T1HQ 3W1GA 4LF6L 3H15A 4DNIA 1Q81C 1VQBA 1Q1EA 1AE2A 5LMUL 4L5SA 4AQYL 4OO1I 1N32Q 4LF7Q 3BZCA 2MQHA 5E7NA 4DV1Q 4LFCQ 1I94L 2PQAA 2UUBQ 1RIPA 3CW2C 3AFPA 4IFDJ 1WFQA 3TREA 1M90C 2UUCL 4DR7Q 3CCMA 2VNUD 4RMFA 3HOYH 3S24A 3CF5A 1EIYB 2VUMG 2JA7G 1K0RA 4GN4B 4BY1H 1P8LA 1V1QA 2KHJA 1IBKQ 4PZ7A 4PZ6A 2K5VA 4IO9A 2E2JH 3K80C 2PNHA 4UP9A 3CCJA 1G291 4XTCS 4GKJQ 1L1OA 1LM0A 3M7NA 3F8TA 4LFBQ 1GKHA 4LF9L 1Q8KA 4DR3L 2YYZA 1HNZQ 2R7FA 4B3TQ 2IY5B 2D0OA 1C9OA 4X6AH 5JEAJ 4QGUA 4B3RQ 1KD1C 1FVIA 1VQDA 3CD6A 3I56A 2UUAL 1IBLQ 4C3HH 2NVYH 1CSPA 4DUYL 4LFAL 4APVA 2NN6I 1VQHA 2GN5A 4DR4L 1I6HH 4BY1G 3FHWA 3KDFB 2OCEA 4JI1L 4GLAC 3PF5A 3FKIH 2ID0A 1TXYA 3PGZA 3KJOA 2MO1A 2Q2TA 4JI7Q 1X9NA 3M3YH 4LUOA 4JI8Q 1HZ9A 3PO2H 2QA4A 4LUZA 1E3PA 2UU9L 1E22A 2V1CC 4X64Q 1KQSA 4R1JA 4JYAL 1VQOA 1J6QA 2ES2A 4X66L 3A5UA 3HOVH 3EN2A 1HR0W 1H95A 1P16A 3HFZB 4GNXC 3F2CA 3CC7A 1VQGA 1S72A 2IT1A 4HIDA 4X65L 1IZ6A 4A3IH 1QVGA 2JA8H 1OXXK 3FKIG 2XGTA 4B3SL 2YTXA 3H3VH 4JBWA 1VQMA 1I3QH 3RZOH 4KHPL 4L5TA 2K52A 1CKNA 1TWFH 2CKZB 1AH9A 4ALPA 1OXSC 2R92H 2E5LQ 3S2DH 3GTGH 1W3SA 4GOPC 4L5RC 1FJGQ 1O7IA 2N3SA 1BVSA 1DGSA 3D0FA 4PG3A 5J3BA 3CMAA 4B3MQ 3HOVG 1MKHA 2F52A 4QQBX 2FXQA 1K9MC 1QUQB 1SMXA 2UXCQ 1HZBA 4JI0L 3SGIA 1SE8A 3HOWH 3J81j 2R7ZH 4A3EH 3CCSA 4A3IG 5GQOA 3RNUA 2KENA 5BR8Q 2R7DA 2JA8G 3S1MH 2VL6A 1EQQA 4BXXH 1PFSA 3BJUA 1PHJA 2VW9A 4OONA 2E8GA 4DV2Q 1QZGA 1PH6A 3OTOL 1X55A 4JOIC 3GTQH 2VQFL 1HR0Q 4YY3Q 2DGYA 4P72A 2YTYA 3JAMi 4UP7A 3RN5A 2ASBA 1MJCA 1N9WA 3CXCA 1W2BA 2WB1E 2JQOA 4AQYQ 1PH8A 4R4IA 2WAQE 5IP7G 1YITA 4C2MH 4IFDI 2UXDL 5IWAL 4UPAA 1VQ4A 3PCOB 4JI4Q 2Y0SG 4JC0A 1GO3E 1X6OA 2UUCQ 4AYBE 5IE8A 2JA5H 4OX9Q 2R7ZG 3CPFA 4AYBG 3AQQA 1VQEA 2GVBA 4JCVE 4NPSA 4LF4Q 3A74A 3GTLH 1I50H 1N33L 3EBEA 2K5NA 2NVQH 5C4JH 1OTCA 3CPWA 1TWHH 5IT9c 5H1SE 4X62Q 4IJLA 3ICEA 3UDXA 4JI2L 1HH2P 2Z6KC 2NZHA 3PO3H 4Y52H 1X3FA 4LF9Q 3W1BA 4KHZA 4R4CA 1K73C 1XNRL 5JJKA 3FP9A 2K4KA 3K81C 1HNXQ 4O0AA 3RLFA 4JI6Q 1LUZA 3K8AA 1IBMQ 4DKAC 4DV3L 1N36L 4IOCA 3KF6A 2ZM6L 2YTVA 1PV4A 1NY4A 2JA5G 1TWGH 4NXML 4QL5A 2NVTH 2IHEA 1B7YB 5M3MG 5M5WH 4DK3C 2K5HA 3CCVA 1KRSA 4YWKA 1PH9A 2AMCB 4K0KL 3PO3G 1IXRA 5JEAG 1JB7A 4DV0Q 1QZHA 3S15H 4P73A 3NEMA 1EIFA 1GD7A 1WI5A 4DV7L 3KFUA 4A3MH 1NJIC 1E1OA 2RF4A 2VZAA 3CP0A 3HOUG 2D0PA 4POFA 1YHBA 1EOVA 5FLMH 3U4VA 4YWLA 3GTJH 4DV5Q 1XMQQ 1I5FA 1Z47A 4LWCA 4IJHA 2E2IH 5LMNL 2WP8J 3MXNB 1X65A 2A19A 3NBHB 4DV6L 2NVXH 1CKMA 3TS0A 1L1OC 1VQLA 1HNWQ 3PUWA 1PH5A 4LF8L 1EUJA 1QVCA 1BKBA 4P74A 2CCZA 4A3JG 1UE7A 2EIFA 4P75A 4HJ9A 3CC4A 1VQIA 2IX0A 2A8VA 1JE5A 4DPGA 2PQAB 4JG2A 3F2DA 4YHHQ 1YEZA 4DUZL 4OO1G 1YI2A 2C35B 3TEHB 4DV4L 5IYDG 1KC8C 4A3MG 2CWPA 2KCTA 3T1YL 1ASZA 1Y1WG 4A3FH 5FLMG 2IX1A 2AKWB 1J5EQ 1N34L 4NXNL 1VQNA 1EWIA 2ZJRA 1L1OB 1KHIA 3H0GH 4DR1Q 1XNQL 2JA6G 1OXTA 2JEAI 3S17H 1SROA 1E7ZA 2B29A 2Q2UA 3U50C 3L7ZC 2DUDA 1TWCH 4HJ5A 2JE6I 1NMGA 4PZ8A 1EYGA 2VQFQ 4DR6L 4L5QA 4R4QA 2ZTCA 4DR2L 1BBUA 3M4QA 1S3OA 2MO0A 4LF5L 1G51A 1MIUA 2PMZE 4A3FG 2NN6G 3J80i 1E24A 4O2DA 4JI3Q 3CC2A 1YBYA 1VQ7A 2I5MX 3E0EA 1A8VA 4IPCA 3ULPA 4GN5A 3JC66 4A4IA 4P71A 4JI5L 3RR5A 3H0GG 1XMOL 3M4OH 3T1HL 2VQEQ 5C4XH 3HKZE 5IYBG 3BU2A 3G6EA 1Q82C 4DR4Q 1N33Q 1L0WA 1B8AA 1VQFA 1YJ9A 4LF7L 5IY0A 2LXJA 4DV1L 4LFCL 2UUBL 2YU9H 4DR7L 5AJ3Q 2R93G 2ZTEA 2ATWA 1B70B 4UP8A 5IP7H 2OWOA 1VS0A 1NBWA 4DR5Q 3JAMc 3RLOA 1VQ6A 1PH4A 2HHHQ 3K7AH 1IBKL 4GNXA 2F4VL 4YCWA 1NMFA 1CKNB 2B3GA 1QVFA 4GKJL 4NXMQ 3B6YA 2ZJQA 4OWWB 4LFBL 2IHFA 1K8GA 3RLNA 1HNZL 5C4XG 4B3TL 4JV5Q 5DLQE 2I5HA 4B3RL 3STBC 3PIPA 1N8RC 2H5XA 2K50A 2ZTDA 1WCMH 4LF6Q 1WJJA 1Z9FA 3UE1A 5LMUQ 2PI2E 4IOAA 1MJEA 1IBLL 2N49A 2OTJA 4EX5A 1UE1A 1AE3A 2MFIA 2WB1G 2MNAA 4GOPA 4OWXB 1G6PA 2WAQG 4IPHA 4KI0A 1I94Q 1KXLA 2LSSA 1CSQA 1PYSB 4GS3A 4KLKA 1JJ2A 2VS1A 3CAMA 4UY8C 4JI7L 3AEVA 2I0QA 1YZ6A 5M3FH 3PF4A 3MEFA 5M3MH 4BBRH 2E2HH 4BY7H 4A3BG 4AH6A 3ER0A 2K14A 3HOXH 2AWNA 3EIVA 3J81c 3KJPA 5M5YH 4GLVB 3CCRA 3I4NH 4GKKL 1WCMG 1PA6A 4DR3Q 4JOIA 3S1RH 4IFDG 4PMWA 3STBD 1Q1BA 3I2ZA 5IP9H 3HOUH 4QY7A 1FGUA 3UDIA 3GO5A 5GAEC 3DM3A 5C44G 2UUAQ 4MTNA 5GAHC 3TS2A 1X3EA 3D31A 2OTLA 2HIXA 4LFAQ 4DUYQ 4A3GH 1VCIA 3GTMH 5M3FG 3J81i 1K83H 4A3LH 3CQZH 3E9HA 1KRTA 4JI1Q 4BBRG 4A3KH 4JBMA 3J7A5 4A3JH 3RZDH 4BY7G 2XTIA 2E5LL 4BA2I 1XPRA 5C3EG 4YCUA 4HIKA 4R4TA 3HOXG 1FJGL 4RG1A 3I4OA 4B3ML 3I4NG 2Z6KA 2UU9Q 2VY3A 4JYAQ 3HKSA 5IYDH 2UXCL 1KIXA 3KF6B 4IPGA 2OQKA 1Y1WH 5IP9G 4BBSH 4X66Q 4GLXA 3L0OA 1VQJA 2WFWA 3ERSX 1S40A 1V9PA 5BR8L 3UDGA 3S1QH 1SLJA 1PYBA 3BZKA 2JJQA 3U58A 3S1NH 4A3GG 4X65Q 1JJCB 1RL2A 2JA6H 2B63H 4A3LG 1PH3A 4A3KG 4C3JH 3L2PA 1HR0L 1U5KA 4YY3L 3PUYA 1ASYA 1YVCA 4B3SQ 1OXVA 3S16H 5GROA 4A3DG 4KHPQ 3A0JA 1X56A 4HJAA 3DLLA 1UEBA 3J7ZC 5ELNA 1Y14B 1JMCA 1Y1VH 4DAMA 1KAWA 4JI4L 3RN2A 3ZJYC 4OX9L 4QIWE 1N34Q 3KLWA 3PSIA 4J15A 3VDYA 1PH1A 4BBSG 1V43A 4LF4L 2NZOA 4MNOA 5C0XJ 4JI0Q 1VQ5A 2A1AA 3J80c 2F4VQ 1LTLA 1Q12A 1T9HA 3W5OA 4X62L 1YHAA 3CCQA 2B63G 5IYBH 1UWVA 3KDFA 3PV0A 3M85A 2Q2HA 1YJWA 3K7UC 2UXBL 2YV5A 3KYHC 1UE6A 1LYLA 2ALYB 2R6GA 2BH2A 4HIMA 4NXNQ 3OTOQ 4GN3B 2CFMA 1HNXL 2CQOA 2R93H 3S2HH 1A0IA 4A75A 2AWOA 4JI6L 1IBML 1Y1VG 1VQKA 2L15A 3WWVA 4R4OA 1VQAA 1Q7YC 3ULJA 3HOYG 2BH8A 5IWAQ 2UXDQ 3NENA 4XIGS 1PVOA 4Y7NH 4HJ8A 4TVAB 4EQ5A 1C0AA 3I4MH 3KF8B 1XPOA 3UE0A 4DV0L 1K8AC 4A93H 2BA0A 4C3IH 3HKZG 2GVAA 2EXDA 2QEXA 5LMNW 1N32L 3TQYA 2I5LX 4JI2Q 1SN8A 1K3RA 1XMQL 4AIMA 4DV5L 4GKKQ 1YHQA 1XNRQ 5JJIA 1SFOH 1VQ8A 2RCNA 1KL9A 5EAYA 1R9TH 3TRZA 5HGQA 5ELOA 1CKOA 1BBWA 2KHIA 1HNWL 1HZCA 1QUQA 4JBKA 1N36Q 4DV3Q 2ZM6Q 1VQCA 2KBNA 4FDBA 3GDEA 4NB3A 4OWTB 4DAYB 4LUVA 1Q46A 3I4MG 4A3BH 3H3VI 2HIVA 3PO2G 4A93G 3AFQA 4YHHL 1FL0A 1JJGA 3I55A 4K0KQ 1U0LA 2HT1A 1X3GA 5JJLA 2QGQA 3U4ZA 4A76A 1UE5A 1OXUA 3OYYA 1YJNA 3OW2A 2EQSA 1J5EL 3PIOA 4DV7Q 4GNXB 1D8LA 1HJPA 2K75A 1XPUA 3GTKH 2N8NA 5C44H 3PUVA 1D7QA 3E9IA 4HJ7A
chains in the Genus database with same CATH superfamily
4DR1L 5CV4A 1EY9A 3GD7A 1EFWA 2BA1A 4KMUC 1JCKB 1JT8A 1QJOA 1XTDA 3FVQA 4K8IA 3FPPA 5CV5A 1VQPA 2JSOA 1VQ9A 5FLXc 2MPMA 1SMYD 5HY6A 5I6WA 4ZUIA 1WYDA 1HZAA 5ELFA 4A3CH 1EWHA 2EYFA 2RBMA 1A63A 1EQRA 3IRBA 5GAGC 1C0AA 2VQEL 3HRZC 3F2BA 2RHSB 4JBJA 4H02A 5IYCH 4V0BA 3VR3A 4EGVA 1XNQQ 4WJ4A 1U4LA 5AJ3L 4HR7B 4RWSC 3CCUA 1H9JA 1WTVA 1L0XB 2G9HD 2HHHL 4PNYA 1HFNA 1GM5A 1YNXA 5ELEA 4A3CG 4IPDA 2WV6D 3M4PA 2RQXA 3QR8A 3GTOH 2PI2A 1IL2A 1EZ6A 1Q3LA 4J1MA 2LFNA 5IYCG 3QOLA 3UDFA 2HDMA 2OEOA 4CDEC 1GUOA 3CCLA 1KNEA 1SBBB 4LF6L 1Q81C 1VQBA 3WOEA 4L5SA 5KNBA 1I94L 5IGEA 1RIPA 1S5ED 4IFDJ 2VNUD 3SVMA 2K32A 3HOYH 1EIYB 4BY1H 3DUZA 1V1QA 2J0TD 3NHHA 1RF2D 2K5VA 4JPBW 4N8FA 1G291 1CZWA 1V1OA 5FOBB 1LACA 4LF9L 1HNZQ 3VYUA 2R7FA 2D0OA 5C3WA 2F03A 2L1BA 1YNJC 1KD1C 2NTSA 1JICA 1H9KA 3HZXA 1WCMB 3CD6A 1U4MA 4DUYL 1E2ZA 1BUVT 1GXDC 4BY1G 3FHWA 1C48A 1T5EA 2ID0A 3M3YH 1PTOB 5CV8A 1X9NA 1NR2A 2QILA 2QA4A 5JOBA 2E2HB 4CKCA 1II3A 1VQOA 3HOXB 1I4RA 1QCBD 1WTOA 3HOVH 3EN2A 4QF4A 3S1RB 3HFZB 2HCCA 4GNXC 3VYSA 1S72A 3K58A 5ELBA 2A5HA 4A3IH 1QVGA 3BYYB 2F0JA 1OXXK 2XGTA 2O2LD 5HGTA 3OIQA 1TKWB 4L5TA 5L37A 1TWFH 2KA7A 1AH9A 1OXSC 2R92H 3RZDB 1VMCA 3S2DH 1CT1D 1FJGQ 1KLGD 4A3DB 2HD3A 1DGSA 3HOVG 1MKHA 2LMCB 1QUQB 2PNRC 4K8JA 4EVOA 4E6IA 4A3EH 1UAPA 4A3IG 3S1QB 2TMPA 1PHJA 3I70A 2VW9A 3S1NB 5E1FA 4MIUA 2B63B 1ZXTA 1X55A 5IODA 2YTYA 3RN5A 2WB1E 1FNWA 1VMPA 4RKLA 2WAQE 1I4PA 1GOZA 1S5DD 4UPAA 4JI4Q 3PCOB 1ENAA 4JC0A 5C0XH 2JA5H 3KK7A 2KCNA 5FO8B 4JCVE 3A74A 2NVQH 2K5NA 5JVG3 5C4JH 1NR4A 3CPWA 5IT9c 5H1SE 3PO3H 4Y52H 3ICEA 3UDXA 4JI2L 2Z6KC 2Z8LA 2NZHA 5EBDA 3HKZB 1T5XD 4LF9Q 4R4CA 4V190 2Z1CA 2K4KA 1E2VA 2R93B 3T56B 4WJWA 1IBMQ 4C1NK 1G6ZA 2KCCA 2B2UC 1CA6A 2JA5G 1A2UA 4F87A 2NVTH 1B7YB 4XQQA 3CCVA 4Y7NB 2JYOA 1PFBA 2AMCB 4IZ8A 1HFGA 4DAPA 2B2WA 3PO3G 5JEAG 1W6KA 3EJIA 1X32A 1QZHA 4C3IB 4P73A 3A7LA 4DV7L 3LWEA 4A3MH 1NJIC 1BQQT 1IW7C 2I46A 1XMQQ 3GTJH 3TN2A 1Z47A 4LWCA 2NVXH 5IGDA 4IALA 4IUTA 1CKMA 4EQPA 2WKDA 4LF8L 3OWFA 1AZQA 1UE7A 2DJGC 3OHXC 1YEZA 3BVGA 1BCPC 2C35B 4KN7C 1KC8C 4A3MG 3D4DA 3T1YL 3W3AA 1ASZA 4WRDA 2B8FA 2AKWB 1IL8A 1GUWA 2KHSA 2QCPX 4NXNL 5CV9A 3H91A 5CORA 2EJGC 1SROA 2EDGA 5KRUA 1PMRA 1O80A 3KF8A 1IYUA 3L7ZC 1CK1A 3GTPB 1TWCH 5C3EB 2JE6I 1PDQA 3DWAA 1ENCA 4R4QA 2ZTCA 1S3OA 4LF5L 1MIUA 2SDFA 3NPPA 1BO0A 4O2DA 4JI3Q 4RAUC 1VQ7A 2NBFA 4P71A 3J7AV 3RR5A 2F0EA 1WVLA 1YNND 1XMOL 3T1HL 4K5XA 3BU2A 4HN7A 1YJ9A 3OPOA 5IY0A 1CM9A 3TDQA 3IFDA 1WTPA 3E5SA 2R93G 2X6LA 2ATWA 2GA4B 2OWOA 4LMQD 3JAMc 3URYA 3K7AH 2F4VL 4XT1B 2VUMB 4GKJL 5EGTA 2IHFA 2ICEC 1K8GA 3S14B 2FJ2A 4B3TL 2F3VA 3STBC 1HA6A 1N8RC 1CTMA 2H5XA 2ZTDA 4IOAA 2H1EA 4IFDH 1MJEA 1IBLL 5BN4A 1D5ZC 2MFIA 5CGKA 2L5TA 5JAVA 2MUYA 2PZUA 4RKBA 4M8AA 4GS3A 1PYSB 5KNDA 1JJ2A 1Z7TA 4UY8C 5CBEE 1TS4A 4BS9A 2EJMA 2EXZA 4BBRH 4A3BG 2K14A 2G9DA 1JE4A 3OSOA 2K1BA 3HG9A 4OHJA 3VR5A 5KGUA 1AN8A 4IFDG 4PMWA 5TSSA 1JC7A 3NUCA 2A6EC 1TS5A 5GAEC 2UUAQ 3TS2A 1LTSD 3GP7A 4C3HB 1AEXA 2AUKA 4LFAQ 2OTLA 4X3KA 1H9MA 3GTMH 1ILQA 3J81i 4FF4A 3E9HA 4BBRG 5IT9L 4A3JH 2XTIA 3I8ZA 3I72A 1R4QB 5C3EG 2LKVA 2A74C 4RG1A 3S17B 3HGBA 5KNCA 2UU9Q 4JYAQ 2L9HA 3HKSA 5ISRA 2UXCL 4FXKC 1Y1WH 4BBSH 1KLUD 1VQJA 3ERSX 1Q8IA 1EY4A 3TP5A 1RL2A 2JA8B 2K5DA 2E75C 4B3SQ 1OXVA 2BOSA 1I3QB 3BDCA 2Z4IA 4YIJA 3DLLA 1DOLA 1IYVA 4DAMA 2N55A 1XYIA 1H9RA 4OX9L 4BBSG 2RSOA 3VDYA 1UNSA 3DWQA 4LF4L 2NZOA 4KY5A 2PO4A 3HOWB 2A1AA 3J80c 2F4VQ 2LY7A 3W5OA 1RKNA 1UWVA 2A73B 3PV0A 1YJWA 2Q2HA 4DNTB 3S1MB 4KN4C 2YV5A 3QIAA 3KYHC 1J9OA 4ILWA 1HNXL 1EY5A 2CQOA 3EVQA 1EIHA 2AWOA 3WWVA 2B2YA 4C2MB 2UXDQ 5IWAQ 2NZ1D 3NENA 1F9SA 2XRSD 2K28A 4TVAB 1OO9B 1HCZA 1TVXA 2Q8RE 5T1GA 3TP6A 1ONLA 3KF8B 2XVSA 4DV0L 1K8AC 4A93H 3GTLB 1I50B 3CRKC 2QEXA 2EXDA 1N32L 3K6OA 1SNQA 2HDLA 3TQYA 1TWHB 4DGZA 1SN8A 1K3RA 1STBA 1SFOH 1R9TH 4DK0A 1YNJD 1HNWL 1N36Q 4DV3Q 1VQCA 4NB3A 3GDEA 1UUPA 1EFID 5M5WB 4A93G 1AW7A 1CI3M 4K0KQ 3A8KE 1MD2D 1X3GA 2F3WA 5JJLA 4G7ZC 4FNFA 3OYYA 1DJRD 3P7JA 2J7ZA 3JAML 3GTKH 1XPUA 1DONA 4K2LA 4HJ7A 2RHQB 4IUUA 1PYWD 4YCVA 4HIOA 3G71A 2E2IB 2F0LA 4JI8L 4OXPA 2L0CA 2BE5C 4J8QA 4KKUA 3IL8A 3QG1A 4X64L 2DNEA 2F0SA 1RTOA 5FJ8H 2Q2IA 3N52A 1S5FD 4RFBA 1GVPA 2RVLA 4ULLA 3Q8DA 1ZYRD 2Y0SE 3F1ZA 1Q86C 4DV4Q 2B2TA 2PCFB 4LAAA 1A15A 4HTHA 3LX0A 3HOWG 1EY6A 1D5XC 2F3IA 3ONAB 4PV1C 5C0XI 1VQ8A 3HOZH 2CWAA 1QB5D 1V1PB 1M1KC 3MXGA 1N34Q 4DR4L 3AYHB 3NP8A 1IYJB 5M5XH 4YWMA 3KOJA 3T13A 4LNQA 2K04A 4JVZA 4TRDA 1NUCA 1RHPA 5FJ8G 1SE3A 4WJ3M 1JORA 5ELDA 1BCPF 2D62A 4DR6Q 4DR2Q 2ENBA 4POGA 2JA7H 1HPCA 1O7YA 3HOZG 1TT2A 2WINB 1LT6D 1JB3A 4KK7A 2JP1A 5GADC 3BVZA 3GV3A 3M4OB 2AQ2B 3W1GA 1Q1EA 2WKCA 4AQYL 1N32Q 5C3XA 1KDCA 2SNMA 5E7NA 4LFCQ 2PQAA 3CW2C 3MVVA 2YU9B 2UUCL 4DR7Q 1QILA 2WB1B 4XYOA 1D6EC 5A35A 3S24A 2WAQB 1K0RA 2JA7G 2FFKB 2AUJD 2KHJA 4PZ7A 4PZ6A 2E2JH 4HSVA 3BDLA 4XTCS 4X3SA 3F8TA 1I4HA 4DR3L 2YYZA 5JEAJ 4QGUA 4B3RQ 5CR3A 1FVIA 1FD7D 1LTGD 3QOJA 4EQOA 4ZUJA 2NVYH 3NTIA 1HXYD 1DXMA 2O4XA 5IGGA 2OCEA 1IW7D 3J80L 3PF5A 3FKIH 1HA5A 2Q2TA 1WTXA 1ZKOA 5M3FB 4JI8Q 5M3MB 3PO2H 1NSNS 4LUZA 3MFYA 1E3PA 4BY7B 1KQSA 4X64Q 5LL6S 2IJ0A 1J6QA 2ES2A 2BDNA 3A5UA 5M5YB 3I4NB 2F0UA 2WIIB 4HMIA 1EWCA 1BCPD 2L11A 4J6HA 5ELCA 3HOUB 4X65L 3H6MA 2CH4W 1FNVA 4X3UA 3FKIG 4B08A 2YTXA 1EYDA 4A3GB 2KECA 3NSWA 1RJTA 4KHPL 2K52A 2CKZB 3SK6A 4DAYA 5FLXE 5JJZA 2K7VA 2E5LQ 3GTGH 3SR1A 1W3SA 2C9OA 4GOPC 4L5RC 5J3BA 2F52A 1K9MC 1HZBA 4JI0L 5FO9B 3J81j 3R8BA 2DJFC 5GQOA 2KENA 5BR8Q 2F0GA 1EQQA 1SNPA 1PFSA 3BJUA 2EY5A 1PZJD 3MXPA 1PH6A 3OTOL 4ZKCB 4JOIC 4C3JB 2VQFL 5KYIA 1EYCA 1B4OA 3C1EA 1DOKA 1W2BA 4NKLA 4KY6A 4AQYQ 1GUGA 4IFDI 5IP7G 1SYBA 4KD4A 2CW0D 4OL7A 1LTBD 1X6OA 2N88A 1B9MA 1JR0D 2UUCQ 2RA4A 3HOYB 3V2TA 2GVBA 1QNKA 3EBEA 3KLSX 1X3FA 4C1NI 1K73C 1XNRL 2EYJA 3I4LA 3FP9A 4PMBA 1A3UA 4O0AA 1LUZA 4IOCA 1PXUA 5D3IB 2F0PA 2YTVA 1TWGH 3R2TA 1SE4A 2SOBA 5M3MG 4DK3C 2VB3X 5I2YA 1KRSA 4I7AA 1IXRA 4KD3A 3R93A 1PRTC 1EIGA 3S15H 3T16A 3NEMA 3CP0A 2VZAA 2A69D 3HOUG 2D0PA 5FLMH 1FNUA 5LMNL 3MXNB 1X65A 2A19A 3NBHB 5A2QL 4DV6L 2X69A 3Q0AA 2A6ED 1QNUA 1VQLA 3MA2B 3P20A 3PUWA 4O42A 1PH5A 2XIWA 1EUJA 2F0QA 1IHZA 4P74A 3VR6A 4RGNA 1ILPA 4DPGA 3F2DA 2PQAB 4JG2A 4DUZL 3D8GA 3I73A 1VDZA 2B2VC 2L4NA 3TEHB 4L8JA 5COYA 5C6AA 5FLMG 1J5EQ 1VQNA 1Q90A 5C44B 4U673 4DR1Q 1V8QA 3MC0B 3S9WA 2JEAI 4N9PA 4H44C 1A3TA 1U4PA 3QO2A 4ZKBB 3K5LA 4H7BA 3F2UA 4RCNA 3U50C 3C3LA 2KUMA 3OMGA 4KHVA 3K5MA 1NMGA 4PZ8A 3RD4A 2VQFQ 2C5CA 2Q8IB 1BBUA 3M4QA 2DY7A 4KJNA 3MHBA 4K2KA 3K5OA 2I5MX 4IPCA 3DMUA 2M00A 4GN5A 3JC66 3R2IA 4A4IA 3AU7A 4JI5L 3C2PA 2VQEQ 1TWAB 3D6WA 1LABA 1EOTA 1VQFA 4LF7L 4DV1L 3KUPA 2UUBL 4ZK9B 5AJ3Q 2ZTEA 4UP8A 1VS0A 4ZQ3A 1BR9A 4JW0A 4XT3B 1PH4A 2EZVA 2HHHQ 1IBKL 5IT9E 4GNXA 4YCWA 1NMFA 4OWWB 4LFBL 1JWUD 2F0NA 3WDNA 5CBAE 5DLQE 2I5HA 4O1NA 2XNAC 1WCMH 4LF6Q 1SNCA 4DA2A 1WJJA 1Z9FA 2B8GA 2E74C 3NE5B 3H09A 1RCVD 4WFN3 1G6PA 1LT4D 3BYTB 4IPHA 1I94Q 3ITPA 4KLKA 2VS1A 4JI7L 1PTOH 2K03A 3X3MA 1Y8OB 4NP5A 1JQYD 1ENFA 2E2HH 1JOOA 4Q0FA 3HOXH 5JEAH 3J81c 3KJPA 3R3OA 4GLVB 1H9SA 1WCMG 3DWPA 1PA6A 2AQ1B 4RGMA 4Q5VA 3S1RH 5FLXL 1Q1BA 4DNRB 2JN4A 2V4DA 2PQEA 1HTLD 1QWYA 3DM3A 5C44G 5GAHC 1STYA 4DUYQ 5KEEA 1I4GA 2PZWA 2A6HC 2B2WC 1EL0A 1TU2B 1M4VA 3RZDH 1SYCA 4HIKA 4R4TA 2BE5D 3HOXG 3E0JA 5EJWA 3I4OA 4B3ML 2Z6KA 3VR4A 2RDGA 1LTRD 4IPGA 1O7LA 2F0KA 3L0OA 3SHLA 3S1QH 1SLJA 3BZKA 5BN5A 3U58A 3S1NH 1JJCB 2B2UA 3AMUA 2B63H 1NNXA 3E6ZX 4XXEA 3L2PA 1HR0L 2IX3A 4YY3L 4FF1A 3PUYA 5E4WC 1ASYA 5CC4A 4DAVA 4A3DG 3RZOB 2DNCA 1CFMA 2DY8A 1X56A 3GV6A 3NWTA 5CYUA 2IW3A 4DFAA 4K5VA 4K14A 1KAWA 1EEID 3ZJYC 4QIWE 3KLWA 2NB0A 1XWEA 3U9OA 2Y0SB 4ZLTF 2O5IC 2R7ZB 1T9HA 4X62L 4KKTA 2B63G 1YHAA 4CBVA 3KDFA 1S5BD 2UXBL 3M4YA 3MEHA 3JAME 1UE6A 2R6GA 4HIMA 1MSGA 3GTQB 2CFMA 2R93H 1A0IA 4A75A 3TSSA 4JI6L 3CHBD 1VQKA 4DU9A 2EY1A 3L9AX 3ULJA 3DEPA 2BH8A 1GUNA 4Y7NH 4HJ8A 3A7AB 4DK1A 3EA6A 4FP5D 1HTPA 4C3IH 3HKZG 2GVAA 5E3FA 2I5LX 1I6VC 4JI2Q 3IAYA 1LTAD 4FF2A 4DV5L 5M9OA 1ET6A 4QMGA 1BDOA 2KHIA 2F1MA 1HZCA 4JBKA 1STEA 1B3QA 4F88A 2HUGA 4N9TA 2QKIC 4LUVA 1EU3A 4A3BH 3AFQA 4YHHL 4C3IG 3I55A 3CU7A 5NUCA 2HT1A 3TZUA 4A76A 1SMYC 1UE5A 4PMCA 5K36H 3OW2A 4TKOB 4GNXB 1F2ZA 4DV7Q 1HJPA 1HRJA 3O13A 1EU4A 1GHKA 3RUZA 2AHOB 1WOCA 1SRUA 3GTPH 4IUQA 3OWEB 5C3EH 4HEDA 4LF8Q 2SEBD 3G48A 1SR3A 3PUXA 1PRTF 2EYPA 3NWSA 3VA5A 3VYRA 5K36G 1PH7A 1PH2A 1YIJA 3K0XA 2EY2A 3BVMA 5I6YA 3T1YQ 1RODA 2K5WA 4A3FB 5J22A 3E3XA 2KCMA 4MZ9A 4NXNQ 3G4SA 4BXXG 3H0GB 3J7YW 1H9SB 3X3NA 3NELA 4R8IA 2UXBQ 4DR5L 4TSSA 3J80E 2JK8A 3CKIB 1LO5D 2N78A 4LF5Q 1S4ZA 2VUMH 2ZXRA 4CGYB 2Z0SA 3S14H 4JV5L 3T53B 3EROA 1EY0A 4QB4A 3ULLA 1CHQD 3I7FA 1ESRA 1XMOQ 1X54A 3T1HQ 5T1IA 5C4XB 1AE2A 5LMUL 1Y8PB 1STGA 5I2XA 3BZCA 2MQHA 2TSSA 3AFPA 2CVRA 1M90C 4RMFA 1RDPD 2VUMG 1EZ8A 4GN4B 1DOMA 4RGTA 3Q24A 2EOTA 3HEJA 4L63B 5D65A 3BG3A 2PNHA 3K80C 4K6LA 4GKJQ 1L1OA 3NTHA 4KY7A 2G5DA 4B3TQ 4X6AH 3J7AF 1PRTD 2B2YC 5EKKA 3I56A 5G3LF 4C3HH 1IBLQ 1PLFA 2F0HA 1SNOA 2K6AA 5EKLA 1VQHA 1I6HH 5KYLA 3KDFB 4JI1L 4GLAC 1TXYA 3NBIA 3PGZA 2MO1A 1D1KA 1HZ9A 2K05A 1EY7A 4DXFA 5CV7A 4IUVA 2NUCA 1E22A 1BCPB 2WACA 2IWHA 4X66L 1P16A 2QF7A 3F2CA 4C3HG 1VQGA 2IT1A 3TZDA 1DM0B 1QG7A 5K5PA 2JA8H 1XTCD 1CHPD 3K59A 4JBWA 1VQMA 1I3QH 3A54A 3KLRA 1B3AA 1CKNA 1HUMA 1K83B 3CQZB 3TMEA 5M5XB 4A3KB 4ALPA 4NDXA 1O7IA 1BVSA 2AQ3B 3HP3A 4PG3A 5FK9C 2UXCQ 3HOWH 1A3VA 1E0BA 3RNUA 5J1ZA 2R7DA 2JA8G 3S1MH 4OONA 2JA6B 2E8GA 4FXGC 3ZYYX 3S16B 2DGYA 1G2TA 1LV9A 3JAMi 1KDAA 1K3BC 1MJCA 1N9WA 3CXCA 1HQMC 5KIXA 5D3DA 5A2QE 1PH8A 4N8X1 4C2MH 1VQ4A 1Y1VB 2XSCA 2O5JC 2R61A 4AYBE 5IE8A 4OX9Q 5G3LD 1SNMA 1ZEQX 5IGCA 5DEHA 3AQQA 1VQEA 4LF4Q 3GTLH 3QWNA 1I50H 1SDFA 1TWHH 3NXWA 4QUCA 1GUSA 1PFNA 3W1BA 5FO7B 1MHWC 3G7LA 3OIPA 3K81C 1HNXQ 3S2HB 3K8AA 5FKAC 2ZM6L 4NXML 4RHSA 2IHEA 4ABNA 3K57A 1VF5C 5M5WH 2K5HA 2E2DC 2XWBB 4WORA 3I4MB 2QW7A 4DV0Q 4OO1H 3MWYW 5LHY1 1X3QA 1EIFA 1GD7A 1WI5A 3UI2A 1M8AA 4POFA 3U4VA 2E2IH 3V05A 2WP8J 2KEDA 1BF4A 3TS0A 4Z9CB 3HS0C 1HNWQ 3VR2A 5JVH3 1QVCA 1PTOC 1BKBA 2CCZA 4HJ9A 2EYLA 2RDFA 1VQIA 1JE5A 4OO1G 2BCOA 1YI2A 4EQNA 5IYDG 2CWPA 2PW5A 2NN6H 3G6JB 1G2SA 1B9NA 1YNNC 3C1FA 3Q22A 1EWIA 2ZJRA 1L1OB 1KABA 4MN3A 3C46A 4KJOA 3SK5A 1XNQL 2JA6G 1OXTA 4CJ0B 2Q2UA 2VB2X 4ODGA 1F9QA 3OW7A 2DUDA 2F0IA 3D4RA 4HJ5A 2PPBC 1F9RA 1F9PA 4BWGB 1GUTA 2F0DA 1G51A 2PMZE 2NN6G 3J80i 1E24A 4LJZC 1YBYA 3E0EA 3FPUB 1A8VA 4IUNA 1WD1A 3M4OH 5IYBG 3G6EA 1Q82C 4DR4Q 2D5DA 1PZKD 1B8AA 3I91A 2LXJA 2K01A 2H4OA 2YU9H 3PQIA 3KLSA 3A55A 1B70B 5IP7H 2X6GA 1NBWA 5IIFA 1D1IA 2P5ZX 1WTWA 5C4ZA 4QIWB 5C5LA 1CKNB 2B3GA 3TBIB 4NXMQ 3B6YA 1F2YA 3GTOB 4S3SA 1HNZL 4RHRA 3BZDB 2M9VA 3PIPA 2K50A 2IPKD 3UE1A 2FHTA 4CDFC 1LT5D 3QJYA 4EX5A 2WB1G 4GOPA 4KTAA 2WAQG 4KI0A 2D2CC 1F77A 2LSSA 1CSQA 2K33A 3LNNA 3CAMA 3SXHA 2MGSA 1YZ6A 5M3FH 3MEFA 5M3MH 4BY1B 1L0YB 2ICIA 4BY7H 4AH6A 2RSNA 1KNAA 5EPJA 2AWNA 5M5YH 1K8OA 4GKKL 3I4NH 3DHQA 4DR3Q 1DZ1A 4JOIA 4G57A 3STBD 2BDOA 3NTKA 3I2ZA 4HSPA 5IP9H 3HOUH 4QY7A 3D3RA 4ME5A 3TP7A 1MGSA 3D31A 4A3GH 1VCIA 3ND8A 5M3FG 1R4PB 1KRTA 1EEFD 4BY7G 5LL6X 3M3YB 4BA2I 4L6TB 1XPRA 4YCUA 3H3VC 1FJGL 3BDOA 2KQ3A 3SE0A 4KV6A 3I4NG 2EE1A 1SXTA 3SK4A 2K5QA 3A8JE 3A56A 1KIXA 2OQKA 1JWSD 5IP9G 3HOVB 2WFWA 1S40A 3K5NA 1S5CD 4A3GG 1O7ZA 4X65Q 4A3IB 3FDTA 4C3JH 1K28A 5GROA 4KHPQ 4HJAA 1TWFB 1ET9A 2R92B 5ELNA 1Y14B 3S2DB 2ZXOA 2XRQD 4JI4L 3RN2A 3PSIA 3WOFA 3P75A 4CJ2C 1V43A 5EPKA 4MNOA 4JI0Q 5D14A 1WTRA 3SK8A 1Q12A 4A3EB 3M85A 2A68C 3K7UC 5EKIA 4C3JG 1A2TA 2ALYB 2F4IA 2BH2A 3RMHA 5I4DA 3OTOQ 2QDLA 3GQBA 1U4RA 1IBML 2B2VA 4R4OA 1O78A 1VQAA 2F0VA 1Q7YC 1BBXC 3HOYG 1DYQA 4XIGS 4LK1C 5HURA 3Q23A 2JA5B 2KVMA 3Q6SA 3UE0A 2BA0A 2HQEA 1RTNA 5LMNW 2NVQB 5C4JB 3PO3B 5I9OA 1XMQL 4AIMA 4GKKQ 1XNRQ 5EAYA 3TRZA 5HGQA 5ELOA 4F7XA 1CKOA 1AZPA 1BBWA 1EQVA 5EPLA 3J81E 4FDBA 2KBNA 4DAYB 1I4QA 4B9XA 2Z9HA 4OWTB 1I4XA 1TY2A 3OMCA 4I7ZC 2NVTB 2HIVA 4FVMA 5E4XA 4FYDA 1TS3A 1DCZA 1ZYRC 2QGQA 1SYEA 5JPMC 1YJNA 4M1UB 1CQVA 3PIOA 1QE6A 2K75A 2N8NA 4A3MB 5C44H 3E9IA 1NE3A 3GTJB 2NVXB 5LMNQ 3SDZA 4DV6Q 3D4WA 3KBXA 1B44D 4TQUS 4QCLA 3M9BA 4R8NA 5AFWA 2XWJB 1C7YA 1SSOA 2R92G 4GOPB 4B9WA 4U68A 4DUZQ 1NTGA 4IURA 4ME3A 3CCEA 5JPNC 4JI3L 2MJ8A 1A62A 1UEAB 3PUZA 2LXKA 2KEEA 4A3EG 1TWAH 2HQLA 1E1TA 1A6XA 3K0YA 1D5MC 5DM63 2D9UA 4HCSA 2HCIA 2JEBI 1C4QA 2RKSA 2ZJPA 1PTOF 1SNDA 3CMEA 4R9WA 3A5ZB 4LW1A 2OT2A 4A3DH 3LGJA 2ZXPA 1L2FA 4BA1I 4ZRZA 1TWCB 4DK6C 1STHA 3U9SA 1XJVA 2EYMA 1CUKA 4QJFA 5C0XG 2OQ0A 4XQNA 1TY0A 1U9RA 4K6DA 5C4HA 1LT3D 4DV2L 1ESFA 2JA9A 4JI5Q 3H15A 4DNIA 1BXTA 1SJHD 3T4AC 4OO1I 2F0OA 4LF7Q 2EYOA 4DV1Q 1SE2A 1TR5A 5J39A 2UUBQ 1WFQA 3TREA 4KKSA 1NCVA 2NYZD 3CCMA 4IQZA 1QOHA 3CF5A 3ND9A 3MXUA 3MAQA 1P8LA 3K7AB 1IBKQ 4IN3A 4IO9A 4ID6A 4AYBB 3CCJA 4UP9A 1GJXA 1LM0A 1XXGA 3M7NA 4LFBQ 1STNA 1AFPA 1GKHA 4HAEA 1Q8KA 1PRTB 4A3BB 4G4KA 1EY8A 2IY5B 1C9OA 2RCFA 4FXDA 1VQDA 4C56C 2UUAL 1CSPA 4LFAL 1BNZA 4APVA 2NN6I 2GN5A 3DXJC 1MSHA 4JI7Q 3KJOA 5EBCA 4LUOA 4BBRB 1K0SA 3L3OC 4CDCC 2V1CC 1E2WA 1PTOD 4R1JA 2UU9L 4JYAL 1HR0W 1H95A 4JK1C 3IFTA 4MTKA 4CKEA 4CKBA 3CC7A 5DNFA 4UDUC 3I90A 4HIDA 3IKJA 1NAPA 1IZ6A 3T51B 1Y8NB 1TIID 3PMFA 2LS01 1BOSA 1PFMA 4B3SL 4RA8A 3H3VH 1B2TA 3RZOH 3GTMB 1B53A 4A3JB 4RH6A 2CW0C 2E76C 2N3SA 3D0FA 4XDXA 3CMAA 1ICFB 4CDDC 4B3MQ 1IKLA 4QQBX 2FXQA 5C5MA 1SMXA 3FRPB 3NQIA 3SGIA 1SE8A 1Y1WB 4BBSB 2R7ZH 1HQRD 3MFGA 3LWUA 3CCSA 2MHVA 4ZCKA 2VL6A 4BXXH 4XQJA 1G91A 2OF1A 4DV2Q 1QZGA 4H13C 3GTQH 1SYDA 1EYAA 1HR0Q 4YY3Q 3PIP3 4FF3A 4P72A 2EYHA 4UP7A 2ASBA 1HUNA 2JQOA 4MHEA 4R4IA 1YITA 2UXDL 5IWAL 2Y0SG 1EQTA 1GO3E 2R7ZG 1F2LA 3CPFA 2PMZB 4AYBG 4NPSA 1N33L 1PZID 1V1PA 1OTCA 3ERQA 3QB3A 4X62Q 3J81L 4IJLA 1G8ZD 1HH2P 3MTSA 2R3ZA 1CA5A 2A69C 4KHZA 1TQOA 1Z6HA 1B50A 1D2BA 5IGFA 5JJKA 1VF7A 2FINB 4ZAIA 4GZYC 1LTTD 3RLFA 4JI6Q 4OIJA 4DKAC 4DV3L 1N36L 3KF6A 1PV4A 1NY4A 4QL5A 1I6HB 2I07B 2J4XA 4DN4M 2F0TA 4YWKA 1PH9A 4K0KL 4OELB 1K8MA 1JB7A 4A93B 2CQAA 1WTHA 3KFUA 1KDBA 1E1OA 2RF4A 4FO2A 5I9PA 1YHBA 1EOVA 4DV5Q 4YWLA 1I5FA 4IJHA 3D6CA 1SFOB 1R9TB 4RGOS 1IKMA 4HMJA 1L1OC 3P1HA 4H0LC 4A3JG 3A8IE 2EIFA 4P75A 1WTQA 3CC4A 2F0FA 2A8VA 2IX0A 4PQXA 4YHHQ 3KBGA 4DV4L 2F0WA 2KCTA 1Y1WG 4A3FH 2IX1A 2EVBA 2MP1A 1N34L 3GTKB 1KAAA 1KHIA 3H0GH 4HCEA 4K5WA 3S17H 3FMCA 4UAIA 1E7ZA 2B29A 1SYFA 4OGQC 1LLRD 1EYGA 4DR6L 4L5QA 3CRLC 4OEMB 1SJED 3AB9A 4DR2L 2MO0A 2OXPA 4A3FG 4NMZA 4QUFA 3CC2A 4ZYSA 3ULPA 3HOZB 3H0GG 3H94A 5CV6A 5C4XH 3HKZE 1N33Q 1L0WA 1AP0A 4CHTB 2FMMA 1SYGA 4LFCL 5F2DA 2A68D 1Y69U 4DR7L 3N6RA 4UHVA 4DR5Q 3RLOA 1JOKA 1VQ6A 2JA7B 1QVFA 2ZJQA 1STAA 3EQLC 1TS2A 3RLNA 5C4XG 4JV5Q 1FGBD 4B3RL 2FMCA 5DM73 3NQTA 5LMUQ 2PI2E 2OTJA 2N49A 2B2TC 1UE1A 1AE3A 4F8MA 2MNAA 4OWXB 3PIO3 1KXLA 2XN9C 1WD0A 3AEVA 3FEWX 5CMDA 2I0QA 3PF4A 3NK9A 3OOCA 5IOCA 3EFXD 3ER0A 2E2JB 4DXGA 3EIVA 1J8IA 1DD2A 3CCRA 4G7HC 3VYTA 1CZGA 1FGUA 1JOQA 2NWGA 3GO5A 3UDIA 4I65A 3SEBA 4MTNA 1RD9D 2M2LA 1X3EA 2NVYB 1X3PA 2HIXA 4A3LH 1K83H 3CQZH 4A3KH 4JI1Q 3J7A5 4JBMA 3VA7A 3FKIB 4X3TA 2E5LL 1SAPA 1XX8A 2DN8A 3PO2B 1FR3A 3DEOA 2QEJC 2NTTA 2VY3A 2VXWA 5IYDH 3KF6B 1B1ZA 2L12A 2IL8A 4X66Q 4GLXA 1CQFA 3W2DA 1C8CA 4P2CB 1V9PA 5BR8L 3UDGA 1PYBA 2JJQA 5IGBA 2JA6H 3MXNA 3NBHA 4A3LG 1PH3A 3BS1A 4A3KG 3V96A 4NW2A 1U5KA 3S16H 1MI2A 1YVCA 2ZT9C 2A6HD 3A0JA 2Z4HA 2F0MA 1UEBA 3J7ZC 3GTGB 1JMCA 1Y1VH 5EQ0A 1F2MA 2EJFC 2CH4A 1PH1A 4J15A 5C0XJ 1VQ5A 2JXMB 1LTLA 1MBYA 3CCQA 1HHVA 5IYBH 5BN3A 2PYKA 2B39A 1LYLA 2SNSA 2KJXA 2PW7A 4IUPA 4GN3B 1JWMD 3S2HH 2RDHA 1ICWA 1Y1VG 2L15A 4RCOA 2CHBD 3DM1A 1PVOA 1W6JA 1KTKA 2PZTA 4EQ5A 3I4MH 1XPOA 4XYQA 1ML0D 3TP8A 5DAUA 4OIKA 1GHJA 3MZ5A 4CJ1B 1YHQA 5JJIA 2RCNA 1KL9A 2L55A 2EPBA 1SEBD 1QUQA 4DF7A 2ZM6Q 1TWGB 3I4MG 2Z6BA 1Q46A 3H3VI 3I3CA 3PO2G 1JJGA 2Q8TA 1FL0A 4G7OC 1U0LA 1FYCA 3U4ZA 2EY6A 1OXUA 2KOLA 2QDBA 3S15B 3M7GA 2EQSA 1J5EL 1D8LA 1LTID 3PUVA 1D7QA
chains in the Genus database with same CATH topology
4DR1L 2RHQB 1NE3A 4YCVA 4HIOA 3G71A 3GD7A 4JI8L 5LMNQ 4OXPA 4DV6Q 2AHOB 1EFWA 1WOCA 4TQUS 2BA1A 1SRUA 3M9BA 3GTPH 4X64L 5C3EH 1JT8A 4LF8Q 1XTDA 3G48A 1SR3A 1C7YA 5FJ8H 2R92G 3PUXA 2Q2IA 4GOPB 1GVPA 4DUZQ 1VQPA 1NTGA 5K36G 1VQ9A 3Q8DA 4ME3A 1PH7A 3CCEA 5FLXc 4JI3L 2Y0SE 3F1ZA 1Q86C 5HY6A 4DV4Q 1YIJA 1PH2A 1A62A 3K0XA 1WYDA 1HZAA 3T1YQ 3PUZA 4A3CH 3HOWG 2LXKA 2F3IA 3HOZH 5C0XI 1A63A 1EQRA 3IRBA 5GAGC 2CWAA 4A3EG 1M1KC 1TWAH 2HQLA 1E1TA 2KCMA 4MZ9A 2RHSB 3F2BA 2VQEL 3AYHB 4H02A 4JBJA 1IYJB 5IYCH 5M5XH 4YWMA 3KOJA 3G4SA 4BXXG 4LNQA 2JEBI 2ZJPA 1XNQQ 3CMEA 3NELA 3A5ZB 4LW1A 4A3DH 4WJ4A 5AJ3L 3LGJA 2UXBQ 5FJ8G 1L2FA 4WJ3M 4BA1I 3CCUA 4DR5L 4DK6C 2D62A 2HHHL 4DR6Q 2JK8A 1XJVA 1GM5A 1YNXA 4DR2Q 1CUKA 2N78A 4QJFA 4LF5Q 2VUMH 5C0XG 4POGA 2OQ0A 4IPDA 2JA7H 3M4PA 4A3CG 3HOZG 3GTOH 2Z0SA 2PI2A 1IL2A 3S14H 4JV5L 4DV2L 5IYCG 3UDFA 5GADC 3ULLA 3I7FA 2JA9A 4JI5Q 3CCLA 1XMOQ 1X54A 3T1HQ 3W1GA 4LF6L 3H15A 4DNIA 1Q81C 1VQBA 1Q1EA 1AE2A 5LMUL 4L5SA 4AQYL 4OO1I 1N32Q 4LF7Q 3BZCA 2MQHA 5E7NA 4DV1Q 4LFCQ 1I94L 2PQAA 2UUBQ 1RIPA 3CW2C 3AFPA 4IFDJ 1WFQA 3TREA 1M90C 2UUCL 4DR7Q 3CCMA 2VNUD 4RMFA 3HOYH 3S24A 3CF5A 1EIYB 2VUMG 2JA7G 1K0RA 4GN4B 4BY1H 1P8LA 1V1QA 2KHJA 1IBKQ 4PZ7A 4PZ6A 2K5VA 4IO9A 2E2JH 3K80C 2PNHA 4UP9A 3CCJA 1G291 4XTCS 4GKJQ 1L1OA 1LM0A 3M7NA 3F8TA 4LFBQ 1GKHA 4LF9L 1Q8KA 4DR3L 2YYZA 1HNZQ 2R7FA 4B3TQ 2IY5B 2D0OA 1C9OA 4X6AH 5JEAJ 4QGUA 4B3RQ 1KD1C 1FVIA 1VQDA 3CD6A 3I56A 2UUAL 1IBLQ 4C3HH 2NVYH 1CSPA 4DUYL 4LFAL 4APVA 2NN6I 1VQHA 2GN5A 4DR4L 1I6HH 4BY1G 3FHWA 3KDFB 2OCEA 4JI1L 4GLAC 3PF5A 3FKIH 2ID0A 1TXYA 3PGZA 3KJOA 2MO1A 2Q2TA 4JI7Q 1X9NA 3M3YH 4LUOA 4JI8Q 1HZ9A 3PO2H 2QA4A 4LUZA 1E3PA 2UU9L 1E22A 2V1CC 4X64Q 1KQSA 4R1JA 4JYAL 1VQOA 1J6QA 2ES2A 4X66L 3A5UA 3HOVH 3EN2A 1HR0W 1H95A 1P16A 3HFZB 4GNXC 3F2CA 3CC7A 1VQGA 1S72A 2IT1A 4HIDA 4X65L 1IZ6A 4A3IH 1QVGA 2JA8H 1OXXK 3FKIG 2XGTA 4B3SL 2YTXA 3H3VH 4JBWA 1VQMA 1I3QH 3RZOH 4KHPL 4L5TA 2K52A 1CKNA 1TWFH 2CKZB 1AH9A 4ALPA 1OXSC 2R92H 2E5LQ 3S2DH 3GTGH 1W3SA 4GOPC 4L5RC 1FJGQ 1O7IA 2N3SA 1BVSA 1DGSA 3D0FA 4PG3A 5J3BA 3CMAA 4B3MQ 3HOVG 1MKHA 2F52A 4QQBX 2FXQA 1K9MC 1QUQB 1SMXA 2UXCQ 1HZBA 4JI0L 3SGIA 1SE8A 3HOWH 3J81j 2R7ZH 4A3EH 3CCSA 4A3IG 5GQOA 3RNUA 2KENA 5BR8Q 2R7DA 2JA8G 3S1MH 2VL6A 1EQQA 4BXXH 1PFSA 3BJUA 1PHJA 2VW9A 4OONA 2E8GA 4DV2Q 1QZGA 1PH6A 3OTOL 1X55A 4JOIC 3GTQH 2VQFL 1HR0Q 4YY3Q 2DGYA 4P72A 2YTYA 3JAMi 4UP7A 3RN5A 2ASBA 1MJCA 1N9WA 3CXCA 1W2BA 2WB1E 2JQOA 4AQYQ 1PH8A 4R4IA 2WAQE 5IP7G 1YITA 4C2MH 4IFDI 2UXDL 5IWAL 4UPAA 1VQ4A 3PCOB 4JI4Q 2Y0SG 4JC0A 1GO3E 1X6OA 2UUCQ 4AYBE 5IE8A 2JA5H 4OX9Q 2R7ZG 3CPFA 4AYBG 3AQQA 1VQEA 2GVBA 4JCVE 4NPSA 4LF4Q 3A74A 3GTLH 1I50H 1N33L 3EBEA 2K5NA 2NVQH 5C4JH 1OTCA 3CPWA 1TWHH 5IT9c 5H1SE 4X62Q 4IJLA 3ICEA 3UDXA 4JI2L 1HH2P 2Z6KC 2NZHA 3PO3H 4Y52H 1X3FA 4LF9Q 3W1BA 4KHZA 4R4CA 1K73C 1XNRL 5JJKA 3FP9A 2K4KA 3K81C 1HNXQ 4O0AA 3RLFA 4JI6Q 1LUZA 3K8AA 1IBMQ 4DKAC 4DV3L 1N36L 4IOCA 3KF6A 2ZM6L 2YTVA 1PV4A 1NY4A 2JA5G 1TWGH 4NXML 4QL5A 2NVTH 2IHEA 1B7YB 5M3MG 5M5WH 4DK3C 2K5HA 3CCVA 1KRSA 4YWKA 1PH9A 2AMCB 4K0KL 3PO3G 1IXRA 5JEAG 1JB7A 4DV0Q 1QZHA 3S15H 4P73A 3NEMA 1EIFA 1GD7A 1WI5A 4DV7L 3KFUA 4A3MH 1NJIC 1E1OA 2RF4A 2VZAA 3CP0A 3HOUG 2D0PA 4POFA 1YHBA 1EOVA 5FLMH 3U4VA 4YWLA 3GTJH 4DV5Q 1XMQQ 1I5FA 1Z47A 4LWCA 4IJHA 2E2IH 5LMNL 2WP8J 3MXNB 1X65A 2A19A 3NBHB 4DV6L 2NVXH 1CKMA 3TS0A 1L1OC 1VQLA 1HNWQ 3PUWA 1PH5A 4LF8L 1EUJA 1QVCA 1BKBA 4P74A 2CCZA 4A3JG 1UE7A 2EIFA 4P75A 4HJ9A 3CC4A 1VQIA 2IX0A 2A8VA 1JE5A 4DPGA 2PQAB 4JG2A 3F2DA 4YHHQ 1YEZA 4DUZL 4OO1G 1YI2A 2C35B 3TEHB 4DV4L 5IYDG 1KC8C 4A3MG 2CWPA 2KCTA 3T1YL 1ASZA 1Y1WG 4A3FH 5FLMG 2IX1A 2AKWB 1J5EQ 1N34L 4NXNL 1VQNA 1EWIA 2ZJRA 1L1OB 1KHIA 3H0GH 4DR1Q 1XNQL 2JA6G 1OXTA 2JEAI 3S17H 1SROA 1E7ZA 2B29A 2Q2UA 3U50C 3L7ZC 2DUDA 1TWCH 4HJ5A 2JE6I 1NMGA 4PZ8A 1EYGA 2VQFQ 4DR6L 4L5QA 4R4QA 2ZTCA 4DR2L 1BBUA 3M4QA 1S3OA 2MO0A 4LF5L 1G51A 1MIUA 2PMZE 4A3FG 2NN6G 3J80i 1E24A 4O2DA 4JI3Q 3CC2A 1YBYA 1VQ7A 2I5MX 3E0EA 1A8VA 4IPCA 3ULPA 4GN5A 3JC66 4A4IA 4P71A 4JI5L 3RR5A 3H0GG 1XMOL 3M4OH 3T1HL 2VQEQ 5C4XH 3HKZE 5IYBG 3BU2A 3G6EA 1Q82C 4DR4Q 1N33Q 1L0WA 1B8AA 1VQFA 1YJ9A 4LF7L 5IY0A 2LXJA 4DV1L 4LFCL 2UUBL 2YU9H 4DR7L 5AJ3Q 2R93G 2ZTEA 2ATWA 1B70B 4UP8A 5IP7H 2OWOA 1VS0A 1NBWA 4DR5Q 3JAMc 3RLOA 1VQ6A 1PH4A 2HHHQ 3K7AH 1IBKL 4GNXA 2F4VL 4YCWA 1NMFA 1CKNB 2B3GA 1QVFA 4GKJL 4NXMQ 3B6YA 2ZJQA 4OWWB 4LFBL 2IHFA 1K8GA 3RLNA 1HNZL 5C4XG 4B3TL 4JV5Q 5DLQE 2I5HA 4B3RL 3STBC 3PIPA 1N8RC 2H5XA 2K50A 2ZTDA 1WCMH 4LF6Q 1WJJA 1Z9FA 3UE1A 5LMUQ 2PI2E 4IOAA 1MJEA 1IBLL 2N49A 2OTJA 4EX5A 1UE1A 1AE3A 2MFIA 2WB1G 2MNAA 4GOPA 4OWXB 1G6PA 2WAQG 4IPHA 4KI0A 1I94Q 1KXLA 2LSSA 1CSQA 1PYSB 4GS3A 4KLKA 1JJ2A 2VS1A 3CAMA 4UY8C 4JI7L 3AEVA 2I0QA 1YZ6A 5M3FH 3PF4A 3MEFA 5M3MH 4BBRH 2E2HH 4BY7H 4A3BG 4AH6A 3ER0A 2K14A 3HOXH 2AWNA 3EIVA 3J81c 3KJPA 5M5YH 4GLVB 3CCRA 3I4NH 4GKKL 1WCMG 1PA6A 4DR3Q 4JOIA 3S1RH 4IFDG 4PMWA 3STBD 1Q1BA 3I2ZA 5IP9H 3HOUH 4QY7A 1FGUA 3UDIA 3GO5A 5GAEC 3DM3A 5C44G 2UUAQ 4MTNA 5GAHC 3TS2A 1X3EA 3D31A 2OTLA 2HIXA 4LFAQ 4DUYQ 4A3GH 1VCIA 3GTMH 5M3FG 3J81i 1K83H 4A3LH 3CQZH 3E9HA 1KRTA 4JI1Q 4BBRG 4A3KH 4JBMA 3J7A5 4A3JH 3RZDH 4BY7G 2XTIA 2E5LL 4BA2I 1XPRA 5C3EG 4YCUA 4HIKA 4R4TA 3HOXG 1FJGL 4RG1A 3I4OA 4B3ML 3I4NG 2Z6KA 2UU9Q 2VY3A 4JYAQ 3HKSA 5IYDH 2UXCL 1KIXA 3KF6B 4IPGA 2OQKA 1Y1WH 5IP9G 4BBSH 4X66Q 4GLXA 3L0OA 1VQJA 2WFWA 3ERSX 1S40A 1V9PA 5BR8L 3UDGA 3S1QH 1SLJA 1PYBA 3BZKA 2JJQA 3U58A 3S1NH 4A3GG 4X65Q 1JJCB 1RL2A 2JA6H 2B63H 4A3LG 1PH3A 4A3KG 4C3JH 3L2PA 1HR0L 1U5KA 4YY3L 3PUYA 1ASYA 1YVCA 4B3SQ 1OXVA 3S16H 5GROA 4A3DG 4KHPQ 3A0JA 1X56A 4HJAA 3DLLA 1UEBA 3J7ZC 5ELNA 1Y14B 1JMCA 1Y1VH 4DAMA 1KAWA 4JI4L 3RN2A 3ZJYC 4OX9L 4QIWE 1N34Q 3KLWA 3PSIA 4J15A 3VDYA 1PH1A 4BBSG 1V43A 4LF4L 2NZOA 4MNOA 5C0XJ 4JI0Q 1VQ5A 2A1AA 3J80c 2F4VQ 1LTLA 1Q12A 1T9HA 3W5OA 4X62L 1YHAA 3CCQA 2B63G 5IYBH 1UWVA 3KDFA 3PV0A 3M85A 2Q2HA 1YJWA 3K7UC 2UXBL 2YV5A 3KYHC 1UE6A 1LYLA 2ALYB 2R6GA 2BH2A 4HIMA 4NXNQ 3OTOQ 4GN3B 2CFMA 1HNXL 2CQOA 2R93H 3S2HH 1A0IA 4A75A 2AWOA 4JI6L 1IBML 1Y1VG 1VQKA 2L15A 3WWVA 4R4OA 1VQAA 1Q7YC 3ULJA 3HOYG 2BH8A 5IWAQ 2UXDQ 3NENA 4XIGS 1PVOA 4Y7NH 4HJ8A 4TVAB 4EQ5A 1C0AA 3I4MH 3KF8B 1XPOA 3UE0A 4DV0L 1K8AC 4A93H 2BA0A 4C3IH 3HKZG 2GVAA 2EXDA 2QEXA 5LMNW 1N32L 3TQYA 2I5LX 4JI2Q 1SN8A 1K3RA 1XMQL 4AIMA 4DV5L 4GKKQ 1YHQA 1XNRQ 5JJIA 1SFOH 1VQ8A 2RCNA 1KL9A 5EAYA 1R9TH 3TRZA 5HGQA 5ELOA 1CKOA 1BBWA 2KHIA 1HNWL 1HZCA 1QUQA 4JBKA 1N36Q 4DV3Q 2ZM6Q 1VQCA 2KBNA 4FDBA 3GDEA 4NB3A 4OWTB 4DAYB 4LUVA 1Q46A 3I4MG 4A3BH 3H3VI 2HIVA 3PO2G 4A93G 3AFQA 4YHHL 1FL0A 1JJGA 3I55A 4K0KQ 1U0LA 2HT1A 1X3GA 5JJLA 2QGQA 3U4ZA 4A76A 1UE5A 1OXUA 3OYYA 1YJNA 3OW2A 2EQSA 1J5EL 3PIOA 4DV7Q 4GNXB 1D8LA 1HJPA 2K75A 1XPUA 3GTKH 2N8NA 5C44H 3PUVA 1D7QA 3E9IA 4HJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 L;  2RHQ B;  1NE3 A;  4YCV A;  4HIO A;  3G71 A;  3GD7 A;  4JI8 L;  5LMN Q;  4OXP A;  4DV6 Q;  2AHO B;  1EFW A;  1WOC A;  4TQU S;  2BA1 A;  1SRU A;  3M9B A;  3GTP H;  4X64 L;  5C3E H;  1JT8 A;  4LF8 Q;  1XTD A;  3G48 A;  1SR3 A;  1C7Y A;  5FJ8 H;  2R92 G;  3PUX A;  2Q2I A;  4GOP B;  1GVP A;  4DUZ Q;  1VQP A;  1NTG A;  5K36 G;  1VQ9 A;  3Q8D A;  4ME3 A;  1PH7 A;  3CCE A;  5FLX c;  4JI3 L;  2Y0S E;  3F1Z A;  1Q86 C;  5HY6 A;  4DV4 Q;  1YIJ A;  1PH2 A;  1A62 A;  3K0X A;  1WYD A;  1HZA A;  3T1Y Q;  3PUZ A;  4A3C H;  3HOW G;  2LXK A;  2F3I A;  3HOZ H;  5C0X I;  1A63 A;  1EQR A;  3IRB A;  5GAG C;  2CWA A;  4A3E G;  1M1K C;  1TWA H;  2HQL A;  1E1T A;  2KCM A;  4MZ9 A;  2RHS B;  3F2B A;  2VQE L;  3AYH B;  4H02 A;  4JBJ A;  1IYJ B;  5IYC H;  5M5X H;  4YWM A;  3KOJ A;  3G4S A;  4BXX G;  4LNQ A;  2JEB I;  2ZJP A;  1XNQ Q;  3CME A;  3NEL A;  3A5Z B;  4LW1 A;  4A3D H;  4WJ4 A;  5AJ3 L;  3LGJ A;  2UXB Q;  5FJ8 G;  1L2F A;  4WJ3 M;  4BA1 I;  3CCU A;  4DR5 L;  4DK6 C;  2D62 A;  2HHH L;  4DR6 Q;  2JK8 A;  1XJV A;  1GM5 A;  1YNX A;  4DR2 Q;  1CUK A;  2N78 A;  4QJF A;  4LF5 Q;  2VUM H;  5C0X G;  4POG A;  2OQ0 A;  4IPD A;  2JA7 H;  3M4P A;  4A3C G;  3HOZ G;  3GTO H;  2Z0S A;  2PI2 A;  1IL2 A;  3S14 H;  4JV5 L;  4DV2 L;  5IYC G;  3UDF A;  5GAD C;  3ULL A;  3I7F A;  2JA9 A;  4JI5 Q;  3CCL A;  1XMO Q;  1X54 A;  3T1H Q;  3W1G A;  4LF6 L;  3H15 A;  4DNI A;  1Q81 C;  1VQB A;  1Q1E A;  1AE2 A;  5LMU L;  4L5S A;  4AQY L;  4OO1 I;  1N32 Q;  4LF7 Q;  3BZC A;  2MQH A;  5E7N A;  4DV1 Q;  4LFC Q;  1I94 L;  2PQA A;  2UUB Q;  1RIP A;  3CW2 C;  3AFP A;  4IFD J;  1WFQ A;  3TRE A;  1M90 C;  2UUC L;  4DR7 Q;  3CCM A;  2VNU D;  4RMF A;  3HOY H;  3S24 A;  3CF5 A;  1EIY B;  2VUM G;  2JA7 G;  1K0R A;  4GN4 B;  4BY1 H;  1P8L A;  1V1Q A;  2KHJ A;  1IBK Q;  4PZ7 A;  4PZ6 A;  2K5V A;  4IO9 A;  2E2J H;  3K80 C;  2PNH A;  4UP9 A;  3CCJ A;  1G29 1;  4XTC S;  4GKJ Q;  1L1O A;  1LM0 A;  3M7N A;  3F8T A;  4LFB Q;  1GKH A;  4LF9 L;  1Q8K A;  4DR3 L;  2YYZ A;  1HNZ Q;  2R7F A;  4B3T Q;  2IY5 B;  2D0O A;  1C9O A;  4X6A H;  5JEA J;  4QGU A;  4B3R Q;  1KD1 C;  1FVI A;  1VQD A;  3CD6 A;  3I56 A;  2UUA L;  1IBL Q;  4C3H H;  2NVY H;  1CSP A;  4DUY L;  4LFA L;  4APV A;  2NN6 I;  1VQH A;  2GN5 A;  4DR4 L;  1I6H H;  4BY1 G;  3FHW A;  3KDF B;  2OCE A;  4JI1 L;  4GLA C;  3PF5 A;  3FKI H;  2ID0 A;  1TXY A;  3PGZ A;  3KJO A;  2MO1 A;  2Q2T A;  4JI7 Q;  1X9N A;  3M3Y H;  4LUO A;  4JI8 Q;  1HZ9 A;  3PO2 H;  2QA4 A;  4LUZ A;  1E3P A;  2UU9 L;  1E22 A;  2V1C C;  4X64 Q;  1KQS A;  4R1J A;  4JYA L;  1VQO A;  1J6Q A;  2ES2 A;  4X66 L;  3A5U A;  3HOV H;  3EN2 A;  1HR0 W;  1H95 A;  1P16 A;  3HFZ B;  4GNX C;  3F2C A;  3CC7 A;  1VQG A;  1S72 A;  2IT1 A;  4HID A;  4X65 L;  1IZ6 A;  4A3I H;  1QVG A;  2JA8 H;  1OXX K;  3FKI G;  2XGT A;  4B3S L;  2YTX A;  3H3V H;  4JBW A;  1VQM A;  1I3Q H;  3RZO H;  4KHP L;  4L5T A;  2K52 A;  1CKN A;  1TWF H;  2CKZ B;  1AH9 A;  4ALP A;  1OXS C;  2R92 H;  2E5L Q;  3S2D H;  3GTG H;  1W3S A;  4GOP C;  4L5R C;  1FJG Q;  1O7I A;  2N3S A;  1BVS A;  1DGS A;  3D0F A;  4PG3 A;  5J3B A;  3CMA A;  4B3M Q;  3HOV G;  1MKH A;  2F52 A;  4QQB X;  2FXQ A;  1K9M C;  1QUQ B;  1SMX A;  2UXC Q;  1HZB A;  4JI0 L;  3SGI A;  1SE8 A;  3HOW H;  3J81 j;  2R7Z H;  4A3E H;  3CCS A;  4A3I G;  5GQO A;  3RNU A;  2KEN A;  5BR8 Q;  2R7D A;  2JA8 G;  3S1M H;  2VL6 A;  1EQQ A;  4BXX H;  1PFS A;  3BJU A;  1PHJ A;  2VW9 A;  4OON A;  2E8G A;  4DV2 Q;  1QZG A;  1PH6 A;  3OTO L;  1X55 A;  4JOI C;  3GTQ H;  2VQF L;  1HR0 Q;  4YY3 Q;  2DGY A;  4P72 A;  2YTY A;  3JAM i;  4UP7 A;  3RN5 A;  2ASB A;  1MJC A;  1N9W A;  3CXC A;  1W2B A;  2WB1 E;  2JQO A;  4AQY Q;  1PH8 A;  4R4I A;  2WAQ E;  5IP7 G;  1YIT A;  4C2M H;  4IFD I;  2UXD L;  5IWA L;  4UPA A;  1VQ4 A;  3PCO B;  4JI4 Q;  2Y0S G;  4JC0 A;  1GO3 E;  1X6O A;  2UUC Q;  4AYB E;  5IE8 A;  2JA5 H;  4OX9 Q;  2R7Z G;  3CPF A;  4AYB G;  3AQQ A;  1VQE A;  2GVB A;  4JCV E;  4NPS A;  4LF4 Q;  3A74 A;  3GTL H;  1I50 H;  1N33 L;  3EBE A;  2K5N A;  2NVQ H;  5C4J H;  1OTC A;  3CPW A;  1TWH H;  5IT9 c;  5H1S E;  4X62 Q;  4IJL A;  3ICE A;  3UDX A;  4JI2 L;  1HH2 P;  2Z6K C;  2NZH A;  3PO3 H;  4Y52 H;  1X3F A;  4LF9 Q;  3W1B A;  4KHZ A;  4R4C A;  1K73 C;  1XNR L;  5JJK A;  3FP9 A;  2K4K A;  3K81 C;  1HNX Q;  4O0A A;  3RLF A;  4JI6 Q;  1LUZ A;  3K8A A;  1IBM Q;  4DKA C;  4DV3 L;  1N36 L;  4IOC A;  3KF6 A;  2ZM6 L;  2YTV A;  1PV4 A;  1NY4 A;  2JA5 G;  1TWG H;  4NXM L;  4QL5 A;  2NVT H;  2IHE A;  1B7Y B;  5M3M G;  5M5W H;  4DK3 C;  2K5H A;  3CCV A;  1KRS A;  4YWK A;  1PH9 A;  2AMC B;  4K0K L;  3PO3 G;  1IXR A;  5JEA G;  1JB7 A;  4DV0 Q;  1QZH A;  3S15 H;  4P73 A;  3NEM A;  1EIF A;  1GD7 A;  1WI5 A;  4DV7 L;  3KFU A;  4A3M H;  1NJI C;  1E1O A;  2RF4 A;  2VZA A;  3CP0 A;  3HOU G;  2D0P A;  4POF A;  1YHB A;  1EOV A;  5FLM H;  3U4V A;  4YWL A;  3GTJ H;  4DV5 Q;  1XMQ Q;  1I5F A;  1Z47 A;  4LWC A;  4IJH A;  2E2I H;  5LMN L;  2WP8 J;  3MXN B;  1X65 A;  2A19 A;  3NBH B;  4DV6 L;  2NVX H;  1CKM A;  3TS0 A;  1L1O C;  1VQL A;  1HNW Q;  3PUW A;  1PH5 A;  4LF8 L;  1EUJ A;  1QVC A;  1BKB A;  4P74 A;  2CCZ A;  4A3J G;  1UE7 A;  2EIF A;  4P75 A;  4HJ9 A;  3CC4 A;  1VQI A;  2IX0 A;  2A8V A;  1JE5 A;  4DPG A;  2PQA B;  4JG2 A;  3F2D A;  4YHH Q;  1YEZ A;  4DUZ L;  4OO1 G;  1YI2 A;  2C35 B;  3TEH B;  4DV4 L;  5IYD G;  1KC8 C;  4A3M G;  2CWP A;  2KCT A;  3T1Y L;  1ASZ A;  1Y1W G;  4A3F H;  5FLM G;  2IX1 A;  2AKW B;  1J5E Q;  1N34 L;  4NXN L;  1VQN A;  1EWI A;  2ZJR A;  1L1O B;  1KHI A;  3H0G H;  4DR1 Q;  1XNQ L;  2JA6 G;  1OXT A;  2JEA I;  3S17 H;  1SRO A;  1E7Z A;  2B29 A;  2Q2U A;  3U50 C;  3L7Z C;  2DUD A;  1TWC H;  4HJ5 A;  2JE6 I;  1NMG A;  4PZ8 A;  1EYG A;  2VQF Q;  4DR6 L;  4L5Q A;  4R4Q A;  2ZTC A;  4DR2 L;  1BBU A;  3M4Q A;  1S3O A;  2MO0 A;  4LF5 L;  1G51 A;  1MIU A;  2PMZ E;  4A3F G;  2NN6 G;  3J80 i;  1E24 A;  4O2D A;  4JI3 Q;  3CC2 A;  1YBY A;  1VQ7 A;  2I5M X;  3E0E A;  1A8V A;  4IPC A;  3ULP A;  4GN5 A;  3JC6 6;  4A4I A;  4P71 A;  4JI5 L;  3RR5 A;  3H0G G;  1XMO L;  3M4O H;  3T1H L;  2VQE Q;  5C4X H;  3HKZ E;  5IYB G;  3BU2 A;  3G6E A;  1Q82 C;  4DR4 Q;  1N33 Q;  1L0W A;  1B8A A;  1VQF A;  1YJ9 A;  4LF7 L;  5IY0 A;  2LXJ A;  4DV1 L;  4LFC L;  2UUB L;  2YU9 H;  4DR7 L;  5AJ3 Q;  2R93 G;  2ZTE A;  2ATW A;  1B70 B;  4UP8 A;  5IP7 H;  2OWO A;  1VS0 A;  1NBW A;  4DR5 Q;  3JAM c;  3RLO A;  1VQ6 A;  1PH4 A;  2HHH Q;  3K7A H;  1IBK L;  4GNX A;  2F4V L;  4YCW A;  1NMF A;  1CKN B;  2B3G A;  1QVF A;  4GKJ L;  4NXM Q;  3B6Y A;  2ZJQ A;  4OWW B;  4LFB L;  2IHF A;  1K8G A;  3RLN A;  1HNZ L;  5C4X G;  4B3T L;  4JV5 Q;  5DLQ E;  2I5H A;  4B3R L;  3STB C;  3PIP A;  1N8R C;  2H5X A;  2K50 A;  2ZTD A;  1WCM H;  4LF6 Q;  1WJJ A;  1Z9F A;  3UE1 A;  5LMU Q;  2PI2 E;  4IOA A;  1MJE A;  1IBL L;  2N49 A;  2OTJ A;  4EX5 A;  1UE1 A;  1AE3 A;  2MFI A;  2WB1 G;  2MNA A;  4GOP A;  4OWX B;  1G6P A;  2WAQ G;  4IPH A;  4KI0 A;  1I94 Q;  1KXL A;  2LSS A;  1CSQ A;  1PYS B;  4GS3 A;  4KLK A;  1JJ2 A;  2VS1 A;  3CAM A;  4UY8 C;  4JI7 L;  3AEV A;  2I0Q A;  1YZ6 A;  5M3F H;  3PF4 A;  3MEF A;  5M3M H;  4BBR H;  2E2H H;  4BY7 H;  4A3B G;  4AH6 A;  3ER0 A;  2K14 A;  3HOX H;  2AWN A;  3EIV A;  3J81 c;  3KJP A;  5M5Y H;  4GLV B;  3CCR A;  3I4N H;  4GKK L;  1WCM G;  1PA6 A;  4DR3 Q;  4JOI A;  3S1R H;  4IFD G;  4PMW A;  3STB D;  1Q1B A;  3I2Z A;  5IP9 H;  3HOU H;  4QY7 A;  1FGU A;  3UDI A;  3GO5 A;  5GAE C;  3DM3 A;  5C44 G;  2UUA Q;  4MTN A;  5GAH C;  3TS2 A;  1X3E A;  3D31 A;  2OTL A;  2HIX A;  4LFA Q;  4DUY Q;  4A3G H;  1VCI A;  3GTM H;  5M3F G;  3J81 i;  1K83 H;  4A3L H;  3CQZ H;  3E9H A;  1KRT A;  4JI1 Q;  4BBR G;  4A3K H;  4JBM A;  3J7A 5;  4A3J H;  3RZD H;  4BY7 G;  2XTI A;  2E5L L;  4BA2 I;  1XPR A;  5C3E G;  4YCU A;  4HIK A;  4R4T A;  3HOX G;  1FJG L;  4RG1 A;  3I4O A;  4B3M L;  3I4N G;  2Z6K A;  2UU9 Q;  2VY3 A;  4JYA Q;  3HKS A;  5IYD H;  2UXC L;  1KIX A;  3KF6 B;  4IPG A;  2OQK A;  1Y1W H;  5IP9 G;  4BBS H;  4X66 Q;  4GLX A;  3L0O A;  1VQJ A;  2WFW A;  3ERS X;  1S40 A;  1V9P A;  5BR8 L;  3UDG A;  3S1Q H;  1SLJ A;  1PYB A;  3BZK A;  2JJQ A;  3U58 A;  3S1N H;  4A3G G;  4X65 Q;  1JJC B;  1RL2 A;  2JA6 H;  2B63 H;  4A3L G;  1PH3 A;  4A3K G;  4C3J H;  3L2P A;  1HR0 L;  1U5K A;  4YY3 L;  3PUY A;  1ASY A;  1YVC A;  4B3S Q;  1OXV A;  3S16 H;  5GRO A;  4A3D G;  4KHP Q;  3A0J A;  1X56 A;  4HJA A;  3DLL A;  1UEB A;  3J7Z C;  5ELN A;  1Y14 B;  1JMC A;  1Y1V H;  4DAM A;  1KAW A;  4JI4 L;  3RN2 A;  3ZJY C;  4OX9 L;  4QIW E;  1N34 Q;  3KLW A;  3PSI A;  4J15 A;  3VDY A;  1PH1 A;  4BBS G;  1V43 A;  4LF4 L;  2NZO A;  4MNO A;  5C0X J;  4JI0 Q;  1VQ5 A;  2A1A A;  3J80 c;  2F4V Q;  1LTL A;  1Q12 A;  1T9H A;  3W5O A;  4X62 L;  1YHA A;  3CCQ A;  2B63 G;  5IYB H;  1UWV A;  3KDF A;  3PV0 A;  3M85 A;  2Q2H A;  1YJW A;  3K7U C;  2UXB L;  2YV5 A;  3KYH C;  1UE6 A;  1LYL A;  2ALY B;  2R6G A;  2BH2 A;  4HIM A;  4NXN Q;  3OTO Q;  4GN3 B;  2CFM A;  1HNX L;  2CQO A;  2R93 H;  3S2H H;  1A0I A;  4A75 A;  2AWO A;  4JI6 L;  1IBM L;  1Y1V G;  1VQK A;  2L15 A;  3WWV A;  4R4O A;  1VQA A;  1Q7Y C;  3ULJ A;  3HOY G;  2BH8 A;  5IWA Q;  2UXD Q;  3NEN A;  4XIG S;  1PVO A;  4Y7N H;  4HJ8 A;  4TVA B;  4EQ5 A;  1C0A A;  3I4M H;  3KF8 B;  1XPO A;  3UE0 A;  4DV0 L;  1K8A C;  4A93 H;  2BA0 A;  4C3I H;  3HKZ G;  2GVA A;  2EXD A;  2QEX A;  5LMN W;  1N32 L;  3TQY A;  2I5L X;  4JI2 Q;  1SN8 A;  1K3R A;  1XMQ L;  4AIM A;  4DV5 L;  4GKK Q;  1YHQ A;  1XNR Q;  5JJI A;  1SFO H;  1VQ8 A;  2RCN A;  1KL9 A;  5EAY A;  1R9T H;  3TRZ A;  5HGQ A;  5ELO A;  1CKO A;  1BBW A;  2KHI A;  1HNW L;  1HZC A;  1QUQ A;  4JBK A;  1N36 Q;  4DV3 Q;  2ZM6 Q;  1VQC A;  2KBN A;  4FDB A;  3GDE A;  4NB3 A;  4OWT B;  4DAY B;  4LUV A;  1Q46 A;  3I4M G;  4A3B H;  3H3V I;  2HIV A;  3PO2 G;  4A93 G;  3AFQ A;  4YHH L;  1FL0 A;  1JJG A;  3I55 A;  4K0K Q;  1U0L A;  2HT1 A;  1X3G A;  5JJL A;  2QGQ A;  3U4Z A;  4A76 A;  1UE5 A;  1OXU A;  3OYY A;  1YJN A;  3OW2 A;  2EQS A;  1J5E L;  3PIO A;  4DV7 Q;  4GNX B;  1D8L A;  1HJP A;  2K75 A;  1XPU A;  3GTK H;  2N8N A;  5C44 H;  3PUV A;  1D7Q A;  3E9I A;  4HJ7 A; 
#chains in the Genus database with same CATH topology
 4DR1 L;  5CV4 A;  1EY9 A;  3GD7 A;  1EFW A;  2BA1 A;  4KMU C;  1JCK B;  1JT8 A;  1QJO A;  1XTD A;  3FVQ A;  4K8I A;  3FPP A;  5CV5 A;  1VQP A;  2JSO A;  1VQ9 A;  5FLX c;  2MPM A;  1SMY D;  5HY6 A;  5I6W A;  4ZUI A;  1WYD A;  1HZA A;  5ELF A;  4A3C H;  1EWH A;  2EYF A;  2RBM A;  1A63 A;  1EQR A;  3IRB A;  5GAG C;  1C0A A;  2VQE L;  3HRZ C;  3F2B A;  2RHS B;  4JBJ A;  4H02 A;  5IYC H;  4V0B A;  3VR3 A;  4EGV A;  1XNQ Q;  4WJ4 A;  1U4L A;  5AJ3 L;  4HR7 B;  4RWS C;  3CCU A;  1H9J A;  1WTV A;  1L0X B;  2G9H D;  2HHH L;  4PNY A;  1HFN A;  1GM5 A;  1YNX A;  5ELE A;  4A3C G;  4IPD A;  2WV6 D;  3M4P A;  2RQX A;  3QR8 A;  3GTO H;  2PI2 A;  1IL2 A;  1EZ6 A;  1Q3L A;  4J1M A;  2LFN A;  5IYC G;  3QOL A;  3UDF A;  2HDM A;  2OEO A;  4CDE C;  1GUO A;  3CCL A;  1KNE A;  1SBB B;  4LF6 L;  1Q81 C;  1VQB A;  3WOE A;  4L5S A;  5KNB A;  1I94 L;  5IGE A;  1RIP A;  1S5E D;  4IFD J;  2VNU D;  3SVM A;  2K32 A;  3HOY H;  1EIY B;  4BY1 H;  3DUZ A;  1V1Q A;  2J0T D;  3NHH A;  1RF2 D;  2K5V A;  4JPB W;  4N8F A;  1G29 1;  1CZW A;  1V1O A;  5FOB B;  1LAC A;  4LF9 L;  1HNZ Q;  3VYU A;  2R7F A;  2D0O A;  5C3W A;  2F03 A;  2L1B A;  1YNJ C;  1KD1 C;  2NTS A;  1JIC A;  1H9K A;  3HZX A;  1WCM B;  3CD6 A;  1U4M A;  4DUY L;  1E2Z A;  1BUV T;  1GXD C;  4BY1 G;  3FHW A;  1C48 A;  1T5E A;  2ID0 A;  3M3Y H;  1PTO B;  5CV8 A;  1X9N A;  1NR2 A;  2QIL A;  2QA4 A;  5JOB A;  2E2H B;  4CKC A;  1II3 A;  1VQO A;  3HOX B;  1I4R A;  1QCB D;  1WTO A;  3HOV H;  3EN2 A;  4QF4 A;  3S1R B;  3HFZ B;  2HCC A;  4GNX C;  3VYS A;  1S72 A;  3K58 A;  5ELB A;  2A5H A;  4A3I H;  1QVG A;  3BYY B;  2F0J A;  1OXX K;  2XGT A;  2O2L D;  5HGT A;  3OIQ A;  1TKW B;  4L5T A;  5L37 A;  1TWF H;  2KA7 A;  1AH9 A;  1OXS C;  2R92 H;  3RZD B;  1VMC A;  3S2D H;  1CT1 D;  1FJG Q;  1KLG D;  4A3D B;  2HD3 A;  1DGS A;  3HOV G;  1MKH A;  2LMC B;  1QUQ B;  2PNR C;  4K8J A;  4EVO A;  4E6I A;  4A3E H;  1UAP A;  4A3I G;  3S1Q B;  2TMP A;  1PHJ A;  3I70 A;  2VW9 A;  3S1N B;  5E1F A;  4MIU A;  2B63 B;  1ZXT A;  1X55 A;  5IOD A;  2YTY A;  3RN5 A;  2WB1 E;  1FNW A;  1VMP A;  4RKL A;  2WAQ E;  1I4P A;  1GOZ A;  1S5D D;  4UPA A;  4JI4 Q;  3PCO B;  1ENA A;  4JC0 A;  5C0X H;  2JA5 H;  3KK7 A;  2KCN A;  5FO8 B;  4JCV E;  3A74 A;  2NVQ H;  2K5N A;  5JVG 3;  5C4J H;  1NR4 A;  3CPW A;  5IT9 c;  5H1S E;  3PO3 H;  4Y52 H;  3ICE A;  3UDX A;  4JI2 L;  2Z6K C;  2Z8L A;  2NZH A;  5EBD A;  3HKZ B;  1T5X D;  4LF9 Q;  4R4C A;  4V19 0;  2Z1C A;  2K4K A;  1E2V A;  2R93 B;  3T56 B;  4WJW A;  1IBM Q;  4C1N K;  1G6Z A;  2KCC A;  2B2U C;  1CA6 A;  2JA5 G;  1A2U A;  4F87 A;  2NVT H;  1B7Y B;  4XQQ A;  3CCV A;  4Y7N B;  2JYO A;  1PFB A;  2AMC B;  4IZ8 A;  1HFG A;  4DAP A;  2B2W A;  3PO3 G;  5JEA G;  1W6K A;  3EJI A;  1X32 A;  1QZH A;  4C3I B;  4P73 A;  3A7L A;  4DV7 L;  3LWE A;  4A3M H;  1NJI C;  1BQQ T;  1IW7 C;  2I46 A;  1XMQ Q;  3GTJ H;  3TN2 A;  1Z47 A;  4LWC A;  2NVX H;  5IGD A;  4IAL A;  4IUT A;  1CKM A;  4EQP A;  2WKD A;  4LF8 L;  3OWF A;  1AZQ A;  1UE7 A;  2DJG C;  3OHX C;  1YEZ A;  3BVG A;  1BCP C;  2C35 B;  4KN7 C;  1KC8 C;  4A3M G;  3D4D A;  3T1Y L;  3W3A A;  1ASZ A;  4WRD A;  2B8F A;  2AKW B;  1IL8 A;  1GUW A;  2KHS A;  2QCP X;  4NXN L;  5CV9 A;  3H91 A;  5COR A;  2EJG C;  1SRO A;  2EDG A;  5KRU A;  1PMR A;  1O80 A;  3KF8 A;  1IYU A;  3L7Z C;  1CK1 A;  3GTP B;  1TWC H;  5C3E B;  2JE6 I;  1PDQ A;  3DWA A;  1ENC A;  4R4Q A;  2ZTC A;  1S3O A;  4LF5 L;  1MIU A;  2SDF A;  3NPP A;  1BO0 A;  4O2D A;  4JI3 Q;  4RAU C;  1VQ7 A;  2NBF A;  4P71 A;  3J7A V;  3RR5 A;  2F0E A;  1WVL A;  1YNN D;  1XMO L;  3T1H L;  4K5X A;  3BU2 A;  4HN7 A;  1YJ9 A;  3OPO A;  5IY0 A;  1CM9 A;  3TDQ A;  3IFD A;  1WTP A;  3E5S A;  2R93 G;  2X6L A;  2ATW A;  2GA4 B;  2OWO A;  4LMQ D;  3JAM c;  3URY A;  3K7A H;  2F4V L;  4XT1 B;  2VUM B;  4GKJ L;  5EGT A;  2IHF A;  2ICE C;  1K8G A;  3S14 B;  2FJ2 A;  4B3T L;  2F3V A;  3STB C;  1HA6 A;  1N8R C;  1CTM A;  2H5X A;  2ZTD A;  4IOA A;  2H1E A;  4IFD H;  1MJE A;  1IBL L;  5BN4 A;  1D5Z C;  2MFI A;  5CGK A;  2L5T A;  5JAV A;  2MUY A;  2PZU A;  4RKB A;  4M8A A;  4GS3 A;  1PYS B;  5KND A;  1JJ2 A;  1Z7T A;  4UY8 C;  5CBE E;  1TS4 A;  4BS9 A;  2EJM A;  2EXZ A;  4BBR H;  4A3B G;  2K14 A;  2G9D A;  1JE4 A;  3OSO A;  2K1B A;  3HG9 A;  4OHJ A;  3VR5 A;  5KGU A;  1AN8 A;  4IFD G;  4PMW A;  5TSS A;  1JC7 A;  3NUC A;  2A6E C;  1TS5 A;  5GAE C;  2UUA Q;  3TS2 A;  1LTS D;  3GP7 A;  4C3H B;  1AEX A;  2AUK A;  4LFA Q;  2OTL A;  4X3K A;  1H9M A;  3GTM H;  1ILQ A;  3J81 i;  4FF4 A;  3E9H A;  4BBR G;  5IT9 L;  4A3J H;  2XTI A;  3I8Z A;  3I72 A;  1R4Q B;  5C3E G;  2LKV A;  2A74 C;  4RG1 A;  3S17 B;  3HGB A;  5KNC A;  2UU9 Q;  4JYA Q;  2L9H A;  3HKS A;  5ISR A;  2UXC L;  4FXK C;  1Y1W H;  4BBS H;  1KLU D;  1VQJ A;  3ERS X;  1Q8I A;  1EY4 A;  3TP5 A;  1RL2 A;  2JA8 B;  2K5D A;  2E75 C;  4B3S Q;  1OXV A;  2BOS A;  1I3Q B;  3BDC A;  2Z4I A;  4YIJ A;  3DLL A;  1DOL A;  1IYV A;  4DAM A;  2N55 A;  1XYI A;  1H9R A;  4OX9 L;  4BBS G;  2RSO A;  3VDY A;  1UNS A;  3DWQ A;  4LF4 L;  2NZO A;  4KY5 A;  2PO4 A;  3HOW B;  2A1A A;  3J80 c;  2F4V Q;  2LY7 A;  3W5O A;  1RKN A;  1UWV A;  2A73 B;  3PV0 A;  1YJW A;  2Q2H A;  4DNT B;  3S1M B;  4KN4 C;  2YV5 A;  3QIA A;  3KYH C;  1J9O A;  4ILW A;  1HNX L;  1EY5 A;  2CQO A;  3EVQ A;  1EIH A;  2AWO A;  3WWV A;  2B2Y A;  4C2M B;  2UXD Q;  5IWA Q;  2NZ1 D;  3NEN A;  1F9S A;  2XRS D;  2K28 A;  4TVA B;  1OO9 B;  1HCZ A;  1TVX A;  2Q8R E;  5T1G A;  3TP6 A;  1ONL A;  3KF8 B;  2XVS A;  4DV0 L;  1K8A C;  4A93 H;  3GTL B;  1I50 B;  3CRK C;  2QEX A;  2EXD A;  1N32 L;  3K6O A;  1SNQ A;  2HDL A;  3TQY A;  1TWH B;  4DGZ A;  1SN8 A;  1K3R A;  1STB A;  1SFO H;  1R9T H;  4DK0 A;  1YNJ D;  1HNW L;  1N36 Q;  4DV3 Q;  1VQC A;  4NB3 A;  3GDE A;  1UUP A;  1EFI D;  5M5W B;  4A93 G;  1AW7 A;  1CI3 M;  4K0K Q;  3A8K E;  1MD2 D;  1X3G A;  2F3W A;  5JJL A;  4G7Z C;  4FNF A;  3OYY A;  1DJR D;  3P7J A;  2J7Z A;  3JAM L;  3GTK H;  1XPU A;  1DON A;  4K2L A;  4HJ7 A;  2RHQ B;  4IUU A;  1PYW D;  4YCV A;  4HIO A;  3G71 A;  2E2I B;  2F0L A;  4JI8 L;  4OXP A;  2L0C A;  2BE5 C;  4J8Q A;  4KKU A;  3IL8 A;  3QG1 A;  4X64 L;  2DNE A;  2F0S A;  1RTO A;  5FJ8 H;  2Q2I A;  3N52 A;  1S5F D;  4RFB A;  1GVP A;  2RVL A;  4ULL A;  3Q8D A;  1ZYR D;  2Y0S E;  3F1Z A;  1Q86 C;  4DV4 Q;  2B2T A;  2PCF B;  4LAA A;  1A15 A;  4HTH A;  3LX0 A;  3HOW G;  1EY6 A;  1D5X C;  2F3I A;  3ONA B;  4PV1 C;  5C0X I;  1VQ8 A;  3HOZ H;  2CWA A;  1QB5 D;  1V1P B;  1M1K C;  3MXG A;  1N34 Q;  4DR4 L;  3AYH B;  3NP8 A;  1IYJ B;  5M5X H;  4YWM A;  3KOJ A;  3T13 A;  4LNQ A;  2K04 A;  4JVZ A;  4TRD A;  1NUC A;  1RHP A;  5FJ8 G;  1SE3 A;  4WJ3 M;  1JOR A;  5ELD A;  1BCP F;  2D62 A;  4DR6 Q;  4DR2 Q;  2ENB A;  4POG A;  2JA7 H;  1HPC A;  1O7Y A;  3HOZ G;  1TT2 A;  2WIN B;  1LT6 D;  1JB3 A;  4KK7 A;  2JP1 A;  5GAD C;  3BVZ A;  3GV3 A;  3M4O B;  2AQ2 B;  3W1G A;  1Q1E A;  2WKC A;  4AQY L;  1N32 Q;  5C3X A;  1KDC A;  2SNM A;  5E7N A;  4LFC Q;  2PQA A;  3CW2 C;  3MVV A;  2YU9 B;  2UUC L;  4DR7 Q;  1QIL A;  2WB1 B;  4XYO A;  1D6E C;  5A35 A;  3S24 A;  2WAQ B;  1K0R A;  2JA7 G;  2FFK B;  2AUJ D;  2KHJ A;  4PZ7 A;  4PZ6 A;  2E2J H;  4HSV A;  3BDL A;  4XTC S;  4X3S A;  3F8T A;  1I4H A;  4DR3 L;  2YYZ A;  5JEA J;  4QGU A;  4B3R Q;  5CR3 A;  1FVI A;  1FD7 D;  1LTG D;  3QOJ A;  4EQO A;  4ZUJ A;  2NVY H;  3NTI A;  1HXY D;  1DXM A;  2O4X A;  5IGG A;  2OCE A;  1IW7 D;  3J80 L;  3PF5 A;  3FKI H;  1HA5 A;  2Q2T A;  1WTX A;  1ZKO A;  5M3F B;  4JI8 Q;  5M3M B;  3PO2 H;  1NSN S;  4LUZ A;  3MFY A;  1E3P A;  4BY7 B;  1KQS A;  4X64 Q;  5LL6 S;  2IJ0 A;  1J6Q A;  2ES2 A;  2BDN A;  3A5U A;  5M5Y B;  3I4N B;  2F0U A;  2WII B;  4HMI A;  1EWC A;  1BCP D;  2L11 A;  4J6H A;  5ELC A;  3HOU B;  4X65 L;  3H6M A;  2CH4 W;  1FNV A;  4X3U A;  3FKI G;  4B08 A;  2YTX A;  1EYD A;  4A3G B;  2KEC A;  3NSW A;  1RJT A;  4KHP L;  2K52 A;  2CKZ B;  3SK6 A;  4DAY A;  5FLX E;  5JJZ A;  2K7V A;  2E5L Q;  3GTG H;  3SR1 A;  1W3S A;  2C9O A;  4GOP C;  4L5R C;  5J3B A;  2F52 A;  1K9M C;  1HZB A;  4JI0 L;  5FO9 B;  3J81 j;  3R8B A;  2DJF C;  5GQO A;  2KEN A;  5BR8 Q;  2F0G A;  1EQQ A;  1SNP A;  1PFS A;  3BJU A;  2EY5 A;  1PZJ D;  3MXP A;  1PH6 A;  3OTO L;  4ZKC B;  4JOI C;  4C3J B;  2VQF L;  5KYI A;  1EYC A;  1B4O A;  3C1E A;  1DOK A;  1W2B A;  4NKL A;  4KY6 A;  4AQY Q;  1GUG A;  4IFD I;  5IP7 G;  1SYB A;  4KD4 A;  2CW0 D;  4OL7 A;  1LTB D;  1X6O A;  2N88 A;  1B9M A;  1JR0 D;  2UUC Q;  2RA4 A;  3HOY B;  3V2T A;  2GVB A;  1QNK A;  3EBE A;  3KLS X;  1X3F A;  4C1N I;  1K73 C;  1XNR L;  2EYJ A;  3I4L A;  3FP9 A;  4PMB A;  1A3U A;  4O0A A;  1LUZ A;  4IOC A;  1PXU A;  5D3I B;  2F0P A;  2YTV A;  1TWG H;  3R2T A;  1SE4 A;  2SOB A;  5M3M G;  4DK3 C;  2VB3 X;  5I2Y A;  1KRS A;  4I7A A;  1IXR A;  4KD3 A;  3R93 A;  1PRT C;  1EIG A;  3S15 H;  3T16 A;  3NEM A;  3CP0 A;  2VZA A;  2A69 D;  3HOU G;  2D0P A;  5FLM H;  1FNU A;  5LMN L;  3MXN B;  1X65 A;  2A19 A;  3NBH B;  5A2Q L;  4DV6 L;  2X69 A;  3Q0A A;  2A6E D;  1QNU A;  1VQL A;  3MA2 B;  3P20 A;  3PUW A;  4O42 A;  1PH5 A;  2XIW A;  1EUJ A;  2F0Q A;  1IHZ A;  4P74 A;  3VR6 A;  4RGN A;  1ILP A;  4DPG A;  3F2D A;  2PQA B;  4JG2 A;  4DUZ L;  3D8G A;  3I73 A;  1VDZ A;  2B2V C;  2L4N A;  3TEH B;  4L8J A;  5COY A;  5C6A A;  5FLM G;  1J5E Q;  1VQN A;  1Q90 A;  5C44 B;  4U67 3;  4DR1 Q;  1V8Q A;  3MC0 B;  3S9W A;  2JEA I;  4N9P A;  4H44 C;  1A3T A;  1U4P A;  3QO2 A;  4ZKB B;  3K5L A;  4H7B A;  3F2U A;  4RCN A;  3U50 C;  3C3L A;  2KUM A;  3OMG A;  4KHV A;  3K5M A;  1NMG A;  4PZ8 A;  3RD4 A;  2VQF Q;  2C5C A;  2Q8I B;  1BBU A;  3M4Q A;  2DY7 A;  4KJN A;  3MHB A;  4K2K A;  3K5O A;  2I5M X;  4IPC A;  3DMU A;  2M00 A;  4GN5 A;  3JC6 6;  3R2I A;  4A4I A;  3AU7 A;  4JI5 L;  3C2P A;  2VQE Q;  1TWA B;  3D6W A;  1LAB A;  1EOT A;  1VQF A;  4LF7 L;  4DV1 L;  3KUP A;  2UUB L;  4ZK9 B;  5AJ3 Q;  2ZTE A;  4UP8 A;  1VS0 A;  4ZQ3 A;  1BR9 A;  4JW0 A;  4XT3 B;  1PH4 A;  2EZV A;  2HHH Q;  1IBK L;  5IT9 E;  4GNX A;  4YCW A;  1NMF A;  4OWW B;  4LFB L;  1JWU D;  2F0N A;  3WDN A;  5CBA E;  5DLQ E;  2I5H A;  4O1N A;  2XNA C;  1WCM H;  4LF6 Q;  1SNC A;  4DA2 A;  1WJJ A;  1Z9F A;  2B8G A;  2E74 C;  3NE5 B;  3H09 A;  1RCV D;  4WFN 3;  1G6P A;  1LT4 D;  3BYT B;  4IPH A;  1I94 Q;  3ITP A;  4KLK A;  2VS1 A;  4JI7 L;  1PTO H;  2K03 A;  3X3M A;  1Y8O B;  4NP5 A;  1JQY D;  1ENF A;  2E2H H;  1JOO A;  4Q0F A;  3HOX H;  5JEA H;  3J81 c;  3KJP A;  3R3O A;  4GLV B;  1H9S A;  1WCM G;  3DWP A;  1PA6 A;  2AQ1 B;  4RGM A;  4Q5V A;  3S1R H;  5FLX L;  1Q1B A;  4DNR B;  2JN4 A;  2V4D A;  2PQE A;  1HTL D;  1QWY A;  3DM3 A;  5C44 G;  5GAH C;  1STY A;  4DUY Q;  5KEE A;  1I4G A;  2PZW A;  2A6H C;  2B2W C;  1EL0 A;  1TU2 B;  1M4V A;  3RZD H;  1SYC A;  4HIK A;  4R4T A;  2BE5 D;  3HOX G;  3E0J A;  5EJW A;  3I4O A;  4B3M L;  2Z6K A;  3VR4 A;  2RDG A;  1LTR D;  4IPG A;  1O7L A;  2F0K A;  3L0O A;  3SHL A;  3S1Q H;  1SLJ A;  3BZK A;  5BN5 A;  3U58 A;  3S1N H;  1JJC B;  2B2U A;  3AMU A;  2B63 H;  1NNX A;  3E6Z X;  4XXE A;  3L2P A;  1HR0 L;  2IX3 A;  4YY3 L;  4FF1 A;  3PUY A;  5E4W C;  1ASY A;  5CC4 A;  4DAV A;  4A3D G;  3RZO B;  2DNC A;  1CFM A;  2DY8 A;  1X56 A;  3GV6 A;  3NWT A;  5CYU A;  2IW3 A;  4DFA A;  4K5V A;  4K14 A;  1KAW A;  1EEI D;  3ZJY C;  4QIW E;  3KLW A;  2NB0 A;  1XWE A;  3U9O A;  2Y0S B;  4ZLT F;  2O5I C;  2R7Z B;  1T9H A;  4X62 L;  4KKT A;  2B63 G;  1YHA A;  4CBV A;  3KDF A;  1S5B D;  2UXB L;  3M4Y A;  3MEH A;  3JAM E;  1UE6 A;  2R6G A;  4HIM A;  1MSG A;  3GTQ B;  2CFM A;  2R93 H;  1A0I A;  4A75 A;  3TSS A;  4JI6 L;  3CHB D;  1VQK A;  4DU9 A;  2EY1 A;  3L9A X;  3ULJ A;  3DEP A;  2BH8 A;  1GUN A;  4Y7N H;  4HJ8 A;  3A7A B;  4DK1 A;  3EA6 A;  4FP5 D;  1HTP A;  4C3I H;  3HKZ G;  2GVA A;  5E3F A;  2I5L X;  1I6V C;  4JI2 Q;  3IAY A;  1LTA D;  4FF2 A;  4DV5 L;  5M9O A;  1ET6 A;  4QMG A;  1BDO A;  2KHI A;  2F1M A;  1HZC A;  4JBK A;  1STE A;  1B3Q A;  4F88 A;  2HUG A;  4N9T A;  2QKI C;  4LUV A;  1EU3 A;  4A3B H;  3AFQ A;  4YHH L;  4C3I G;  3I55 A;  3CU7 A;  5NUC A;  2HT1 A;  3TZU A;  4A76 A;  1SMY C;  1UE5 A;  4PMC A;  5K36 H;  3OW2 A;  4TKO B;  4GNX B;  1F2Z A;  4DV7 Q;  1HJP A;  1HRJ A;  3O13 A;  1EU4 A;  1GHK A;  3RUZ A;  2AHO B;  1WOC A;  1SRU A;  3GTP H;  4IUQ A;  3OWE B;  5C3E H;  4HED A;  4LF8 Q;  2SEB D;  3G48 A;  1SR3 A;  3PUX A;  1PRT F;  2EYP A;  3NWS A;  3VA5 A;  3VYR A;  5K36 G;  1PH7 A;  1PH2 A;  1YIJ A;  3K0X A;  2EY2 A;  3BVM A;  5I6Y A;  3T1Y Q;  1ROD A;  2K5W A;  4A3F B;  5J22 A;  3E3X A;  2KCM A;  4MZ9 A;  4NXN Q;  3G4S A;  4BXX G;  3H0G B;  3J7Y W;  1H9S B;  3X3N A;  3NEL A;  4R8I A;  2UXB Q;  4DR5 L;  4TSS A;  3J80 E;  2JK8 A;  3CKI B;  1LO5 D;  2N78 A;  4LF5 Q;  1S4Z A;  2VUM H;  2ZXR A;  4CGY B;  2Z0S A;  3S14 H;  4JV5 L;  3T53 B;  3ERO A;  1EY0 A;  4QB4 A;  3ULL A;  1CHQ D;  3I7F A;  1ESR A;  1XMO Q;  1X54 A;  3T1H Q;  5T1I A;  5C4X B;  1AE2 A;  5LMU L;  1Y8P B;  1STG A;  5I2X A;  3BZC A;  2MQH A;  2TSS A;  3AFP A;  2CVR A;  1M90 C;  4RMF A;  1RDP D;  2VUM G;  1EZ8 A;  4GN4 B;  1DOM A;  4RGT A;  3Q24 A;  2EOT A;  3HEJ A;  4L63 B;  5D65 A;  3BG3 A;  2PNH A;  3K80 C;  4K6L A;  4GKJ Q;  1L1O A;  3NTH A;  4KY7 A;  2G5D A;  4B3T Q;  4X6A H;  3J7A F;  1PRT D;  2B2Y C;  5EKK A;  3I56 A;  5G3L F;  4C3H H;  1IBL Q;  1PLF A;  2F0H A;  1SNO A;  2K6A A;  5EKL A;  1VQH A;  1I6H H;  5KYL A;  3KDF B;  4JI1 L;  4GLA C;  1TXY A;  3NBI A;  3PGZ A;  2MO1 A;  1D1K A;  1HZ9 A;  2K05 A;  1EY7 A;  4DXF A;  5CV7 A;  4IUV A;  2NUC A;  1E22 A;  1BCP B;  2WAC A;  2IWH A;  4X66 L;  1P16 A;  2QF7 A;  3F2C A;  4C3H G;  1VQG A;  2IT1 A;  3TZD A;  1DM0 B;  1QG7 A;  5K5P A;  2JA8 H;  1XTC D;  1CHP D;  3K59 A;  4JBW A;  1VQM A;  1I3Q H;  3A54 A;  3KLR A;  1B3A A;  1CKN A;  1HUM A;  1K83 B;  3CQZ B;  3TME A;  5M5X B;  4A3K B;  4ALP A;  4NDX A;  1O7I A;  1BVS A;  2AQ3 B;  3HP3 A;  4PG3 A;  5FK9 C;  2UXC Q;  3HOW H;  1A3V A;  1E0B A;  3RNU A;  5J1Z A;  2R7D A;  2JA8 G;  3S1M H;  4OON A;  2JA6 B;  2E8G A;  4FXG C;  3ZYY X;  3S16 B;  2DGY A;  1G2T A;  1LV9 A;  3JAM i;  1KDA A;  1K3B C;  1MJC A;  1N9W A;  3CXC A;  1HQM C;  5KIX A;  5D3D A;  5A2Q E;  1PH8 A;  4N8X 1;  4C2M H;  1VQ4 A;  1Y1V B;  2XSC A;  2O5J C;  2R61 A;  4AYB E;  5IE8 A;  4OX9 Q;  5G3L D;  1SNM A;  1ZEQ X;  5IGC A;  5DEH A;  3AQQ A;  1VQE A;  4LF4 Q;  3GTL H;  3QWN A;  1I50 H;  1SDF A;  1TWH H;  3NXW A;  4QUC A;  1GUS A;  1PFN A;  3W1B A;  5FO7 B;  1MHW C;  3G7L A;  3OIP A;  3K81 C;  1HNX Q;  3S2H B;  3K8A A;  5FKA C;  2ZM6 L;  4NXM L;  4RHS A;  2IHE A;  4ABN A;  3K57 A;  1VF5 C;  5M5W H;  2K5H A;  2E2D C;  2XWB B;  4WOR A;  3I4M B;  2QW7 A;  4DV0 Q;  4OO1 H;  3MWY W;  5LHY 1;  1X3Q A;  1EIF A;  1GD7 A;  1WI5 A;  3UI2 A;  1M8A A;  4POF A;  3U4V A;  2E2I H;  3V05 A;  2WP8 J;  2KED A;  1BF4 A;  3TS0 A;  4Z9C B;  3HS0 C;  1HNW Q;  3VR2 A;  5JVH 3;  1QVC A;  1PTO C;  1BKB A;  2CCZ A;  4HJ9 A;  2EYL A;  2RDF A;  1VQI A;  1JE5 A;  4OO1 G;  2BCO A;  1YI2 A;  4EQN A;  5IYD G;  2CWP A;  2PW5 A;  2NN6 H;  3G6J B;  1G2S A;  1B9N A;  1YNN C;  3C1F A;  3Q22 A;  1EWI A;  2ZJR A;  1L1O B;  1KAB A;  4MN3 A;  3C46 A;  4KJO A;  3SK5 A;  1XNQ L;  2JA6 G;  1OXT A;  4CJ0 B;  2Q2U A;  2VB2 X;  4ODG A;  1F9Q A;  3OW7 A;  2DUD A;  2F0I A;  3D4R A;  4HJ5 A;  2PPB C;  1F9R A;  1F9P A;  4BWG B;  1GUT A;  2F0D A;  1G51 A;  2PMZ E;  2NN6 G;  3J80 i;  1E24 A;  4LJZ C;  1YBY A;  3E0E A;  3FPU B;  1A8V A;  4IUN A;  1WD1 A;  3M4O H;  5IYB G;  3G6E A;  1Q82 C;  4DR4 Q;  2D5D A;  1PZK D;  1B8A A;  3I91 A;  2LXJ A;  2K01 A;  2H4O A;  2YU9 H;  3PQI A;  3KLS A;  3A55 A;  1B70 B;  5IP7 H;  2X6G A;  1NBW A;  5IIF A;  1D1I A;  2P5Z X;  1WTW A;  5C4Z A;  4QIW B;  5C5L A;  1CKN B;  2B3G A;  3TBI B;  4NXM Q;  3B6Y A;  1F2Y A;  3GTO B;  4S3S A;  1HNZ L;  4RHR A;  3BZD B;  2M9V A;  3PIP A;  2K50 A;  2IPK D;  3UE1 A;  2FHT A;  4CDF C;  1LT5 D;  3QJY A;  4EX5 A;  2WB1 G;  4GOP A;  4KTA A;  2WAQ G;  4KI0 A;  2D2C C;  1F77 A;  2LSS A;  1CSQ A;  2K33 A;  3LNN A;  3CAM A;  3SXH A;  2MGS A;  1YZ6 A;  5M3F H;  3MEF A;  5M3M H;  4BY1 B;  1L0Y B;  2ICI A;  4BY7 H;  4AH6 A;  2RSN A;  1KNA A;  5EPJ A;  2AWN A;  5M5Y H;  1K8O A;  4GKK L;  3I4N H;  3DHQ A;  4DR3 Q;  1DZ1 A;  4JOI A;  4G57 A;  3STB D;  2BDO A;  3NTK A;  3I2Z A;  4HSP A;  5IP9 H;  3HOU H;  4QY7 A;  3D3R A;  4ME5 A;  3TP7 A;  1MGS A;  3D31 A;  4A3G H;  1VCI A;  3ND8 A;  5M3F G;  1R4P B;  1KRT A;  1EEF D;  4BY7 G;  5LL6 X;  3M3Y B;  4BA2 I;  4L6T B;  1XPR A;  4YCU A;  3H3V C;  1FJG L;  3BDO A;  2KQ3 A;  3SE0 A;  4KV6 A;  3I4N G;  2EE1 A;  1SXT A;  3SK4 A;  2K5Q A;  3A8J E;  3A56 A;  1KIX A;  2OQK A;  1JWS D;  5IP9 G;  3HOV B;  2WFW A;  1S40 A;  3K5N A;  1S5C D;  4A3G G;  1O7Z A;  4X65 Q;  4A3I B;  3FDT A;  4C3J H;  1K28 A;  5GRO A;  4KHP Q;  4HJA A;  1TWF B;  1ET9 A;  2R92 B;  5ELN A;  1Y14 B;  3S2D B;  2ZXO A;  2XRQ D;  4JI4 L;  3RN2 A;  3PSI A;  3WOF A;  3P75 A;  4CJ2 C;  1V43 A;  5EPK A;  4MNO A;  4JI0 Q;  5D14 A;  1WTR A;  3SK8 A;  1Q12 A;  4A3E B;  3M85 A;  2A68 C;  3K7U C;  5EKI A;  4C3J G;  1A2T A;  2ALY B;  2F4I A;  2BH2 A;  3RMH A;  5I4D A;  3OTO Q;  2QDL A;  3GQB A;  1U4R A;  1IBM L;  2B2V A;  4R4O A;  1O78 A;  1VQA A;  2F0V A;  1Q7Y C;  1BBX C;  3HOY G;  1DYQ A;  4XIG S;  4LK1 C;  5HUR A;  3Q23 A;  2JA5 B;  2KVM A;  3Q6S A;  3UE0 A;  2BA0 A;  2HQE A;  1RTN A;  5LMN W;  2NVQ B;  5C4J B;  3PO3 B;  5I9O A;  1XMQ L;  4AIM A;  4GKK Q;  1XNR Q;  5EAY A;  3TRZ A;  5HGQ A;  5ELO A;  4F7X A;  1CKO A;  1AZP A;  1BBW A;  1EQV A;  5EPL A;  3J81 E;  4FDB A;  2KBN A;  4DAY B;  1I4Q A;  4B9X A;  2Z9H A;  4OWT B;  1I4X A;  1TY2 A;  3OMC A;  4I7Z C;  2NVT B;  2HIV A;  4FVM A;  5E4X A;  4FYD A;  1TS3 A;  1DCZ A;  1ZYR C;  2QGQ A;  1SYE A;  5JPM C;  1YJN A;  4M1U B;  1CQV A;  3PIO A;  1QE6 A;  2K75 A;  2N8N A;  4A3M B;  5C44 H;  3E9I A;  1NE3 A;  3GTJ B;  2NVX B;  5LMN Q;  3SDZ A;  4DV6 Q;  3D4W A;  3KBX A;  1B44 D;  4TQU S;  4QCL A;  3M9B A;  4R8N A;  5AFW A;  2XWJ B;  1C7Y A;  1SSO A;  2R92 G;  4GOP B;  4B9W A;  4U68 A;  4DUZ Q;  1NTG A;  4IUR A;  4ME3 A;  3CCE A;  5JPN C;  4JI3 L;  2MJ8 A;  1A62 A;  1UEA B;  3PUZ A;  2LXK A;  2KEE A;  4A3E G;  1TWA H;  2HQL A;  1E1T A;  1A6X A;  3K0Y A;  1D5M C;  5DM6 3;  2D9U A;  4HCS A;  2HCI A;  2JEB I;  1C4Q A;  2RKS A;  2ZJP A;  1PTO F;  1SND A;  3CME A;  4R9W A;  3A5Z B;  4LW1 A;  2OT2 A;  4A3D H;  3LGJ A;  2ZXP A;  1L2F A;  4BA1 I;  4ZRZ A;  1TWC B;  4DK6 C;  1STH A;  3U9S A;  1XJV A;  2EYM A;  1CUK A;  4QJF A;  5C0X G;  2OQ0 A;  4XQN A;  1TY0 A;  1U9R A;  4K6D A;  5C4H A;  1LT3 D;  4DV2 L;  1ESF A;  2JA9 A;  4JI5 Q;  3H15 A;  4DNI A;  1BXT A;  1SJH D;  3T4A C;  4OO1 I;  2F0O A;  4LF7 Q;  2EYO A;  4DV1 Q;  1SE2 A;  1TR5 A;  5J39 A;  2UUB Q;  1WFQ A;  3TRE A;  4KKS A;  1NCV A;  2NYZ D;  3CCM A;  4IQZ A;  1QOH A;  3CF5 A;  3ND9 A;  3MXU A;  3MAQ A;  1P8L A;  3K7A B;  1IBK Q;  4IN3 A;  4IO9 A;  4ID6 A;  4AYB B;  3CCJ A;  4UP9 A;  1GJX A;  1LM0 A;  1XXG A;  3M7N A;  4LFB Q;  1STN A;  1AFP A;  1GKH A;  4HAE A;  1Q8K A;  1PRT B;  4A3B B;  4G4K A;  1EY8 A;  2IY5 B;  1C9O A;  2RCF A;  4FXD A;  1VQD A;  4C56 C;  2UUA L;  1CSP A;  4LFA L;  1BNZ A;  4APV A;  2NN6 I;  2GN5 A;  3DXJ C;  1MSH A;  4JI7 Q;  3KJO A;  5EBC A;  4LUO A;  4BBR B;  1K0S A;  3L3O C;  4CDC C;  2V1C C;  1E2W A;  1PTO D;  4R1J A;  2UU9 L;  4JYA L;  1HR0 W;  1H95 A;  4JK1 C;  3IFT A;  4MTK A;  4CKE A;  4CKB A;  3CC7 A;  5DNF A;  4UDU C;  3I90 A;  4HID A;  3IKJ A;  1NAP A;  1IZ6 A;  3T51 B;  1Y8N B;  1TII D;  3PMF A;  2LS0 1;  1BOS A;  1PFM A;  4B3S L;  4RA8 A;  3H3V H;  1B2T A;  3RZO H;  3GTM B;  1B53 A;  4A3J B;  4RH6 A;  2CW0 C;  2E76 C;  2N3S A;  3D0F A;  4XDX A;  3CMA A;  1ICF B;  4CDD C;  4B3M Q;  1IKL A;  4QQB X;  2FXQ A;  5C5M A;  1SMX A;  3FRP B;  3NQI A;  3SGI A;  1SE8 A;  1Y1W B;  4BBS B;  2R7Z H;  1HQR D;  3MFG A;  3LWU A;  3CCS A;  2MHV A;  4ZCK A;  2VL6 A;  4BXX H;  4XQJ A;  1G91 A;  2OF1 A;  4DV2 Q;  1QZG A;  4H13 C;  3GTQ H;  1SYD A;  1EYA A;  1HR0 Q;  4YY3 Q;  3PIP 3;  4FF3 A;  4P72 A;  2EYH A;  4UP7 A;  2ASB A;  1HUN A;  2JQO A;  4MHE A;  4R4I A;  1YIT A;  2UXD L;  5IWA L;  2Y0S G;  1EQT A;  1GO3 E;  2R7Z G;  1F2L A;  3CPF A;  2PMZ B;  4AYB G;  4NPS A;  1N33 L;  1PZI D;  1V1P A;  1OTC A;  3ERQ A;  3QB3 A;  4X62 Q;  3J81 L;  4IJL A;  1G8Z D;  1HH2 P;  3MTS A;  2R3Z A;  1CA5 A;  2A69 C;  4KHZ A;  1TQO A;  1Z6H A;  1B50 A;  1D2B A;  5IGF A;  5JJK A;  1VF7 A;  2FIN B;  4ZAI A;  4GZY C;  1LTT D;  3RLF A;  4JI6 Q;  4OIJ A;  4DKA C;  4DV3 L;  1N36 L;  3KF6 A;  1PV4 A;  1NY4 A;  4QL5 A;  1I6H B;  2I07 B;  2J4X A;  4DN4 M;  2F0T A;  4YWK A;  1PH9 A;  4K0K L;  4OEL B;  1K8M A;  1JB7 A;  4A93 B;  2CQA A;  1WTH A;  3KFU A;  1KDB A;  1E1O A;  2RF4 A;  4FO2 A;  5I9P A;  1YHB A;  1EOV A;  4DV5 Q;  4YWL A;  1I5F A;  4IJH A;  3D6C A;  1SFO B;  1R9T B;  4RGO S;  1IKM A;  4HMJ A;  1L1O C;  3P1H A;  4H0L C;  4A3J G;  3A8I E;  2EIF A;  4P75 A;  1WTQ A;  3CC4 A;  2F0F A;  2A8V A;  2IX0 A;  4PQX A;  4YHH Q;  3KBG A;  4DV4 L;  2F0W A;  2KCT A;  1Y1W G;  4A3F H;  2IX1 A;  2EVB A;  2MP1 A;  1N34 L;  3GTK B;  1KAA A;  1KHI A;  3H0G H;  4HCE A;  4K5W A;  3S17 H;  3FMC A;  4UAI A;  1E7Z A;  2B29 A;  1SYF A;  4OGQ C;  1LLR D;  1EYG A;  4DR6 L;  4L5Q A;  3CRL C;  4OEM B;  1SJE D;  3AB9 A;  4DR2 L;  2MO0 A;  2OXP A;  4A3F G;  4NMZ A;  4QUF A;  3CC2 A;  4ZYS A;  3ULP A;  3HOZ B;  3H0G G;  3H94 A;  5CV6 A;  5C4X H;  3HKZ E;  1N33 Q;  1L0W A;  1AP0 A;  4CHT B;  2FMM A;  1SYG A;  4LFC L;  5F2D A;  2A68 D;  1Y69 U;  4DR7 L;  3N6R A;  4UHV A;  4DR5 Q;  3RLO A;  1JOK A;  1VQ6 A;  2JA7 B;  1QVF A;  2ZJQ A;  1STA A;  3EQL C;  1TS2 A;  3RLN A;  5C4X G;  4JV5 Q;  1FGB D;  4B3R L;  2FMC A;  5DM7 3;  3NQT A;  5LMU Q;  2PI2 E;  2OTJ A;  2N49 A;  2B2T C;  1UE1 A;  1AE3 A;  4F8M A;  2MNA A;  4OWX B;  3PIO 3;  1KXL A;  2XN9 C;  1WD0 A;  3AEV A;  3FEW X;  5CMD A;  2I0Q A;  3PF4 A;  3NK9 A;  3OOC A;  5IOC A;  3EFX D;  3ER0 A;  2E2J B;  4DXG A;  3EIV A;  1J8I A;  1DD2 A;  3CCR A;  4G7H C;  3VYT A;  1CZG A;  1FGU A;  1JOQ A;  2NWG A;  3GO5 A;  3UDI A;  4I65 A;  3SEB A;  4MTN A;  1RD9 D;  2M2L A;  1X3E A;  2NVY B;  1X3P A;  2HIX A;  4A3L H;  1K83 H;  3CQZ H;  4A3K H;  4JI1 Q;  3J7A 5;  4JBM A;  3VA7 A;  3FKI B;  4X3T A;  2E5L L;  1SAP A;  1XX8 A;  2DN8 A;  3PO2 B;  1FR3 A;  3DEO A;  2QEJ C;  2NTT A;  2VY3 A;  2VXW A;  5IYD H;  3KF6 B;  1B1Z A;  2L12 A;  2IL8 A;  4X66 Q;  4GLX A;  1CQF A;  3W2D A;  1C8C A;  4P2C B;  1V9P A;  5BR8 L;  3UDG A;  1PYB A;  2JJQ A;  5IGB A;  2JA6 H;  3MXN A;  3NBH A;  4A3L G;  1PH3 A;  3BS1 A;  4A3K G;  3V96 A;  4NW2 A;  1U5K A;  3S16 H;  1MI2 A;  1YVC A;  2ZT9 C;  2A6H D;  3A0J A;  2Z4H A;  2F0M A;  1UEB A;  3J7Z C;  3GTG B;  1JMC A;  1Y1V H;  5EQ0 A;  1F2M A;  2EJF C;  2CH4 A;  1PH1 A;  4J15 A;  5C0X J;  1VQ5 A;  2JXM B;  1LTL A;  1MBY A;  3CCQ A;  1HHV A;  5IYB H;  5BN3 A;  2PYK A;  2B39 A;  1LYL A;  2SNS A;  2KJX A;  2PW7 A;  4IUP A;  4GN3 B;  1JWM D;  3S2H H;  2RDH A;  1ICW A;  1Y1V G;  2L15 A;  4RCO A;  2CHB D;  3DM1 A;  1PVO A;  1W6J A;  1KTK A;  2PZT A;  4EQ5 A;  3I4M H;  1XPO A;  4XYQ A;  1ML0 D;  3TP8 A;  5DAU A;  4OIK A;  1GHJ A;  3MZ5 A;  4CJ1 B;  1YHQ A;  5JJI A;  2RCN A;  1KL9 A;  2L55 A;  2EPB A;  1SEB D;  1QUQ A;  4DF7 A;  2ZM6 Q;  1TWG B;  3I4M G;  2Z6B A;  1Q46 A;  3H3V I;  3I3C A;  3PO2 G;  1JJG A;  2Q8T A;  1FL0 A;  4G7O C;  1U0L A;  1FYC A;  3U4Z A;  2EY6 A;  1OXU A;  2KOL A;  2QDB A;  3S15 B;  3M7G A;  2EQS A;  1J5E L;  1D8L A;  1LTI D;  3PUV A;  1D7Q A; 
#chains in the Genus database with same CATH homology
 4DR1 L;  2RHQ B;  1NE3 A;  4YCV A;  4HIO A;  3G71 A;  3GD7 A;  4JI8 L;  5LMN Q;  4OXP A;  4DV6 Q;  2AHO B;  1EFW A;  1WOC A;  4TQU S;  2BA1 A;  1SRU A;  3M9B A;  3GTP H;  4X64 L;  5C3E H;  1JT8 A;  4LF8 Q;  1XTD A;  3G48 A;  1SR3 A;  1C7Y A;  5FJ8 H;  2R92 G;  3PUX A;  2Q2I A;  4GOP B;  1GVP A;  4DUZ Q;  1VQP A;  1NTG A;  5K36 G;  1VQ9 A;  3Q8D A;  4ME3 A;  1PH7 A;  3CCE A;  5FLX c;  4JI3 L;  2Y0S E;  3F1Z A;  1Q86 C;  5HY6 A;  4DV4 Q;  1YIJ A;  1PH2 A;  1A62 A;  3K0X A;  1WYD A;  1HZA A;  3T1Y Q;  3PUZ A;  4A3C H;  3HOW G;  2LXK A;  2F3I A;  3HOZ H;  5C0X I;  1A63 A;  1EQR A;  3IRB A;  5GAG C;  2CWA A;  4A3E G;  1M1K C;  1TWA H;  2HQL A;  1E1T A;  2KCM A;  4MZ9 A;  2RHS B;  3F2B A;  2VQE L;  3AYH B;  4H02 A;  4JBJ A;  1IYJ B;  5IYC H;  5M5X H;  4YWM A;  3KOJ A;  3G4S A;  4BXX G;  4LNQ A;  2JEB I;  2ZJP A;  1XNQ Q;  3CME A;  3NEL A;  3A5Z B;  4LW1 A;  4A3D H;  4WJ4 A;  5AJ3 L;  3LGJ A;  2UXB Q;  5FJ8 G;  1L2F A;  4WJ3 M;  4BA1 I;  3CCU A;  4DR5 L;  4DK6 C;  2D62 A;  2HHH L;  4DR6 Q;  2JK8 A;  1XJV A;  1GM5 A;  1YNX A;  4DR2 Q;  1CUK A;  2N78 A;  4QJF A;  4LF5 Q;  2VUM H;  5C0X G;  4POG A;  2OQ0 A;  4IPD A;  2JA7 H;  3M4P A;  4A3C G;  3HOZ G;  3GTO H;  2Z0S A;  2PI2 A;  1IL2 A;  3S14 H;  4JV5 L;  4DV2 L;  5IYC G;  3UDF A;  5GAD C;  3ULL A;  3I7F A;  2JA9 A;  4JI5 Q;  3CCL A;  1XMO Q;  1X54 A;  3T1H Q;  3W1G A;  4LF6 L;  3H15 A;  4DNI A;  1Q81 C;  1VQB A;  1Q1E A;  1AE2 A;  5LMU L;  4L5S A;  4AQY L;  4OO1 I;  1N32 Q;  4LF7 Q;  3BZC A;  2MQH A;  5E7N A;  4DV1 Q;  4LFC Q;  1I94 L;  2PQA A;  2UUB Q;  1RIP A;  3CW2 C;  3AFP A;  4IFD J;  1WFQ A;  3TRE A;  1M90 C;  2UUC L;  4DR7 Q;  3CCM A;  2VNU D;  4RMF A;  3HOY H;  3S24 A;  3CF5 A;  1EIY B;  2VUM G;  2JA7 G;  1K0R A;  4GN4 B;  4BY1 H;  1P8L A;  1V1Q A;  2KHJ A;  1IBK Q;  4PZ7 A;  4PZ6 A;  2K5V A;  4IO9 A;  2E2J H;  3K80 C;  2PNH A;  4UP9 A;  3CCJ A;  1G29 1;  4XTC S;  4GKJ Q;  1L1O A;  1LM0 A;  3M7N A;  3F8T A;  4LFB Q;  1GKH A;  4LF9 L;  1Q8K A;  4DR3 L;  2YYZ A;  1HNZ Q;  2R7F A;  4B3T Q;  2IY5 B;  2D0O A;  1C9O A;  4X6A H;  5JEA J;  4QGU A;  4B3R Q;  1KD1 C;  1FVI A;  1VQD A;  3CD6 A;  3I56 A;  2UUA L;  1IBL Q;  4C3H H;  2NVY H;  1CSP A;  4DUY L;  4LFA L;  4APV A;  2NN6 I;  1VQH A;  2GN5 A;  4DR4 L;  1I6H H;  4BY1 G;  3FHW A;  3KDF B;  2OCE A;  4JI1 L;  4GLA C;  3PF5 A;  3FKI H;  2ID0 A;  1TXY A;  3PGZ A;  3KJO A;  2MO1 A;  2Q2T A;  4JI7 Q;  1X9N A;  3M3Y H;  4LUO A;  4JI8 Q;  1HZ9 A;  3PO2 H;  2QA4 A;  4LUZ A;  1E3P A;  2UU9 L;  1E22 A;  2V1C C;  4X64 Q;  1KQS A;  4R1J A;  4JYA L;  1VQO A;  1J6Q A;  2ES2 A;  4X66 L;  3A5U A;  3HOV H;  3EN2 A;  1HR0 W;  1H95 A;  1P16 A;  3HFZ B;  4GNX C;  3F2C A;  3CC7 A;  1VQG A;  1S72 A;  2IT1 A;  4HID A;  4X65 L;  1IZ6 A;  4A3I H;  1QVG A;  2JA8 H;  1OXX K;  3FKI G;  2XGT A;  4B3S L;  2YTX A;  3H3V H;  4JBW A;  1VQM A;  1I3Q H;  3RZO H;  4KHP L;  4L5T A;  2K52 A;  1CKN A;  1TWF H;  2CKZ B;  1AH9 A;  4ALP A;  1OXS C;  2R92 H;  2E5L Q;  3S2D H;  3GTG H;  1W3S A;  4GOP C;  4L5R C;  1FJG Q;  1O7I A;  2N3S A;  1BVS A;  1DGS A;  3D0F A;  4PG3 A;  5J3B A;  3CMA A;  4B3M Q;  3HOV G;  1MKH A;  2F52 A;  4QQB X;  2FXQ A;  1K9M C;  1QUQ B;  1SMX A;  2UXC Q;  1HZB A;  4JI0 L;  3SGI A;  1SE8 A;  3HOW H;  3J81 j;  2R7Z H;  4A3E H;  3CCS A;  4A3I G;  5GQO A;  3RNU A;  2KEN A;  5BR8 Q;  2R7D A;  2JA8 G;  3S1M H;  2VL6 A;  1EQQ A;  4BXX H;  1PFS A;  3BJU A;  1PHJ A;  2VW9 A;  4OON A;  2E8G A;  4DV2 Q;  1QZG A;  1PH6 A;  3OTO L;  1X55 A;  4JOI C;  3GTQ H;  2VQF L;  1HR0 Q;  4YY3 Q;  2DGY A;  4P72 A;  2YTY A;  3JAM i;  4UP7 A;  3RN5 A;  2ASB A;  1MJC A;  1N9W A;  3CXC A;  1W2B A;  2WB1 E;  2JQO A;  4AQY Q;  1PH8 A;  4R4I A;  2WAQ E;  5IP7 G;  1YIT A;  4C2M H;  4IFD I;  2UXD L;  5IWA L;  4UPA A;  1VQ4 A;  3PCO B;  4JI4 Q;  2Y0S G;  4JC0 A;  1GO3 E;  1X6O A;  2UUC Q;  4AYB E;  5IE8 A;  2JA5 H;  4OX9 Q;  2R7Z G;  3CPF A;  4AYB G;  3AQQ A;  1VQE A;  2GVB A;  4JCV E;  4NPS A;  4LF4 Q;  3A74 A;  3GTL H;  1I50 H;  1N33 L;  3EBE A;  2K5N A;  2NVQ H;  5C4J H;  1OTC A;  3CPW A;  1TWH H;  5IT9 c;  5H1S E;  4X62 Q;  4IJL A;  3ICE A;  3UDX A;  4JI2 L;  1HH2 P;  2Z6K C;  2NZH A;  3PO3 H;  4Y52 H;  1X3F A;  4LF9 Q;  3W1B A;  4KHZ A;  4R4C A;  1K73 C;  1XNR L;  5JJK A;  3FP9 A;  2K4K A;  3K81 C;  1HNX Q;  4O0A A;  3RLF A;  4JI6 Q;  1LUZ A;  3K8A A;  1IBM Q;  4DKA C;  4DV3 L;  1N36 L;  4IOC A;  3KF6 A;  2ZM6 L;  2YTV A;  1PV4 A;  1NY4 A;  2JA5 G;  1TWG H;  4NXM L;  4QL5 A;  2NVT H;  2IHE A;  1B7Y B;  5M3M G;  5M5W H;  4DK3 C;  2K5H A;  3CCV A;  1KRS A;  4YWK A;  1PH9 A;  2AMC B;  4K0K L;  3PO3 G;  1IXR A;  5JEA G;  1JB7 A;  4DV0 Q;  1QZH A;  3S15 H;  4P73 A;  3NEM A;  1EIF A;  1GD7 A;  1WI5 A;  4DV7 L;  3KFU A;  4A3M H;  1NJI C;  1E1O A;  2RF4 A;  2VZA A;  3CP0 A;  3HOU G;  2D0P A;  4POF A;  1YHB A;  1EOV A;  5FLM H;  3U4V A;  4YWL A;  3GTJ H;  4DV5 Q;  1XMQ Q;  1I5F A;  1Z47 A;  4LWC A;  4IJH A;  2E2I H;  5LMN L;  2WP8 J;  3MXN B;  1X65 A;  2A19 A;  3NBH B;  4DV6 L;  2NVX H;  1CKM A;  3TS0 A;  1L1O C;  1VQL A;  1HNW Q;  3PUW A;  1PH5 A;  4LF8 L;  1EUJ A;  1QVC A;  1BKB A;  4P74 A;  2CCZ A;  4A3J G;  1UE7 A;  2EIF A;  4P75 A;  4HJ9 A;  3CC4 A;  1VQI A;  2IX0 A;  2A8V A;  1JE5 A;  4DPG A;  2PQA B;  4JG2 A;  3F2D A;  4YHH Q;  1YEZ A;  4DUZ L;  4OO1 G;  1YI2 A;  2C35 B;  3TEH B;  4DV4 L;  5IYD G;  1KC8 C;  4A3M G;  2CWP A;  2KCT A;  3T1Y L;  1ASZ A;  1Y1W G;  4A3F H;  5FLM G;  2IX1 A;  2AKW B;  1J5E Q;  1N34 L;  4NXN L;  1VQN A;  1EWI A;  2ZJR A;  1L1O B;  1KHI A;  3H0G H;  4DR1 Q;  1XNQ L;  2JA6 G;  1OXT A;  2JEA I;  3S17 H;  1SRO A;  1E7Z A;  2B29 A;  2Q2U A;  3U50 C;  3L7Z C;  2DUD A;  1TWC H;  4HJ5 A;  2JE6 I;  1NMG A;  4PZ8 A;  1EYG A;  2VQF Q;  4DR6 L;  4L5Q A;  4R4Q A;  2ZTC A;  4DR2 L;  1BBU A;  3M4Q A;  1S3O A;  2MO0 A;  4LF5 L;  1G51 A;  1MIU A;  2PMZ E;  4A3F G;  2NN6 G;  3J80 i;  1E24 A;  4O2D A;  4JI3 Q;  3CC2 A;  1YBY A;  1VQ7 A;  2I5M X;  3E0E A;  1A8V A;  4IPC A;  3ULP A;  4GN5 A;  3JC6 6;  4A4I A;  4P71 A;  4JI5 L;  3RR5 A;  3H0G G;  1XMO L;  3M4O H;  3T1H L;  2VQE Q;  5C4X H;  3HKZ E;  5IYB G;  3BU2 A;  3G6E A;  1Q82 C;  4DR4 Q;  1N33 Q;  1L0W A;  1B8A A;  1VQF A;  1YJ9 A;  4LF7 L;  5IY0 A;  2LXJ A;  4DV1 L;  4LFC L;  2UUB L;  2YU9 H;  4DR7 L;  5AJ3 Q;  2R93 G;  2ZTE A;  2ATW A;  1B70 B;  4UP8 A;  5IP7 H;  2OWO A;  1VS0 A;  1NBW A;  4DR5 Q;  3JAM c;  3RLO A;  1VQ6 A;  1PH4 A;  2HHH Q;  3K7A H;  1IBK L;  4GNX A;  2F4V L;  4YCW A;  1NMF A;  1CKN B;  2B3G A;  1QVF A;  4GKJ L;  4NXM Q;  3B6Y A;  2ZJQ A;  4OWW B;  4LFB L;  2IHF A;  1K8G A;  3RLN A;  1HNZ L;  5C4X G;  4B3T L;  4JV5 Q;  5DLQ E;  2I5H A;  4B3R L;  3STB C;  3PIP A;  1N8R C;  2H5X A;  2K50 A;  2ZTD A;  1WCM H;  4LF6 Q;  1WJJ A;  1Z9F A;  3UE1 A;  5LMU Q;  2PI2 E;  4IOA A;  1MJE A;  1IBL L;  2N49 A;  2OTJ A;  4EX5 A;  1UE1 A;  1AE3 A;  2MFI A;  2WB1 G;  2MNA A;  4GOP A;  4OWX B;  1G6P A;  2WAQ G;  4IPH A;  4KI0 A;  1I94 Q;  1KXL A;  2LSS A;  1CSQ A;  1PYS B;  4GS3 A;  4KLK A;  1JJ2 A;  2VS1 A;  3CAM A;  4UY8 C;  4JI7 L;  3AEV A;  2I0Q A;  1YZ6 A;  5M3F H;  3PF4 A;  3MEF A;  5M3M H;  4BBR H;  2E2H H;  4BY7 H;  4A3B G;  4AH6 A;  3ER0 A;  2K14 A;  3HOX H;  2AWN A;  3EIV A;  3J81 c;  3KJP A;  5M5Y H;  4GLV B;  3CCR A;  3I4N H;  4GKK L;  1WCM G;  1PA6 A;  4DR3 Q;  4JOI A;  3S1R H;  4IFD G;  4PMW A;  3STB D;  1Q1B A;  3I2Z A;  5IP9 H;  3HOU H;  4QY7 A;  1FGU A;  3UDI A;  3GO5 A;  5GAE C;  3DM3 A;  5C44 G;  2UUA Q;  4MTN A;  5GAH C;  3TS2 A;  1X3E A;  3D31 A;  2OTL A;  2HIX A;  4LFA Q;  4DUY Q;  4A3G H;  1VCI A;  3GTM H;  5M3F G;  3J81 i;  1K83 H;  4A3L H;  3CQZ H;  3E9H A;  1KRT A;  4JI1 Q;  4BBR G;  4A3K H;  4JBM A;  3J7A 5;  4A3J H;  3RZD H;  4BY7 G;  2XTI A;  2E5L L;  4BA2 I;  1XPR A;  5C3E G;  4YCU A;  4HIK A;  4R4T A;  3HOX G;  1FJG L;  4RG1 A;  3I4O A;  4B3M L;  3I4N G;  2Z6K A;  2UU9 Q;  2VY3 A;  4JYA Q;  3HKS A;  5IYD H;  2UXC L;  1KIX A;  3KF6 B;  4IPG A;  2OQK A;  1Y1W H;  5IP9 G;  4BBS H;  4X66 Q;  4GLX A;  3L0O A;  1VQJ A;  2WFW A;  3ERS X;  1S40 A;  1V9P A;  5BR8 L;  3UDG A;  3S1Q H;  1SLJ A;  1PYB A;  3BZK A;  2JJQ A;  3U58 A;  3S1N H;  4A3G G;  4X65 Q;  1JJC B;  1RL2 A;  2JA6 H;  2B63 H;  4A3L G;  1PH3 A;  4A3K G;  4C3J H;  3L2P A;  1HR0 L;  1U5K A;  4YY3 L;  3PUY A;  1ASY A;  1YVC A;  4B3S Q;  1OXV A;  3S16 H;  5GRO A;  4A3D G;  4KHP Q;  3A0J A;  1X56 A;  4HJA A;  3DLL A;  1UEB A;  3J7Z C;  5ELN A;  1Y14 B;  1JMC A;  1Y1V H;  4DAM A;  1KAW A;  4JI4 L;  3RN2 A;  3ZJY C;  4OX9 L;  4QIW E;  1N34 Q;  3KLW A;  3PSI A;  4J15 A;  3VDY A;  1PH1 A;  4BBS G;  1V43 A;  4LF4 L;  2NZO A;  4MNO A;  5C0X J;  4JI0 Q;  1VQ5 A;  2A1A A;  3J80 c;  2F4V Q;  1LTL A;  1Q12 A;  1T9H A;  3W5O A;  4X62 L;  1YHA A;  3CCQ A;  2B63 G;  5IYB H;  1UWV A;  3KDF A;  3PV0 A;  3M85 A;  2Q2H A;  1YJW A;  3K7U C;  2UXB L;  2YV5 A;  3KYH C;  1UE6 A;  1LYL A;  2ALY B;  2R6G A;  2BH2 A;  4HIM A;  4NXN Q;  3OTO Q;  4GN3 B;  2CFM A;  1HNX L;  2CQO A;  2R93 H;  3S2H H;  1A0I A;  4A75 A;  2AWO A;  4JI6 L;  1IBM L;  1Y1V G;  1VQK A;  2L15 A;  3WWV A;  4R4O A;  1VQA A;  1Q7Y C;  3ULJ A;  3HOY G;  2BH8 A;  5IWA Q;  2UXD Q;  3NEN A;  4XIG S;  1PVO A;  4Y7N H;  4HJ8 A;  4TVA B;  4EQ5 A;  1C0A A;  3I4M H;  3KF8 B;  1XPO A;  3UE0 A;  4DV0 L;  1K8A C;  4A93 H;  2BA0 A;  4C3I H;  3HKZ G;  2GVA A;  2EXD A;  2QEX A;  5LMN W;  1N32 L;  3TQY A;  2I5L X;  4JI2 Q;  1SN8 A;  1K3R A;  1XMQ L;  4AIM A;  4DV5 L;  4GKK Q;  1YHQ A;  1XNR Q;  5JJI A;  1SFO H;  1VQ8 A;  2RCN A;  1KL9 A;  5EAY A;  1R9T H;  3TRZ A;  5HGQ A;  5ELO A;  1CKO A;  1BBW A;  2KHI A;  1HNW L;  1HZC A;  1QUQ A;  4JBK A;  1N36 Q;  4DV3 Q;  2ZM6 Q;  1VQC A;  2KBN A;  4FDB A;  3GDE A;  4NB3 A;  4OWT B;  4DAY B;  4LUV A;  1Q46 A;  3I4M G;  4A3B H;  3H3V I;  2HIV A;  3PO2 G;  4A93 G;  3AFQ A;  4YHH L;  1FL0 A;  1JJG A;  3I55 A;  4K0K Q;  1U0L A;  2HT1 A;  1X3G A;  5JJL A;  2QGQ A;  3U4Z A;  4A76 A;  1UE5 A;  1OXU A;  3OYY A;  1YJN A;  3OW2 A;  2EQS A;  1J5E L;  3PIO A;  4DV7 Q;  4GNX B;  1D8L A;  1HJP A;  2K75 A;  1XPU A;  3GTK H;  2N8N A;  5C44 H;  3PUV A;  1D7Q A;  3E9I A;  4HJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...