2MO1A

Backbone 1h, 13c, and 15n chemical shift assignments for cold shock protein, tacsp with dt7
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFTAIEADGFRTLNEGEHVEFEVEPGRGGKGPQAKKVRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and flexibility of the thermophilic cold-shock protein of Thermus aquaticus
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
molecule keywords Cold-shock DNA-binding domain protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2mo1A00
1QVFA 3UDFA 3KLWA 4A3CH 3EN2A 4HJ5A 2N8NA 4BY7H 4JI3Q 4LWCA 4AQYQ 2K75A 2R7DA 4DR5Q 5M3MH 1XPRA 4APVA 4A3KH 2BA0A 4JI0Q 4JI2Q 2I5HA 3CW2C 4A3IH 1JMCA 1K83H 2EIFA 2HHHL 4NXNQ 1Q1BA 1HZBA 1PH3A 2B3GA 2Q2HA 3H3VI 1C9OA 2HIVA 1BBWA 2JA7H 3KFUA 1VQ9A 1Q8KA 2YV5A 2JA7G 1VQKA 2ZJRA 4C3JH 3ULLA 2NVYH 1IBLQ 2Q2IA 3BJUA 4R4CA 3T1HL 1GO3E 2JA5H 3I4OA 4DV1L 4JI8L 4H02A 5C3EH 3PGZA 5C3EG 3NBHB 3GTOH 2AWOA 1KQSA 1YJNA 1O7IA 1HR0Q 4JI1Q 1RIPA 2OQKA 4DV7Q 1MJEA 1XMQQ 2MO1A 4X65Q 1VQMA 1G291 1YJWA 4LF6L 2ATWA 3RLFA 3U58A 1CSPA 1TWCH 4DUYL 1TXYA 1P16A 4DV4L 1TWFH 1VQHA 4R4TA 4LNQA 3A0JA 3CC2A 5GAGC 2L15A 1KXLA 4JV5Q 2E8GA 2Z0SA 3OYYA 4A3DG 5ELNA 1FJGQ 3PO3H 1R9TH 3K81C 3GTPH 3NENA 2A1AA 5JJLA 4DR3Q 5IYCG 1Y14B 2QGQA 1X3EA 2ZTDA 4LFAQ 4JYAL 4FDBA 2IY5B 4DUZL 4L5SA 4RMFA 2F4VQ 5JEAG 4KHPL 1N9WA 2CFMA 2CWAA 4BY1G 1Z9FA 5C44H 3E9IA 5AJ3L 4POFA 1VQ7A 4JI5Q 2Q2UA 4O0AA 4DR1Q 3CMAA 4JI6L 3HOVG 4XIGS 1IZ6A 5IT9c 4BY7G 1SN8A 1A63A 1QZGA 4UY8C 1JJGA 3PUVA 3WWVA 1GKHA 4AYBE 1YI2A 1W2BA 1HZ9A 3PO2H 1L1OA 1N36L 1AE3A 1K73C 5EAYA 3U50C 1YITA 3CP0A 4A3LH 5C4JH 4GOPC 1YHQA 4YWMA 1IL2A 4YWKA 2B63G 1YHAA 1UE7A 1SLJA 1PH6A 1VQJA 1QUQA 5IP9H 3W1BA 1CKNA 4C3HH 2PQAA 1HZAA 5IWAL 2JA5G 2DGYA 1LUZA 1HNZL 4GN4B 1AE2A 2D0OA 3OW2A 2VQFQ 3AQQA 1TWGH 2WFWA 4LF7Q 3M9BA 2MFIA 3FHWA 5GROA 1X54A 4IPGA 1T9HA 4A3EG 2BH2A 2K14A 2MQHA 4LF8L 4UP7A 3PIPA 1PHJA 3I4NH 1BBUA 3U4ZA 4LF9Q 2JA6G 2HT1A 1YJ9A 2JA6H 3J80c 3M7NA 1J6QA 1NY4A 2UU9L 1HZCA 1N36Q 2LXJA 3CCQA 4JG2A 3JAMc 4GNXC 3AYHB 2R93G 1YBYA 2UUAQ 4YCWA 4DR2Q 4JI4Q 3PO3G 1OXXK 1WOCA 3PUZA 2IHFA 5C0XJ 3H0GG 4R1JA 2ZJPA 5IYDG 4LFBQ 4WJ4A 3UDXA 2KHJA 3I2ZA 4YHHL 3UE1A 1IBKL 5AJ3Q 4BBRH 1P8LA 1PVOA 3J7ZC 1K8GA 2LXKA 1DGSA 3J81i 1HR0W 2F3IA 3J7A5 4OO1I 1L0WA 2F4VL 4MTNA 3HOUH 1VS0A 4UP8A 1OXSC 4JYAQ 3PCOB 4LFAL 3CCJA 2YU9H 2K50A 4DR3L 4GLAC 2E2JH 2E5LL 1FJGL 2IX0A 1YIJA 1BVSA 1C7YA 4POGA 1NTGA 2BH8A 3HOWG 2JK8A 1NE3A 4JV5L 3PO2G 2JE6I 2VUMH 2I5MX 1PH9A 2KHIA 2UXDL 3AFQA 5BR8Q 4GKJL 1CSQA 4A3IG 2AHOB 2UXBL 1G51A 4DUYQ 3HOXG 3UDIA 4EQ5A 5HY6A 1K9MC 1E7ZA 1UE6A 3GD7A 1VQEA 2PMZE 3HOXH 1QZHA 2Y0SG 5ELOA 2JA8H 4LF6Q 2NZHA 4JOIC 4X65L 1CKNB 1XMQL 2PQAB 3BU2A 1MIUA 3I4MH 2D0PA 1HR0L 4QQBX 3AFPA 5FJ8H 1K3RA 1V9PA 1FVIA 4QJFA 3CCVA 2C35B 1PH4A 2R7ZG 2GVBA 4P72A 4JI8Q 1VQOA 4DR4L 4HIDA 4HJ9A 3MEFA 4A3JG 2RF4A 1QVCA 3GTJH 1CKOA 3I56A 5LMUL 4DV2Q 3T1HQ 2ZTEA 5GAEC 1HNWL 2CQOA 1IBLL 1L1OB 2OTLA 1UEBA 2ALYB 1WCMG 2BA1A 3F1ZA 4A3EH 4HJ8A 2WB1E 2A19A 4MZ9A 3PF5A 2NVTH 3D31A 2OQ0A 3PF4A 4NXNL 1NMFA 1EQRA 3BZCA 4PZ6A 3H3VH 3T1YL 2UXCQ 1FGUA 3KDFA 2WP8J 3ICEA 4OX9L 3M85A 4AQYL 2R93H 4AH6A 4DAMA 4IJHA 1Y1VH 4A3DH 2WAQE 4LFCQ 1QVGA 2EXDA 1JJCB 1S72A 1SROA 4O2DA 4JBMA 1G6PA 4LUOA 4X64L 4A93G 4A76A 2YTXA 1N34Q 1XJVA 1SFOH 4NPSA 2EQSA 3NEMA 1TWAH 1MJCA 3JC66 3W5OA 1XNRL 2R6GA 3HFZB 1I3QH 4DK3C 4DPGA 2RCNA 1PH1A 4HJ7A 2OTJA 3TREA 1VQIA 1X6OA 4EX5A 1QUQB 3KYHC 1KC8C 4A3FG 4GOPA 4GKKL 4X62L 2NN6I 4DV0L 4A3BG 1EWIA 3NELA 5LMNW 3K8AA 4DV0Q 3ULJA 1D8LA 2OCEA 1E1TA 5GQOA 2ZTCA 4JCVE 4X62Q 4GKKQ 1GD7A 4A3GH 4R4OA 1LM0A 1EIFA 4A3GG 3RNUA 1KL9A 1NBWA 2Z6KC 1JB7A 4A3LG 2JA8G 1XNRQ 1HNXQ 1PYBA 1OTCA 1XPOA 1PYSB 4IO9A 1VQBA 2B63H 4KI0A 3TS0A 1V1QA 1YHBA 1N34L 1EUJA 4JI7Q 3KF8B 2Z6KA 5HGQA 2N3SA 3I4MG 1HH2P 3S1RH 4OWWB 1JJ2A 4LFCL 4TVAB 5C0XI 1SR3A 3S1NH 1A8VA 1XNQQ 4P71A 5LMNL 1L1OC 1W3SA 1WFQA 5GADC 4JBWA 4KLKA 1GVPA 4OX9Q 1PH7A 1VQGA 1XPUA 1NJIC 1N32Q 1PFSA 3CMEA 3T1YQ 1JE5A 3PSIA 4B3SQ 4DR6L 2UXCL 4DV5L 2GVAA 3HOZG 4B3RQ 4YY3L 3HOZH 4QIWE 3CF5A 2VY3A 3IRBA 1CUKA 4JC0A 2IX1A 1VQ4A 2A8VA 2FXQA 1HNWQ 3ZJYC 1FL0A 3M4QA 4IFDI 1BKBA 4IPHA 1I50H 3CCRA 3HKZG 5LMUQ 4DV2L 4GLXA 3DM3A 2JQOA 5M3MG 3ERSX 5C0XG 1WYDA 4DR4Q 2VL6A 3PIOA 1C0AA 3MXNB 1VQPA 4B3TL 2UUBL 2HIXA 3CQZH 4TQUS 4DNIA 3S15H 4A93H 3K80C 4GN3B 5IYCH 4BBRG 1J5EL 2IHEA 4UPAA 4LUZA 4HIKA 1EQQA 3F2BA 1L2FA 1Q82C 1XMOQ 4LF4Q 4GOPB 2UXBQ 1TWHH 4QGUA 5BR8L 1Q81C 4GKJQ 2UXDQ 5M5YH 2KENA 4XTCS 1LTLA 4BA2I 3A74A 1U5KA 2Y0SE 3CPFA 3STBD 3CC7A 4P74A 4R4IA 1Z47A 4PZ7A 2JJQA 4A4IA 4LW1A 2E5LQ 3HOYH 3PUXA 3W1GA 2K52A 3HOYG 3KJOA 1SRUA 3RN5A 3J81c 2NVXH 5FLXc 1VCIA 3GTLH 3GTMH 4IOAA 2K5NA 4DV3Q 3GO5A 4NXMQ 1IYJB 1RL2A 1EOVA 1IBML 1N33L 3EBEA 5C4XH 3G71A 4B3ML 4Y7NH 3J81j 2UUCQ 4AIMA 1EFWA 4YCVA 1A0IA 4X66L 4YHHQ 2VQEQ 1B70B 4IOCA 4P73A 1IBKQ 2N78A 3ER0A 4LFBL 3GTQH 2PI2E 2XTIA 3D0FA 3GDEA 4PZ8A 5IP9G 4OWTB 4DR2L 1K8AC 1M90C 1YNXA 2UUAL 4QY7A 4JI4L 2VW9A 2ASBA 4OWXB 5M5XH 1SMXA 4J15A 1X3GA 3RLNA 4DKAC 3L2PA 2RHSB 1ASZA 2UU9Q 1IXRA 4A3MG 1VQLA 2WAQG 3RN2A 4NB3A 3CXCA 3G4SA 3BZKA 4LF9L 4LF8Q 2I5LX 2K5VA 2VZAA 2I0QA 1A62A 2JEBI 2ZM6Q 4K0KL 1I94L 5JJKA 4LF7L 1VQ8A 1PA6A 3OTOQ 5H1SE 4DV6Q 3HOVH 4ME3A 3TQYA 3TS2A 2VQFL 4LF5L 2R92H 4BXXG 1CKMA 1HNZQ 3S2HH 2H5XA 2YYZA 2LSSA 4PMWA 2R92G 4BXXH 1I6HH 4IPDA 5IWAQ 1N8RC 4LF5Q 1Y1VG 3F8TA 2IT1A 4DV6L 3OTOL 1JT8A 4GS3A 4UP9A 1M1KC 1VQFA 2PNHA 3M4PA 3H15A 1I94Q 4YCUA 3CC4A 2ZM6L 2XGTA 4C2MH 1WJJA 4WJ3M 2ZJQA 1S3OA 3RZDH 3CCEA 2DUDA 5IP7G 4IFDG 5IP7H 1U0LA 1X9NA 2F52A 1VQ6A 3STBC 3CAMA 2JA9A 5JEAJ 3G6EA 4A75A 3S14H 3E0EA 4X6AH 1X3FA 3CD6A 3M4OH 2MNAA 4GNXA 4A3FH 1Y1WH 5IYBG 3M3YH 4A3BH 1Y1WG 4JI6Q 3PUYA 1MKHA 2N49A 4DR1L 3HOWH 2QEXA 4ALPA 2D62A 3FKIG 4AYBG 4OXPA 1WI5A 3CCUA 3EIVA 1UE1A 3FKIH 4JI5L 4X66Q 2VQEL 3TRZA 4BBSH 2UUCL 4L5RC 1SE8A 4DK6C 3S16H 4HJAA 3KF6A 3I4NG 4BBSG 1H95A 2AMCB 3K7UC 4B3MQ 5IE8A 4KHPQ 5GAHC 1IBMQ 1N33Q 1AH9A 1HJPA 3RR5A 4DUZQ 4DV3L 4NXML 3TEHB 2ID0A 1KAWA 3RZOH 1Q12A 1YZ6A 3K7AH 5K36G 3S2DH 5FLMH 2CKZB 5FLMG 3G48A 1YEZA 5JJIA 3RLOA 3CCMA 1KHIA 4C3IH 4HIMA 2OWOA 4OONA 5E7NA 4GNXB 3UE0A 1B8AA 3H0GH 2KCMA 1EIYB 2B29A 2R7ZH 1E24A 2AKWB 3AEVA 1UE5A 4OO1G 4PG3A 1KD1C 5M3FH 4DV4Q 3S17H 1NMGA 1Q1EA 3LGJA 5M3FG 4A3MH 1PH5A 1K0RA 4LUVA 1VQDA 1LYLA 3HOUG 1XMOL 4L5QA 4LF4L 4IFDJ 4IPCA 3J80i 1X56A 3UDGA 3SGIA 1OXVA 4QL5A 2NN6G 2JEAI 2AWNA 5C44G 5J3BA 2K5HA 1J5EQ 4JBKA 1OXTA 4DV7L 4IJLA 4JI1L 4RG1A 4YWLA 3JAMi 5IY0A 3HKZE 2UUBQ 4B3TQ 3F2DA 3A5UA 4A3CG 3CCSA 4DV1Q 1X55A 2NVQH 1Q7YC 2VUMG 2WB1G 3I7FA 3Q8DA 4A3KG 4GLVB 4HIOA 1KRTA 1VQNA 4BA1I 1Q86C 3KOJA 3B6YA 3ULPA 3K0XA 2VNUD 4YY3Q 3A5ZB 3CPWA 4B3RL 1I5FA 1VQAA 4DV5Q 3S1MH 4DR6Q 1VQCA 4B3SL 4MNOA 5FJ8G 3VDYA 2HQLA 2HHHQ 1N32L 2YTVA 2CWPA 3S24A 4JI2L 2R7FA 2KBNA 4JI0L 1KRSA 4A3JH 1YVCA 4DR5L 3L0OA 2YTYA 5LMNQ 4JI3L 1X65A 5IYBH 1XNQL 2V1CC 3GTGH 5M5WH 2MO0A 1PV4A 1WCMH 4DAYB 2GN5A 2K4KA 2VS1A 4DR7L 3PUWA 4KHZA 1S40A 1KIXA 4JI7L 2E2HH 4K0KQ 2ES2A 4R4QA 4JBJA 2QA4A 1V43A 2NZOA 1VQ5A 3PV0A 1HNXL 4Y52H 3I55A 1B7YB 4L5TA 5C4XG 1OXUA 3GTKH 4GN5A 4P75A 3U4VA 1XTDA 1Q46A 3E9HA 1PH2A 3KJPA 2Q2TA 3S1QH 1PH8A 1E3PA 1D7QA 2KCTA 2E2IH 5IYDH 3HKSA 1E22A 1ASYA 3F2CA 3L7ZC 2RHQB 3DLLA 1UWVA 3KF6B 1E1OA 5DLQE 1GM5A 2CCZA 3KDFB 1EYGA 3CCLA 4BY1H 4DR7Q 2PI2A 4JOIA 3FP9A 4X64Q
chains in the Genus database with same CATH superfamily
3BYTB 1MI2A 3KLWA 3GTGB 3EN2A 1IYVA 4LWCA 2K75A 1XPRA 4APVA 3KBXA 4J1MA 4JI2Q 2I5HA 2J4XA 1SNDA 2RBMA 1PH3A 2Q2HA 4DXGA 1BBWA 1F9RA 2RKSA 2NUCA 1CZWA 5KIXA 4C3JH 3J80E 5BN3A 2RA4A 5D3DA 2HDLA 2O4XA 3VYUA 4DV1L 4JI8L 4H02A 1KQSA 3K5OA 2K5WA 4FNFA 1O7IA 4RFBA 2K6AA 2ZT9C 3A8JE 1SE4A 1D1KA 1CSPA 1TWCH 2KCCA 4HSPA 1P16A 1ML0D 4N9TA 1JWUD 3CC2A 3AU7A 1A3VA 3TP8A 2A69C 3M7GA 1FJGQ 2K5QA 3K81C 3Q0AA 1ENCA 1I4HA 1B3QA 3RMHA 1KDAA 3WDNA 3NWTA 1AW7A 3E9IA 1VQ7A 4ZLTF 2A6EC 3CMAA 4JI6L 4XIGS 3HOWB 1GUOA 1JJGA 3BVGA 1SE2A 1LV9A 1GKHA 3NWSA 1HZ9A 1CZGA 4XYOA 1AE3A 1BCPD 5EAYA 1CHPD 5C4JH 1HXYD 1YHQA 2BDNA 1DD2A 1IL2A 1BUVT 1JOQA 5KYIA 1UE7A 5EJWA 1DCZA 1FNVA 1PH6A 1VQJA 1QUQA 2X69A 2I46A 2WACA 3J7AV 1HZAA 4I7AA 5IWAL 1JWMD 2DGYA 1AE2A 1STYA 5HGTA 3AQQA 1BXTA 1SEBD 4LF7Q 1SYGA 3FHWA 2AQ2B 3TDQA 4X64Q 1BBUA 3U4ZA 3PIPA 1PHJA 4LF9Q 1NNXA 2HT1A 5E4XA 2JA6H 4C56C 2B2UA 1HZCA 3E0JA 4KMUC 3TBIB 2B2VC 4JG2A 2PZUA 3AYHB 4DU9A 1JB3A 4YCWA 3D6CA 1EOTA 2IHFA 4R1JA 2E2HB 3UDXA 5I6WA 3UE1A 1F2LA 4LJZC 1S5ED 3MXGA 2WKDA 1EY5A 1HR0W 2F4VL 4MTNA 5JEAH 3HOUH 3PCOB 2NYZD 3GQBA 2K50A 4DR3L 1AEXA 4JVZA 1PZID 1FD7D 1EY9A 1YIJA 1BVSA 1BDOA 1C7YA 3BS1A 1NE3A 4JV5L 1J8IA 2JE6I 1EY6A 1WTXA 5BR8Q 4GKJL 1G51A 3BDCA 1WD1A 1K9MC 3GD7A 1NCVA 2Y0SG 4ME5A 1RCVD 2B2TA 4LF6Q 4JOIC 1HQRD 1BR9A 3PIP3 1FVIA 2F3WA 2PW7A 4P72A 3FEWX 2RF4A 1DOKA 1QVCA 3D3RA 5FLXL 3GTJH 3HOXB 5LMUL 4DV2Q 4E6IA 4ODGA 2ZTEA 5GAEC 3VYTA 4C3JB 1WCMG 3F1ZA 4A3EH 3GV6A 2Z6BA 3PF5A 2EVBA 3LWEA 3PF4A 4K5VA 1EQRA 4PZ6A 2UXCQ 4LAAA 1EZ8A 2NWGA 1FGUA 2EY6A 4QF4A 4CKEA 3ICEA 1V1PA 1TKWB 1TY2A 4ZUJA 5TSSA 4IJHA 1QVGA 2EXDA 1SROA 3HZXA 4JBMA 4LUOA 2VXWA 2YTXA 4K5XA 5CBAE 1SFOH 4NPSA 1LTGD 1MJCA 2R6GA 1I3QH 4DK3C 3QO2A 2EZVA 1EZ6A 1FNUA 4O42A 1EL0A 5CV9A 1EWIA 3K8AA 4DV0Q 4N9PA 5I9PA 4A3GH 4HCEA 4R4OA 3RNUA 3DHQA 4ZRZA 4B08A 2DY8A 1XNRQ 1PYSB 1EYDA 4IO9A 4KKSA 1Y8NB 1PTOF 1V1QA 1EUJA 3RD4A 2KEEA 2Z6KA 1G91A 4LFCL 1SR3A 1ZEQX 3BDLA 1M8AA 2WB1B 5LMNL 1W3SA 4A3JB 4KLKA 1RODA 1VQGA 4BBRB 1NJIC 3T1YQ 3HP3A 1LT4D 4QCLA 4DR6L 1QNKA 1EY0A 1BO0A 2GVAA 4HSVA 4B3RQ 4YY3L 1V1PB 4XQJA 1NUCA 1CUKA 4H13C 2A8VA 3DWPA 2Q8RE 4IPHA 1EEID 3I8ZA 3HKZG 2RCFA 1GHKA 3DM3A 2JQOA 5M3MG 2PZWA 1JWSD 3BZDB 5C0XG 4DR4Q 2NVQB 3PIOA 2HIXA 3CQZH 5G3LD 4R8IA 3K80C 4FXGC 4ZCKA 3FPPA 1AN8A 4R8NA 1Q82C 1PZKD 5DAUA 1B9NA 2FMCA 4QGUA 1TWFB 2ENBA 4Q5VA 1LTLA 2Y0SE 3STBD 3CPFA 1PDQA 4PZ7A 1EIGA 1ONLA 4A4IA 4LW1A 1CFMA 3PUXA 1U9RA 3W1GA 1KDCA 2WIIB 1BCPC 3J81c 1SJED 2K5NA 3GO5A 1SMYC 4B3ML 3J81j 2PO4A 5EKLA 5CGKA 1PYWD 1IBKQ 3U9SA 3GTQH 4X3SA 4JI4L 3SHLA 2UUAL 2PQEA 5I4DA 1Q8IA 3A7AB 2RHSB 1H9KA 1VQLA 1WTVA 4DK0A 3S1MB 3CXCA 3BZKA 2QF7A 4LF8Q 1S5CD 2I5LX 2FINB 3L9AX 4BS9A 3TS2A 3OTOQ 5H1SE 3TQYA 1QG7A 3TN2A 2R92H 4BXXG 4PMWA 3VR2A 3NQIA 1FYCA 2BOSA 3OTOL 4GS3A 1JT8A 1VQFA 2D2CC 2K04A 4YCUA 2DN8A 5ELEA 3EQLC 4C2MH 1A15A 4DAPA 2ZJQA 4WJ3M 3CCEA 5IP7G 4IFDG 4FF2A 1HPCA 3CAMA 5JEAJ 3G6EA 4GNXA 5IYBG 4KD4A 4MHEA 4A3BH 2EY1A 1Y8OB 4H44C 2N49A 2ZXPA 4BBSH 1XX8A 4L5RC 1J9OA 1H95A 2HQEA 4HJAA 3I4NG 3NTIA 4WORA 4B3MQ 3DEOA 2HD3A 1HJPA 3A8KE 4DUZQ 1D6EC 1PRTC 5JPMC 1KAWA 1YZ6A 2X6GA 3K7AH 4HTHA 4X3KA 2CKZB 3G48A 1LT3D 3J80L 1SE3A 5JJIA 1GXDC 2OWOA 1TU2B 5IIFA 5E7NA 4RGTA 3H0GH 1U4MA 1RDPD 3E3XA 3AEVA 4PG3A 5EQ0A 3M4YA 1YNNC 4DV4Q 1D5XC 1Q1EA 4FVMA 1VQDA 1EY8A 1D2BA 3UDGA 2X6LA 4RWSC 4QL5A 5FOBB 2Z8LA 4HMIA 4C3HB 5J3BA 2NN6H 1O7ZA 2B2VA 4JI1L 2F0SA 4YWLA 3OWEB 3HKZE 4XYQA 1V1OA 2VB2X 3A5UA 2K1BA 1AP0A 3I7FA 1KRTA 2SOBA 1Q86C 4YY3Q 3A5ZB 3JAML 4B3RL 1ET9A 4DR6Q 3VDYA 3IKJA 1SNCA 3S24A 1QB5D 2L5TA 2KBNA 1YVCA 4DR5L 3L0OA 2B8GA 2YTYA 3TP7A 5LMNQ 3DM1A 1PRTF 3Q23A 4DXFA 4AYBB 4G7HC 3I3CA 4DR7L 2LY7A 4KHZA 1S40A 1QOHA 1EY4A 3OHXC 2QA4A 2NZOA 5DM73 1SYDA 4DNRB 3I55A 1B7YB 2NTTA 5EBCA 1OXUA 3HOVB 1EEFD 3KJPA 3H6MA 1ENAA 3T53B 1E3PA 5CBEE 2M00A 2CW0C 1JC7A 2D5DA 1YNJC 3HKSA 3S17B 1EWHA 2VUMB 1D5MC 1UWVA 3GP7A 3KF6B 2A6HD 2CCZA 3X3MA 5ELDA 4BY1H 4A3FH 5GADC 3FP9A 5DM63 5CV8A 1O7YA 3UDFA 3V96A 4A3CH 2N8NA 4JI3Q 5M3MH 5C4HA 4A3KH 4JI0Q 3CW2C 1JMCA 1K83H 2HHHL 1Q1BA 3VYRA 3H3VI 1C9OA 2HIVA 1AFPA 2JA7H 3KFUA 1KNAA 4IUUA 1H9SB 2EE1A 2F0EA 1GO3E 4NP5A 1E0BA 1WVLA 4DAVA 3VYSA 1ENFA 3N52A 3NBHB 1STAA 4A3GB 2OQKA 4DV7Q 2MHVA 3TMEA 1JICA 4LF6L 3DEPA 5CMDA 2JA5B 3HKZB 3O13A 2JYOA 2F0HA 2NVYB 4KY7A 5GAGC 4JV5Q 2Z0SA 2R7ZB 3D4RA 1R9TH 3NENA 2A1AA 4A93B 4DR3Q 2F0PA 5T1GA 2ZTDA 4RCOA 1D5ZC 3K5MA 2IY5B 4PV1C 4QB4A 4RMFA 4L5SA 5JEAG 2F4VQ 1N9WA 3VR6A 2CFMA 2EYLA 2Q2UA 2KQ3A 4TSSA 2MP1A 3HOVG 1IZ6A 5IT9c 4BY7G 1SN8A 1QZGA 2H1EA 3WWVA 4AYBE 3PO2H 2F4IA 2J7ZA 4A3IB 2RQXA 1TWCB 3V2TA 3CP0A 3J81E 4KHVA 1F9SA 1CT1D 3FVQA 4YWKA 3H91A 4FP5D 4V0BA 4RHRA 4RKLA 1SLJA 3D8GA 4RH6A 3MWYW 3NBHA 4C3HG 4RGNA 4FF4A 2EXZA 4L8JA 2LKVA 2RSNA 3K0YA 2D0OA 2A73B 2VQFQ 1LT6D 1TWGH 2WFWA 2MFIA 2B2UC 1E2ZA 4A3EG 2BH2A 1T9HA 2RDHA 2K14A 3H0GB 2MQHA 4FXKC 3H3VC 3MA2B 1DZ1A 3J80c 1J6QA 2VB3X 1NY4A 3QOLA 2UU9L 1RKNA 4IUTA 4OHJA 3CCQA 5ELFA 1S5FD 2XNAC 4DR2Q 1O7LA 2FHTA 3PO3G 1OXXK 5C0XJ 1ZXTA 3H0GG 2E75C 4TKOB 4YHHL 1Y69U 2EJGC 4B9XA 2PZTA 1P8LA 1K8GA 5FKAC 2LXKA 5M5WB 2WAQB 5CR3A 2F0IA 1VS0A 1A2UA 2L9HA 4HCSA 2E5LL 2NBFA 4QMGA 1FJGL 2BH8A 2JK8A 2QILA 2VUMH 2I5MX 3LNNA 2KHIA 1PH9A 2UXDL 2UXBL 1HQMC 1FR3A 1DYQA 3ZYYX 3MFGA 1LLRD 1MIUA 3I4MH 4WFN3 3AFPA 1H9RA 2AUKA 1PH4A 1T5EA 4CDFC 2R7ZG 4JI8Q 1MBYA 2F0OA 1QILA 1HCZA 1CKOA 5C5LA 3I56A 4Z9CB 4A3MB 4HEDA 1HNWL 2CQOA 1L1OB 1UEBA 3I90A 4IUNA 1SYBA 2A19A 3A8IE 3D31A 2XN9C 1PTOC 3KUPA 3OSOA 3KDFA 4RHSA 1EWCA 1HA6A 1LTRD 1SAPA 3M85A 2R93H 2A68C 5C0XH 1Y1VH 4CDEC 4O2DA 4X64L 3EVQA 3WOFA 1TT2A 1O80A 4K2KA 1TWAH 3HFZB 3C46A 5J39A 2RCNA 4HJ7A 3TREA 1VQIA 1X6OA 2EYMA 3R8BA 3DUZA 2KHSA 1KC8C 4EGVA 1VDZA 4X62L 1R9TB 2F0QA 3CRLC 3H09A 4A3BG 5I6YA 5LMNW 3ULJA 2OCEA 1U4RA 4GKKQ 1GD7A 2K01A 1EIFA 1MHWC 2EDGA 3HRZC 1II3A 2JA8G 3Q22A 1HNXQ 2SDFA 1XPOA 2EYPA 1VQBA 1N34L 4JI7Q 3A7LA 4KD3A 4FF1A 3S1RH 4OWWB 2IPKD 1IW7D 4TVAB 1CM9A 2L4NA 3M4OB 5L37A 3SVMA 4OX9Q 2FMMA 4KJOA 4KTAA 1PFSA 3CMEA 1GUNA 4PMCA 3HOZG 1LTBD 3QIAA 3IRBA 3S14B 2XRQD 1HUNA 3ZJYC 1FL0A 3M4QA 5FK9C 3T16A 5A2QE 3OMCA 3MXNB 1ET6A 2ICEC 4IN3A 2EY2A 2Z4IA 4DNIA 4A93H 1GUWA 5LL6S 2IHEA 4PMBA 3A55A 1EQQA 5A35A 3F2BA 5K5PA 4LF4Q 1BNZA 5JPNC 3K5LA 3SK5A 1Q81C 5M5YH 3S9WA 4XTCS 4BA2I 1CQFA 5M5XB 1MGSA 4P74A 4R4IA 1GOZA 4J8QA 1PLFA 5LHY1 3CKIB 2MUYA 3HOYH 3V05A 2K52A 1SRUA 2OF1A 1WCMB 1VCIA 2F0VA 4DV3Q 1RL2A 2AQ3B 3EBEA 5C5MA 3SE0A 4C1NK 4X66L 2VQEQ 4IOCA 4P73A 5CYUA 3E5SA 4LFBL 2PI2E 1LO5D 2QDLA 4PZ8A 1SBBB 1K8AC 2VW9A 4FXDA 1BF4A 1SMXA 1F2ZA 5CORA 1F2YA 1IXRA 4WJWA 4KKUA 4NB3A 2NVTB 4KKTA 2I0QA 3T4AC 2ZM6Q 1GHJA 1JQYD 3KF8A 4DV6Q 4N8FA 1TWGB 3S2HH 1HNZQ 1CK1A 2YYZA 1I6HB 2LSSA 4LF5Q 1Y1VG 2IT1A 2EYFA 4UP9A 2PNHA 4XQQA 3TZDA 4IURA 2Y0SB 1ILQA 5KEEA 1MSHA 3OWFA 1Z6HA 5LL6X 4CDDC 4DFAA 4DK1A 5EPKA 1X9NA 2L0CA 2F52A 1EY7A 1CA5A 2JA9A 4X6AH 1CHQD 1JR0D 1X3FA 1VF5C 1TR5A 4HR7B 3M3YH 2EJFC 3NHHA 1QJOA 1SNQA 3SR1A 4DR1L 1Y1WG 1F9QA 2Z9HA 2WV6D 4K2LA 3CCUA 1WI5A 4JI5L 5C3WA 3S16H 4DK6C 3KF6A 1KAAA 2AMCB 3J7YW 4KHPQ 1AH9A 3TSSA 1IBMQ 5C4XB 4NXML 1PFBA 2ID0A 1Q12A 5C4ZA 2BE5D 1WTPA 3S2DH 3I73A 5FLMG 4CDCC 3I4MB 3RLOA 3CCMA 3GTPB 1KHIA 4C3IH 4HIMA 2EOTA 2KCMA 4TRDA 2A6HC 2AKWB 2B2WA 3IFTA 2O5IC 1PH5A 4A3MH 2K32A 1I3QB 3W2DA 5JVG3 4FYDA 4IFDJ 2A6ED 3J80i 1OXVA 2B2TC 2B2WC 1J5EQ 1VMPA 1OXTA 4RG1A 5IY0A 2PMZB 5ELCA 4B3TQ 3MC0B 3F2DA 5C3EB 4A3CG 4C1NI 2FJ2A 1Q7YC 3LX0A 3PMFA 4A3KG 4GLVB 2A5HA 4LK1C 4HIOA 5IODA 4BA1I 1RHPA 1B44D 3OW7A 4RGMA 3CPWA 1QE6A 1I5FA 1VQAA 3S1MH 1VQCA 2HCIA 4MNOA 2HQLA 1N32L 2CWPA 2F0NA 5C44B 2R7FA 1NAPA 2R61A 5E3FA 4A3JH 3RZOB 1PXUA 1ESFA 3MHBA 3S1NB 4OIJA 3AB9A 1PV4A 2NVXB 2AUJD 1EU3A 2VS1A 2XVSA 1I4GA 3HOYB 4K0KQ 2ES2A 2QDBA 4JBJA 4RAUC 3TZUA 1V43A 4F7XA 3PV0A 3T13A 1K0SA 5FLXE 1B53A 2NTSA 1IW7C 1WTHA 1TS5A 1Q46A 1S5DD 1XTDA 5ISRA 3QOJA 1UEAB 2Q2TA 4H7BA 3S1QH 2OXPA 3ND8A 1D7QA 2KCTA 2QCPX 4C2MB 2E2IH 1E22A 4G57A 3NP8A 1ASYA 1PRTB 4IALA 3F2CA 5D14A 4YIJA 2KCNA 2RHQB 3T56B 1TS3A 3IL8A 3DLLA 1GM5A 4BBSB 1EYAA 1H9JA 1A3UA 4HJ5A 4KN7C 4IUVA 2R93B 5BN5A 2HCCA 2BA0A 4IUPA 1HTLD 2K33A 1SYFA 4NXNQ 2B3GA 2CH4W 1VQ9A 1RD9D 2ICIA 2ZJRA 3L3OC 2NVYH 2BDOA 2SEBD 3BJUA 4R4CA 1JOOA 3W3AA 4JW0A 3BDOA 2R92B 5C3EG 3SXHA 4K6DA 2PYKA 3NE5B 1HR0Q 1MJEA 1R4PB 2EY5A 1VQMA 1PTOH 3RUZA 1YJWA 3CU7A 3RLFA 3U58A 2F0FA 4DUYL 1TXYA 5K36H 1VQHA 4R4TA 2BE5C 4R9WA 3TP6A 2L15A 4X3UA 2E8GA 3OYYA 1KLGD 3S1QB 3R3OA 3GTPH 4OELB 2QGQA 3VA5A 5G3LF 1UUPA 4LFAQ 4JYAL 4FDBA 3HOUB 4KHPL 1U4LA 2CWAA 2B8FA 4XT1B 5AJ3L 4JI5Q 3C1FA 4OL7A 3SK8A 2E76C 3MAQA 2RVLA 2B63B 4DR1Q 4A3BB 1JOKA 1A63A 4UY8C 2DNCA 1YI2A 1W2BA 3C1EA 1L1OA 1SNPA 2JSOA 3G7LA 1K73C 3U50C 4PNYA 1XWEA 1Y8PB 4YWMA 1ICFB 1YHAA 1G6ZA 4EQPA 1XTCD 1CKNA 4C3HH 2PQAA 2JA5G 5I2XA 1HNZL 1B9MA 4FO2A 1STEA 1V8QA 4NKLA 3S15B 5KGUA 2M2LA 1UNSA 3D4WA 3QR8A 4UP7A 3I4NH 2JA6G 2M9VA 4DF7A 3FDTA 2PW5A 2IL8A 5JJZA 2ZXRA 1N36Q 4FF3A 1HHVA 2KOLA 3JAMc 1PMRA 3Q6SA 4GNXC 1YBYA 3MFYA 3PUZA 2ZJPA 4LFBQ 4N8X1 4ID6A 1PVOA 2O5JC 1DGSA 2EJMA 4OO1I 2F3IA 1W6KA 2CH4A 3NXWA 4NMZA 5DEHA 1L0WA 3K5NA 3GTMB 4UP8A 2NB0A 2YU9H 2RSOA 3QWNA 4GLAC 4ZUIA 2IX0A 3HOWG 1B50A 1NTGA 2L1BA 2MPMA 5M3FB 3QJYA 3URYA 2A68D 1E7ZA 1UE6A 3HOXH 2JA8H 1JORA 5ELOA 3K58A 2KECA 3I4LA 1BBXC 4X65L 1CKNB 1XMQL 2PQAB 1HFNA 1CI3M 4QQBX 3H94A 3MTSA 3K6OA 4QJFA 3CCVA 3R2IA 3BVMA 1VQOA 3MEFA 4A3JG 2DNEA 2F0TA 4OO1H 3OPOA 3T1HQ 4K6LA 3ITPA 1DOMA 1IBLL 1CA6A 4ZAIA 4UHVA 4U68A 3PO2B 2BA1A 2K5DA 2E74C 2KUMA 1Q3LA 5KNBA 1F9PA 2OQ0A 2SNSA 3H3VH 3BZCA 1K28A 2F03A 1EIHA 4F88A 4GZYC 1DM0B 4OX9L 5M3MB 4AQYL 2XSCA 4A3DH 2L12A 1QNUA 5E4WC 1JJCB 3GTLB 1S72A 3JAME 4HMJA 3P7JA 1TIID 5EBDA 3PIO3 3FPUB 4A76A 1N34Q 4A93G 4LMQD 2EQSA 3NEMA 3JC66 4L6TB 3W5OA 5CV7A 2H4OA 4EX5A 5CV6A 1JCKB 3DWAA 3KYHC 2E2IB 4A3FG 4GOPA 4GKKL 4G4KA 2F0KA 3NELA 3G6JB 1E1TA 5GQOA 2ZTCA 4X62Q 3D4DA 1PRTD 3KBGA 2LFNA 1LM0A 4A3GG 2F3VA 1KL9A 1JB7A 3T51B 3X3NA 4A3LG 5I9OA 1G2SA 2A69D 5HURA 2C9OA 4ZKCB 2B63H 4KI0A 3TS0A 1YHBA 3KF8B 5HGQA 1HH2P 3NSWA 1SNMA 5C0XI 3S1NH 1XNQQ 4P71A 1WFQA 4JBWA 4ZK9B 1PH7A 1XPUA 1Q90A 1SXTA 2CVRA 3A54A 3C2PA 2XWBB 3PSIA 3P1HA 4B3SQ 4DV5L 1GUTA 1WD0A 1GJXA 3CF5A 2VY3A 3K59A 3SEBA 1VQ4A 2FXQA 1HNWQ 4IFDI 1I50H 3P75A 1VMCA 3ND9A 3ERSX 3BG3A 3NTHA 1DJRD 5E1FA 2UUBL 3MVVA 4TQUS 1LT5D 4UPAA 3FMCA 4LUZA 1L2FA 1XMOQ 2TMPA 1R4QB 4C3JG 4GOPB 2WINB 2F0LA 4IFDH 1TWHH 2UXBQ 3KLSA 2UXDQ 5JOBA 2KENA 3A74A 2F0WA 3CC7A 3AMUA 1RTNA 1Z47A 2PNRC 3BYYB 4X3TA 2JJQA 2E5LQ 1CTMA 1RF2D 3KJOA 3RN5A 5FLXc 3GTMH 5DNFA 1D1IA 1EOVA 1N33L 3G71A 2R3ZA 4Y7NH 1ESRA 1IKLA 1L0XB 1ZYRD 2UUCQ 4YCVA 1A0IA 4YHHQ 1B70B 2N78A 3ER0A 4KK7A 3D0FA 3GDEA 1Y1VB 4OWTB 4BWGB 4DR2L 2ASBA 4OWXB 5M5XH 2B39A 5J22A 5FO7B 2P5ZX 4J6HA 4O1NA 3L2PA 2UU9Q 4A3MG 3F2UA 3RN2A 2BCOA 2QKIC 1PTOB 2K5VA 1PTOD 2VZAA 1A62A 2JEBI 2LS01 1I94L 5JJKA 2OEOA 4HN7A 1PA6A 1VQ8A 2VQFL 4G7OC 3R93A 2B2YC 3OIPA 2R92G 4BXXH 1SNOA 4IUQA 4IPDA 3NTKA 3F8TA 3P20A 3WOEA 3M4PA 1I94Q 4ABNA 2Q8IB 3GTOB 2XGTA 3DXJC 1S3OA 4M1UB 3RZDH 2PPBC 1U0LA 2I07B 3S2DB 2F1MA 3STBC 3S14H 3I72A 2MGSA 2MNAA 3M4OH 1RTOA 3FRPB 1TQOA 3PUYA 3HOWH 4ALPA 4AYBG 1HRJA 4OXPA 3EIVA 1UE1A 3FKIH 3TRZA 2UUCL 4BBSG 1N33Q 3HG9A 3RR5A 1A6XA 1I4QA 4G7ZC 5K36G 1TVXA 2N88A 5JAVA 1K3BC 4RGOS 3PO3B 1FNWA 1QWYA 4GNXB 1B8AA 1TS2A 2R7ZH 2B29A 4XQNA 4OO1G 1B4OA 4RA8A 3S17H 5M3FG 1K0RA 4LUVA 2TSSA 3HOUG 1XMOL 1X56A 2DJGC 5D3IB 2NN6G 1KLUD 1K8MA 1E2WA 2K5HA 5KYLA 2WKCA 4DV7L 2QW7A 3CRKC 2XIWA 3JAMi 1O78A 2UUBQ 4L63B 2HUGA 1ILPA 1X55A 2NVQH 1HTPA 1NR4A 3Q8DA 2JXMB 4CBVA 1DXMA 1AZQA 5AFWA 3KLRA 1VQNA 3KOJA 3B6YA 3DWQA 3K0XA 2JN4A 2Q8TA 4XXEA 4DV5Q 4B3SL 5FJ8G 2HHHQ 2YTVA 1A2TA 1MSGA 2YU9B 5EPJA 4JI0L 1KRSA 3VR5A 4CKBA 4A3KB 4DAYA 2IX3A 4JI3L 3J7AF 1SYEA 1XNQL 4IQZA 3GTGH 1X3PA 5IGEA 2MO0A 1WTWA 1IKMA 2RDFA 3PUWA 5A2QL 1I4RA 4R4QA 5NUCA 2EYOA 1VQ5A 4Y52H 2LMCB 4EQOA 2XWJB 4H0LC 1XYIA 3GTKH 4GN5A 4P75A 3U4VA 1SYCA 3E9HA 1PH2A 4CHTB 2HDMA 2B2YA 2CHBD 1PH8A 1H9MA 5C4JB 2CW0D 5KNDA 1JE4A 2G5DA 2DJFC 1EYGA 2E2JB 3CCLA 2SNMA 2G9DA 1S5BD 2PI2A 5IT9E 4DR7Q 5EPLA 1QVFA 5COYA 3MXNA 2JA7B 3M3YB 1Y1WB 4BY7H 1PFNA 3EA6A 4DA2A 4AQYQ 2R7DA 4DR5Q 3OOCA 4A3IH 1W6JA 1I6VC 2EIFA 1HZBA 5FO9B 3QG1A 1C48A 1BQQT 3MEHA 1Q8KA 2YV5A 2JA7G 5IT9L 1VQKA 3TP5A 3ULLA 1IBLQ 2Q2IA 2KA7A 3T1HL 2JA5H 4Y7NB 3I4OA 4QIWB 5JVH3 3S2HB 3ERQA 5C3EH 3NPPA 5EKKA 2CQAA 1NR2A 3PGZA 3GTOH 2AWOA 3NBIA 1YJNA 4JI1Q 1RIPA 1XMQQ 2FFKB 2MO1A 4X65Q 1G291 2ATWA 2JA8B 3VR3A 4K14A 1H9SA 1ZYRC 1TWFH 4DV4L 5M5YB 3GTKB 1C4QA 4LNQA 3A0JA 2D9UA 5EGTA 1KXLA 2XRSD 4ZKBB 4A3DG 5ELNA 3PO3H 1LTSD 3CHBD 1EU4A 5IYCG 1BCPF 1Y14B 1VF7A 1X3EA 4B9WA 4DUZL 2A74C 2RDGA 1TWAB 3ONAB 3S16B 5IGCA 1FGBD 4XT3B 1Z9FA 4BY1G 5C44H 4POFA 4A3FB 4O0AA 3IAYA 2NZ1D 1A3TA 4Q0FA 3PUVA 3OIQA 1N36L 4QUFA 5IGDA 4RKBA 1I4XA 1YITA 4A3LH 4UDUC 2JA6B 4GOPC 5FO8B 2B63G 2N55A 5J1ZA 4XDXA 5IP9H 4QUCA 2IWHA 3W1BA 1STHA 2V4DA 2F0JA 1DOLA 1LUZA 4GN4B 3OW2A 3M9BA 1HUMA 5GROA 1X54A 4IPGA 4LF8L 5IOCA 2L55A 1YJ9A 1PFMA 5I2YA 3M7NA 1CQVA 3DMUA 2E2DC 1U4PA 2LXJA 4OGQC 2R93G 2UUAQ 4JI4Q 1WOCA 4WJ4A 5IYDG 2F0MA 2KHJA 3I2ZA 1IBKL 5AJ3Q 4BBRH 3J7ZC 2GA4B 5EKIA 3J81i 3J7A5 1IHZA 5F2DA 1OXSC 1LABA 4LFAL 4JYAQ 3CCJA 4ZYSA 2K7VA 3NQTA 2E2JH 4NDXA 5D65A 4POGA 5IGFA 1KDBA 2F0UA 4CJ2C 4DNTB 3PO2G 3AFQA 1CSQA 4A3IG 2AHOB 4DUYQ 3HOXG 3UDIA 4EQ5A 2DY7A 5HY6A 1QZHA 1VQEA 2PMZE 3D6WA 2F0DA 3I4NB 3Q24A 1B2TA 4CGYB 4S3SA 4ZQ3A 2NZHA 3BU2A 3VA7A 2D0PA 1HR0L 5C3XA 5FJ8H 1K3RA 1V9PA 2C35B 1SSOA 4A3DB 2GVBA 4DR4L 4HIDA 4HJ9A 2KJXA 1S4ZA 2OTLA 2ALYB 2QEJC 3NK9A 4HJ8A 2EPBA 2WB1E 3MXUA 2F0GA 4MZ9A 3HOZB 2NVTH 1YNJD 4MIUA 4NXNL 1NMFA 3T1YL 4K5WA 2WP8J 4AH6A 4DAMA 1X3QA 2WAQE 4LFCQ 1SJHD 2KVMA 3GTQB 1G6PA 1STBA 1X32A 2Z1CA 1XJVA 4EVOA 2IJ0A 1K8OA 4MTKA 1XNRL 4DPGA 1PH1A 2OTJA 1QUQB 3EROA 1MD2D 3K57A 2NN6I 4DV0L 1D8LA 2Z4HA 4EQNA 4JCVE 1KNEA 3CQZB 1NBWA 2Z6KC 3MZ5A 3I70A 2K03A 2J0TD 3NUCA 1PYBA 1OTCA 3BVZA 4RCNA 4K0KL 3I4MG 3SK6A 1F77A 2N3SA 1Z7TA 1JJ2A 1ICWA 2L11A 4ILWA 1A8VA 3I91A 1LTAD 1PZJD 1L1OC 1GVPA 4WRDA 2K28A 3OMGA 1TS4A 1LTTD 3FKIB 4JPBW 1N32Q 1STGA 1DONA 1JE5A 4P2CB 2UXCL 3HOZH 1UAPA 4QIWE 1LACA 3A56A 4JC0A 2IX1A 4CKCA 5IGBA 1BKBA 3CCRA 5LMUQ 4DV2L 3MXPA 4GLXA 4KJNA 1WYDA 2VL6A 1C0AA 1OO9B 1VQPA 4B3TL 3E6ZX 4OEMB 1EFID 3S15H 5IYCH 4GN3B 1J5EL 4BBRG 4ULLA 4HIKA 1L0YB 4HAEA 3C3LA 1GUSA 5BR8L 4GKJQ 3R2TA 1U5KA 3QB3A 3HOYG 2NVXH 4K8IA 3GTLH 1YNND 4IOAA 4NXMQ 1IYJB 3EFXD 4KN4C 1IBML 5C4XH 1GUGA 1G2TA 1I50B 3N6RA 4AIMA 1EFWA 4CJ0B 1BCPB 3HGBA 1NSNS 2XTIA 5IP9G 1EQVA 3GV3A 1M90C 1YNXA 4QY7A 4J15A 3RLNA 1X3GA 4DKAC 5C6AA 1K83B 3J81L 1ASZA 2ZXOA 5ELBA 3RZDB 2WAQG 4LF9L 3G4SA 1TY0A 2MJ8A 4LF7L 3HOVH 1QCBD 4UAIA 1KABA 4ME3A 4NW2A 3UI2A 4LF5L 5IGGA 1CKMA 2G9HD 1F2MA 1EYCA 2H5XA 1I6HH 5IWAQ 1N8RC 4DV6L 1M1KC 1BOSA 3H15A 3CC4A 5CV5A 2ZM6L 1LTID 1WJJA 2DUDA 3U9OA 5IP7H 4KV6A 1VQ6A 3PQIA 4A75A 3HS0C 1RJTA 3E0EA 1G8ZD 3CD6A 3SK4A 1Y1WH 4BY7B 4JI6Q 1MKHA 2QEXA 2D62A 3FKIG 4F87A 4JBKA 4X66Q 2VQEL 1SDFA 4BY1B 1B3AA 5JJLA 2O2LD 1SE8A 5KNCA 3K7UC 5CV4A 5IE8A 5GAHC 2IW3A 4DV3L 3TEHB 3RZOH 5FLMH 3S1RB 1IL8A 1M4VA 1YEZA 2AQ1B 4OONA 4KY6A 3UE0A 1EIYB 1SMYD 1WTRA 1E24A 1UE5A 4DN4M 1KD1C 5M3FH 1NMGA 3LGJA 5BN4A 5KRUA 1LYLA 4MN3A 4LF4L 4L5QA 4IPCA 1XXGA 3SGIA 1T5XD 2C5CA 1SFOB 2JEAI 4C3IB 2AWNA 5C44G 2EYJA 4IJLA 4I65A 4CJ1B 1AZPA 2EYHA 3KK7A 3K7AB 4F8MA 3CCSA 4DV1Q 5M9OA 4OIKA 2VUMG 4PQXA 2WB1G 1WTQA 4V190 3LWUA 3ULPA 5CC4A 2VNUD 1I4PA 4JK1C 4JI2L 3SDZA 1E2VA 1HA5A 4I7ZC 3GTJB 5T1IA 1X65A 2JP1A 5IYBH 1EQTA 2V1CC 1KTKA 5M5WH 4A3EB 1WCMH 4DAYB 4DGZA 2GN5A 2K4KA 1ZKOA 1KIXA 4JI7L 2E2HH 3IFDA 1HNXL 1HFGA 4L5TA 5C4XG 1TWHB 3KLSX 1C8CA 1WTOA 4K8JA 1IYUA 2OT2A 4M8AA 3EJIA 4C3IG 2KEDA 1B1ZA 1STNA 5IYDH 4U673 3L7ZC 4IZ8A 5DLQE 1E1OA 2K05A 3HEJA 2PCFB 3KDFB 3VR4A 4JOIA 4KY5A
chains in the Genus database with same CATH topology
1QVFA 3UDFA 3KLWA 4A3CH 3EN2A 4HJ5A 2N8NA 4BY7H 4JI3Q 4LWCA 4AQYQ 2K75A 2R7DA 4DR5Q 5M3MH 1XPRA 4APVA 4A3KH 2BA0A 4JI0Q 4JI2Q 2I5HA 3CW2C 4A3IH 1JMCA 1K83H 2EIFA 2HHHL 4NXNQ 1Q1BA 1HZBA 1PH3A 2B3GA 2Q2HA 3H3VI 1C9OA 2HIVA 1BBWA 2JA7H 3KFUA 1VQ9A 1Q8KA 2YV5A 2JA7G 1VQKA 2ZJRA 4C3JH 3ULLA 2NVYH 1IBLQ 2Q2IA 3BJUA 4R4CA 3T1HL 1GO3E 2JA5H 3I4OA 4DV1L 4JI8L 4H02A 5C3EH 3PGZA 5C3EG 3NBHB 3GTOH 2AWOA 1KQSA 1YJNA 1O7IA 1HR0Q 4JI1Q 1RIPA 2OQKA 4DV7Q 1MJEA 1XMQQ 2MO1A 4X65Q 1VQMA 1G291 1YJWA 4LF6L 2ATWA 3RLFA 3U58A 1CSPA 1TWCH 4DUYL 1TXYA 1P16A 4DV4L 1TWFH 1VQHA 4R4TA 4LNQA 3A0JA 3CC2A 5GAGC 2L15A 1KXLA 4JV5Q 2E8GA 2Z0SA 3OYYA 4A3DG 5ELNA 1FJGQ 3PO3H 1R9TH 3K81C 3GTPH 3NENA 2A1AA 5JJLA 4DR3Q 5IYCG 1Y14B 2QGQA 1X3EA 2ZTDA 4LFAQ 4JYAL 4FDBA 2IY5B 4DUZL 4L5SA 4RMFA 2F4VQ 5JEAG 4KHPL 1N9WA 2CFMA 2CWAA 4BY1G 1Z9FA 5C44H 3E9IA 5AJ3L 4POFA 1VQ7A 4JI5Q 2Q2UA 4O0AA 4DR1Q 3CMAA 4JI6L 3HOVG 4XIGS 1IZ6A 5IT9c 4BY7G 1SN8A 1A63A 1QZGA 4UY8C 1JJGA 3PUVA 3WWVA 1GKHA 4AYBE 1YI2A 1W2BA 1HZ9A 3PO2H 1L1OA 1N36L 1AE3A 1K73C 5EAYA 3U50C 1YITA 3CP0A 4A3LH 5C4JH 4GOPC 1YHQA 4YWMA 1IL2A 4YWKA 2B63G 1YHAA 1UE7A 1SLJA 1PH6A 1VQJA 1QUQA 5IP9H 3W1BA 1CKNA 4C3HH 2PQAA 1HZAA 5IWAL 2JA5G 2DGYA 1LUZA 1HNZL 4GN4B 1AE2A 2D0OA 3OW2A 2VQFQ 3AQQA 1TWGH 2WFWA 4LF7Q 3M9BA 2MFIA 3FHWA 5GROA 1X54A 4IPGA 1T9HA 4A3EG 2BH2A 2K14A 2MQHA 4LF8L 4UP7A 3PIPA 1PHJA 3I4NH 1BBUA 3U4ZA 4LF9Q 2JA6G 2HT1A 1YJ9A 2JA6H 3J80c 3M7NA 1J6QA 1NY4A 2UU9L 1HZCA 1N36Q 2LXJA 3CCQA 4JG2A 3JAMc 4GNXC 3AYHB 2R93G 1YBYA 2UUAQ 4YCWA 4DR2Q 4JI4Q 3PO3G 1OXXK 1WOCA 3PUZA 2IHFA 5C0XJ 3H0GG 4R1JA 2ZJPA 5IYDG 4LFBQ 4WJ4A 3UDXA 2KHJA 3I2ZA 4YHHL 3UE1A 1IBKL 5AJ3Q 4BBRH 1P8LA 1PVOA 3J7ZC 1K8GA 2LXKA 1DGSA 3J81i 1HR0W 2F3IA 3J7A5 4OO1I 1L0WA 2F4VL 4MTNA 3HOUH 1VS0A 4UP8A 1OXSC 4JYAQ 3PCOB 4LFAL 3CCJA 2YU9H 2K50A 4DR3L 4GLAC 2E2JH 2E5LL 1FJGL 2IX0A 1YIJA 1BVSA 1C7YA 4POGA 1NTGA 2BH8A 3HOWG 2JK8A 1NE3A 4JV5L 3PO2G 2JE6I 2VUMH 2I5MX 1PH9A 2KHIA 2UXDL 3AFQA 5BR8Q 4GKJL 1CSQA 4A3IG 2AHOB 2UXBL 1G51A 4DUYQ 3HOXG 3UDIA 4EQ5A 5HY6A 1K9MC 1E7ZA 1UE6A 3GD7A 1VQEA 2PMZE 3HOXH 1QZHA 2Y0SG 5ELOA 2JA8H 4LF6Q 2NZHA 4JOIC 4X65L 1CKNB 1XMQL 2PQAB 3BU2A 1MIUA 3I4MH 2D0PA 1HR0L 4QQBX 3AFPA 5FJ8H 1K3RA 1V9PA 1FVIA 4QJFA 3CCVA 2C35B 1PH4A 2R7ZG 2GVBA 4P72A 4JI8Q 1VQOA 4DR4L 4HIDA 4HJ9A 3MEFA 4A3JG 2RF4A 1QVCA 3GTJH 1CKOA 3I56A 5LMUL 4DV2Q 3T1HQ 2ZTEA 5GAEC 1HNWL 2CQOA 1IBLL 1L1OB 2OTLA 1UEBA 2ALYB 1WCMG 2BA1A 3F1ZA 4A3EH 4HJ8A 2WB1E 2A19A 4MZ9A 3PF5A 2NVTH 3D31A 2OQ0A 3PF4A 4NXNL 1NMFA 1EQRA 3BZCA 4PZ6A 3H3VH 3T1YL 2UXCQ 1FGUA 3KDFA 2WP8J 3ICEA 4OX9L 3M85A 4AQYL 2R93H 4AH6A 4DAMA 4IJHA 1Y1VH 4A3DH 2WAQE 4LFCQ 1QVGA 2EXDA 1JJCB 1S72A 1SROA 4O2DA 4JBMA 1G6PA 4LUOA 4X64L 4A93G 4A76A 2YTXA 1N34Q 1XJVA 1SFOH 4NPSA 2EQSA 3NEMA 1TWAH 1MJCA 3JC66 3W5OA 1XNRL 2R6GA 3HFZB 1I3QH 4DK3C 4DPGA 2RCNA 1PH1A 4HJ7A 2OTJA 3TREA 1VQIA 1X6OA 4EX5A 1QUQB 3KYHC 1KC8C 4A3FG 4GOPA 4GKKL 4X62L 2NN6I 4DV0L 4A3BG 1EWIA 3NELA 5LMNW 3K8AA 4DV0Q 3ULJA 1D8LA 2OCEA 1E1TA 5GQOA 2ZTCA 4JCVE 4X62Q 4GKKQ 1GD7A 4A3GH 4R4OA 1LM0A 1EIFA 4A3GG 3RNUA 1KL9A 1NBWA 2Z6KC 1JB7A 4A3LG 2JA8G 1XNRQ 1HNXQ 1PYBA 1OTCA 1XPOA 1PYSB 4IO9A 1VQBA 2B63H 4KI0A 3TS0A 1V1QA 1YHBA 1N34L 1EUJA 4JI7Q 3KF8B 2Z6KA 5HGQA 2N3SA 3I4MG 1HH2P 3S1RH 4OWWB 1JJ2A 4LFCL 4TVAB 5C0XI 1SR3A 3S1NH 1A8VA 1XNQQ 4P71A 5LMNL 1L1OC 1W3SA 1WFQA 5GADC 4JBWA 4KLKA 1GVPA 4OX9Q 1PH7A 1VQGA 1XPUA 1NJIC 1N32Q 1PFSA 3CMEA 3T1YQ 1JE5A 3PSIA 4B3SQ 4DR6L 2UXCL 4DV5L 2GVAA 3HOZG 4B3RQ 4YY3L 3HOZH 4QIWE 3CF5A 2VY3A 3IRBA 1CUKA 4JC0A 2IX1A 1VQ4A 2A8VA 2FXQA 1HNWQ 3ZJYC 1FL0A 3M4QA 4IFDI 1BKBA 4IPHA 1I50H 3CCRA 3HKZG 5LMUQ 4DV2L 4GLXA 3DM3A 2JQOA 5M3MG 3ERSX 5C0XG 1WYDA 4DR4Q 2VL6A 3PIOA 1C0AA 3MXNB 1VQPA 4B3TL 2UUBL 2HIXA 3CQZH 4TQUS 4DNIA 3S15H 4A93H 3K80C 4GN3B 5IYCH 4BBRG 1J5EL 2IHEA 4UPAA 4LUZA 4HIKA 1EQQA 3F2BA 1L2FA 1Q82C 1XMOQ 4LF4Q 4GOPB 2UXBQ 1TWHH 4QGUA 5BR8L 1Q81C 4GKJQ 2UXDQ 5M5YH 2KENA 4XTCS 1LTLA 4BA2I 3A74A 1U5KA 2Y0SE 3CPFA 3STBD 3CC7A 4P74A 4R4IA 1Z47A 4PZ7A 2JJQA 4A4IA 4LW1A 2E5LQ 3HOYH 3PUXA 3W1GA 2K52A 3HOYG 3KJOA 1SRUA 3RN5A 3J81c 2NVXH 5FLXc 1VCIA 3GTLH 3GTMH 4IOAA 2K5NA 4DV3Q 3GO5A 4NXMQ 1IYJB 1RL2A 1EOVA 1IBML 1N33L 3EBEA 5C4XH 3G71A 4B3ML 4Y7NH 3J81j 2UUCQ 4AIMA 1EFWA 4YCVA 1A0IA 4X66L 4YHHQ 2VQEQ 1B70B 4IOCA 4P73A 1IBKQ 2N78A 3ER0A 4LFBL 3GTQH 2PI2E 2XTIA 3D0FA 3GDEA 4PZ8A 5IP9G 4OWTB 4DR2L 1K8AC 1M90C 1YNXA 2UUAL 4QY7A 4JI4L 2VW9A 2ASBA 4OWXB 5M5XH 1SMXA 4J15A 1X3GA 3RLNA 4DKAC 3L2PA 2RHSB 1ASZA 2UU9Q 1IXRA 4A3MG 1VQLA 2WAQG 3RN2A 4NB3A 3CXCA 3G4SA 3BZKA 4LF9L 4LF8Q 2I5LX 2K5VA 2VZAA 2I0QA 1A62A 2JEBI 2ZM6Q 4K0KL 1I94L 5JJKA 4LF7L 1VQ8A 1PA6A 3OTOQ 5H1SE 4DV6Q 3HOVH 4ME3A 3TQYA 3TS2A 2VQFL 4LF5L 2R92H 4BXXG 1CKMA 1HNZQ 3S2HH 2H5XA 2YYZA 2LSSA 4PMWA 2R92G 4BXXH 1I6HH 4IPDA 5IWAQ 1N8RC 4LF5Q 1Y1VG 3F8TA 2IT1A 4DV6L 3OTOL 1JT8A 4GS3A 4UP9A 1M1KC 1VQFA 2PNHA 3M4PA 3H15A 1I94Q 4YCUA 3CC4A 2ZM6L 2XGTA 4C2MH 1WJJA 4WJ3M 2ZJQA 1S3OA 3RZDH 3CCEA 2DUDA 5IP7G 4IFDG 5IP7H 1U0LA 1X9NA 2F52A 1VQ6A 3STBC 3CAMA 2JA9A 5JEAJ 3G6EA 4A75A 3S14H 3E0EA 4X6AH 1X3FA 3CD6A 3M4OH 2MNAA 4GNXA 4A3FH 1Y1WH 5IYBG 3M3YH 4A3BH 1Y1WG 4JI6Q 3PUYA 1MKHA 2N49A 4DR1L 3HOWH 2QEXA 4ALPA 2D62A 3FKIG 4AYBG 4OXPA 1WI5A 3CCUA 3EIVA 1UE1A 3FKIH 4JI5L 4X66Q 2VQEL 3TRZA 4BBSH 2UUCL 4L5RC 1SE8A 4DK6C 3S16H 4HJAA 3KF6A 3I4NG 4BBSG 1H95A 2AMCB 3K7UC 4B3MQ 5IE8A 4KHPQ 5GAHC 1IBMQ 1N33Q 1AH9A 1HJPA 3RR5A 4DUZQ 4DV3L 4NXML 3TEHB 2ID0A 1KAWA 3RZOH 1Q12A 1YZ6A 3K7AH 5K36G 3S2DH 5FLMH 2CKZB 5FLMG 3G48A 1YEZA 5JJIA 3RLOA 3CCMA 1KHIA 4C3IH 4HIMA 2OWOA 4OONA 5E7NA 4GNXB 3UE0A 1B8AA 3H0GH 2KCMA 1EIYB 2B29A 2R7ZH 1E24A 2AKWB 3AEVA 1UE5A 4OO1G 4PG3A 1KD1C 5M3FH 4DV4Q 3S17H 1NMGA 1Q1EA 3LGJA 5M3FG 4A3MH 1PH5A 1K0RA 4LUVA 1VQDA 1LYLA 3HOUG 1XMOL 4L5QA 4LF4L 4IFDJ 4IPCA 3J80i 1X56A 3UDGA 3SGIA 1OXVA 4QL5A 2NN6G 2JEAI 2AWNA 5C44G 5J3BA 2K5HA 1J5EQ 4JBKA 1OXTA 4DV7L 4IJLA 4JI1L 4RG1A 4YWLA 3JAMi 5IY0A 3HKZE 2UUBQ 4B3TQ 3F2DA 3A5UA 4A3CG 3CCSA 4DV1Q 1X55A 2NVQH 1Q7YC 2VUMG 2WB1G 3I7FA 3Q8DA 4A3KG 4GLVB 4HIOA 1KRTA 1VQNA 4BA1I 1Q86C 3KOJA 3B6YA 3ULPA 3K0XA 2VNUD 4YY3Q 3A5ZB 3CPWA 4B3RL 1I5FA 1VQAA 4DV5Q 3S1MH 4DR6Q 1VQCA 4B3SL 4MNOA 5FJ8G 3VDYA 2HQLA 2HHHQ 1N32L 2YTVA 2CWPA 3S24A 4JI2L 2R7FA 2KBNA 4JI0L 1KRSA 4A3JH 1YVCA 4DR5L 3L0OA 2YTYA 5LMNQ 4JI3L 1X65A 5IYBH 1XNQL 2V1CC 3GTGH 5M5WH 2MO0A 1PV4A 1WCMH 4DAYB 2GN5A 2K4KA 2VS1A 4DR7L 3PUWA 4KHZA 1S40A 1KIXA 4JI7L 2E2HH 4K0KQ 2ES2A 4R4QA 4JBJA 2QA4A 1V43A 2NZOA 1VQ5A 3PV0A 1HNXL 4Y52H 3I55A 1B7YB 4L5TA 5C4XG 1OXUA 3GTKH 4GN5A 4P75A 3U4VA 1XTDA 1Q46A 3E9HA 1PH2A 3KJPA 2Q2TA 3S1QH 1PH8A 1E3PA 1D7QA 2KCTA 2E2IH 5IYDH 3HKSA 1E22A 1ASYA 3F2CA 3L7ZC 2RHQB 3DLLA 1UWVA 3KF6B 1E1OA 5DLQE 1GM5A 2CCZA 3KDFB 1EYGA 3CCLA 4BY1H 4DR7Q 2PI2A 4JOIA 3FP9A 4X64Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF A;  3UDF A;  3KLW A;  4A3C H;  3EN2 A;  4HJ5 A;  2N8N A;  4BY7 H;  4JI3 Q;  4LWC A;  4AQY Q;  2K75 A;  2R7D A;  4DR5 Q;  5M3M H;  1XPR A;  4APV A;  4A3K H;  2BA0 A;  4JI0 Q;  4JI2 Q;  2I5H A;  3CW2 C;  4A3I H;  1JMC A;  1K83 H;  2EIF A;  2HHH L;  4NXN Q;  1Q1B A;  1HZB A;  1PH3 A;  2B3G A;  2Q2H A;  3H3V I;  1C9O A;  2HIV A;  1BBW A;  2JA7 H;  3KFU A;  1VQ9 A;  1Q8K A;  2YV5 A;  2JA7 G;  1VQK A;  2ZJR A;  4C3J H;  3ULL A;  2NVY H;  1IBL Q;  2Q2I A;  3BJU A;  4R4C A;  3T1H L;  1GO3 E;  2JA5 H;  3I4O A;  4DV1 L;  4JI8 L;  4H02 A;  5C3E H;  3PGZ A;  5C3E G;  3NBH B;  3GTO H;  2AWO A;  1KQS A;  1YJN A;  1O7I A;  1HR0 Q;  4JI1 Q;  1RIP A;  2OQK A;  4DV7 Q;  1MJE A;  1XMQ Q;  2MO1 A;  4X65 Q;  1VQM A;  1G29 1;  1YJW A;  4LF6 L;  2ATW A;  3RLF A;  3U58 A;  1CSP A;  1TWC H;  4DUY L;  1TXY A;  1P16 A;  4DV4 L;  1TWF H;  1VQH A;  4R4T A;  4LNQ A;  3A0J A;  3CC2 A;  5GAG C;  2L15 A;  1KXL A;  4JV5 Q;  2E8G A;  2Z0S A;  3OYY A;  4A3D G;  5ELN A;  1FJG Q;  3PO3 H;  1R9T H;  3K81 C;  3GTP H;  3NEN A;  2A1A A;  5JJL A;  4DR3 Q;  5IYC G;  1Y14 B;  2QGQ A;  1X3E A;  2ZTD A;  4LFA Q;  4JYA L;  4FDB A;  2IY5 B;  4DUZ L;  4L5S A;  4RMF A;  2F4V Q;  5JEA G;  4KHP L;  1N9W A;  2CFM A;  2CWA A;  4BY1 G;  1Z9F A;  5C44 H;  3E9I A;  5AJ3 L;  4POF A;  1VQ7 A;  4JI5 Q;  2Q2U A;  4O0A A;  4DR1 Q;  3CMA A;  4JI6 L;  3HOV G;  4XIG S;  1IZ6 A;  5IT9 c;  4BY7 G;  1SN8 A;  1A63 A;  1QZG A;  4UY8 C;  1JJG A;  3PUV A;  3WWV A;  1GKH A;  4AYB E;  1YI2 A;  1W2B A;  1HZ9 A;  3PO2 H;  1L1O A;  1N36 L;  1AE3 A;  1K73 C;  5EAY A;  3U50 C;  1YIT A;  3CP0 A;  4A3L H;  5C4J H;  4GOP C;  1YHQ A;  4YWM A;  1IL2 A;  4YWK A;  2B63 G;  1YHA A;  1UE7 A;  1SLJ A;  1PH6 A;  1VQJ A;  1QUQ A;  5IP9 H;  3W1B A;  1CKN A;  4C3H H;  2PQA A;  1HZA A;  5IWA L;  2JA5 G;  2DGY A;  1LUZ A;  1HNZ L;  4GN4 B;  1AE2 A;  2D0O A;  3OW2 A;  2VQF Q;  3AQQ A;  1TWG H;  2WFW A;  4LF7 Q;  3M9B A;  2MFI A;  3FHW A;  5GRO A;  1X54 A;  4IPG A;  1T9H A;  4A3E G;  2BH2 A;  2K14 A;  2MQH A;  4LF8 L;  4UP7 A;  3PIP A;  1PHJ A;  3I4N H;  1BBU A;  3U4Z A;  4LF9 Q;  2JA6 G;  2HT1 A;  1YJ9 A;  2JA6 H;  3J80 c;  3M7N A;  1J6Q A;  1NY4 A;  2UU9 L;  1HZC A;  1N36 Q;  2LXJ A;  3CCQ A;  4JG2 A;  3JAM c;  4GNX C;  3AYH B;  2R93 G;  1YBY A;  2UUA Q;  4YCW A;  4DR2 Q;  4JI4 Q;  3PO3 G;  1OXX K;  1WOC A;  3PUZ A;  2IHF A;  5C0X J;  3H0G G;  4R1J A;  2ZJP A;  5IYD G;  4LFB Q;  4WJ4 A;  3UDX A;  2KHJ A;  3I2Z A;  4YHH L;  3UE1 A;  1IBK L;  5AJ3 Q;  4BBR H;  1P8L A;  1PVO A;  3J7Z C;  1K8G A;  2LXK A;  1DGS A;  3J81 i;  1HR0 W;  2F3I A;  3J7A 5;  4OO1 I;  1L0W A;  2F4V L;  4MTN A;  3HOU H;  1VS0 A;  4UP8 A;  1OXS C;  4JYA Q;  3PCO B;  4LFA L;  3CCJ A;  2YU9 H;  2K50 A;  4DR3 L;  4GLA C;  2E2J H;  2E5L L;  1FJG L;  2IX0 A;  1YIJ A;  1BVS A;  1C7Y A;  4POG A;  1NTG A;  2BH8 A;  3HOW G;  2JK8 A;  1NE3 A;  4JV5 L;  3PO2 G;  2JE6 I;  2VUM H;  2I5M X;  1PH9 A;  2KHI A;  2UXD L;  3AFQ A;  5BR8 Q;  4GKJ L;  1CSQ A;  4A3I G;  2AHO B;  2UXB L;  1G51 A;  4DUY Q;  3HOX G;  3UDI A;  4EQ5 A;  5HY6 A;  1K9M C;  1E7Z A;  1UE6 A;  3GD7 A;  1VQE A;  2PMZ E;  3HOX H;  1QZH A;  2Y0S G;  5ELO A;  2JA8 H;  4LF6 Q;  2NZH A;  4JOI C;  4X65 L;  1CKN B;  1XMQ L;  2PQA B;  3BU2 A;  1MIU A;  3I4M H;  2D0P A;  1HR0 L;  4QQB X;  3AFP A;  5FJ8 H;  1K3R A;  1V9P A;  1FVI A;  4QJF A;  3CCV A;  2C35 B;  1PH4 A;  2R7Z G;  2GVB A;  4P72 A;  4JI8 Q;  1VQO A;  4DR4 L;  4HID A;  4HJ9 A;  3MEF A;  4A3J G;  2RF4 A;  1QVC A;  3GTJ H;  1CKO A;  3I56 A;  5LMU L;  4DV2 Q;  3T1H Q;  2ZTE A;  5GAE C;  1HNW L;  2CQO A;  1IBL L;  1L1O B;  2OTL A;  1UEB A;  2ALY B;  1WCM G;  2BA1 A;  3F1Z A;  4A3E H;  4HJ8 A;  2WB1 E;  2A19 A;  4MZ9 A;  3PF5 A;  2NVT H;  3D31 A;  2OQ0 A;  3PF4 A;  4NXN L;  1NMF A;  1EQR A;  3BZC A;  4PZ6 A;  3H3V H;  3T1Y L;  2UXC Q;  1FGU A;  3KDF A;  2WP8 J;  3ICE A;  4OX9 L;  3M85 A;  4AQY L;  2R93 H;  4AH6 A;  4DAM A;  4IJH A;  1Y1V H;  4A3D H;  2WAQ E;  4LFC Q;  1QVG A;  2EXD A;  1JJC B;  1S72 A;  1SRO A;  4O2D A;  4JBM A;  1G6P A;  4LUO A;  4X64 L;  4A93 G;  4A76 A;  2YTX A;  1N34 Q;  1XJV A;  1SFO H;  4NPS A;  2EQS A;  3NEM A;  1TWA H;  1MJC A;  3JC6 6;  3W5O A;  1XNR L;  2R6G A;  3HFZ B;  1I3Q H;  4DK3 C;  4DPG A;  2RCN A;  1PH1 A;  4HJ7 A;  2OTJ A;  3TRE A;  1VQI A;  1X6O A;  4EX5 A;  1QUQ B;  3KYH C;  1KC8 C;  4A3F G;  4GOP A;  4GKK L;  4X62 L;  2NN6 I;  4DV0 L;  4A3B G;  1EWI A;  3NEL A;  5LMN W;  3K8A A;  4DV0 Q;  3ULJ A;  1D8L A;  2OCE A;  1E1T A;  5GQO A;  2ZTC A;  4JCV E;  4X62 Q;  4GKK Q;  1GD7 A;  4A3G H;  4R4O A;  1LM0 A;  1EIF A;  4A3G G;  3RNU A;  1KL9 A;  1NBW A;  2Z6K C;  1JB7 A;  4A3L G;  2JA8 G;  1XNR Q;  1HNX Q;  1PYB A;  1OTC A;  1XPO A;  1PYS B;  4IO9 A;  1VQB A;  2B63 H;  4KI0 A;  3TS0 A;  1V1Q A;  1YHB A;  1N34 L;  1EUJ A;  4JI7 Q;  3KF8 B;  2Z6K A;  5HGQ A;  2N3S A;  3I4M G;  1HH2 P;  3S1R H;  4OWW B;  1JJ2 A;  4LFC L;  4TVA B;  5C0X I;  1SR3 A;  3S1N H;  1A8V A;  1XNQ Q;  4P71 A;  5LMN L;  1L1O C;  1W3S A;  1WFQ A;  5GAD C;  4JBW A;  4KLK A;  1GVP A;  4OX9 Q;  1PH7 A;  1VQG A;  1XPU A;  1NJI C;  1N32 Q;  1PFS A;  3CME A;  3T1Y Q;  1JE5 A;  3PSI A;  4B3S Q;  4DR6 L;  2UXC L;  4DV5 L;  2GVA A;  3HOZ G;  4B3R Q;  4YY3 L;  3HOZ H;  4QIW E;  3CF5 A;  2VY3 A;  3IRB A;  1CUK A;  4JC0 A;  2IX1 A;  1VQ4 A;  2A8V A;  2FXQ A;  1HNW Q;  3ZJY C;  1FL0 A;  3M4Q A;  4IFD I;  1BKB A;  4IPH A;  1I50 H;  3CCR A;  3HKZ G;  5LMU Q;  4DV2 L;  4GLX A;  3DM3 A;  2JQO A;  5M3M G;  3ERS X;  5C0X G;  1WYD A;  4DR4 Q;  2VL6 A;  3PIO A;  1C0A A;  3MXN B;  1VQP A;  4B3T L;  2UUB L;  2HIX A;  3CQZ H;  4TQU S;  4DNI A;  3S15 H;  4A93 H;  3K80 C;  4GN3 B;  5IYC H;  4BBR G;  1J5E L;  2IHE A;  4UPA A;  4LUZ A;  4HIK A;  1EQQ A;  3F2B A;  1L2F A;  1Q82 C;  1XMO Q;  4LF4 Q;  4GOP B;  2UXB Q;  1TWH H;  4QGU A;  5BR8 L;  1Q81 C;  4GKJ Q;  2UXD Q;  5M5Y H;  2KEN A;  4XTC S;  1LTL A;  4BA2 I;  3A74 A;  1U5K A;  2Y0S E;  3CPF A;  3STB D;  3CC7 A;  4P74 A;  4R4I A;  1Z47 A;  4PZ7 A;  2JJQ A;  4A4I A;  4LW1 A;  2E5L Q;  3HOY H;  3PUX A;  3W1G A;  2K52 A;  3HOY G;  3KJO A;  1SRU A;  3RN5 A;  3J81 c;  2NVX H;  5FLX c;  1VCI A;  3GTL H;  3GTM H;  4IOA A;  2K5N A;  4DV3 Q;  3GO5 A;  4NXM Q;  1IYJ B;  1RL2 A;  1EOV A;  1IBM L;  1N33 L;  3EBE A;  5C4X H;  3G71 A;  4B3M L;  4Y7N H;  3J81 j;  2UUC Q;  4AIM A;  1EFW A;  4YCV A;  1A0I A;  4X66 L;  4YHH Q;  2VQE Q;  1B70 B;  4IOC A;  4P73 A;  1IBK Q;  2N78 A;  3ER0 A;  4LFB L;  3GTQ H;  2PI2 E;  2XTI A;  3D0F A;  3GDE A;  4PZ8 A;  5IP9 G;  4OWT B;  4DR2 L;  1K8A C;  1M90 C;  1YNX A;  2UUA L;  4QY7 A;  4JI4 L;  2VW9 A;  2ASB A;  4OWX B;  5M5X H;  1SMX A;  4J15 A;  1X3G A;  3RLN A;  4DKA C;  3L2P A;  2RHS B;  1ASZ A;  2UU9 Q;  1IXR A;  4A3M G;  1VQL A;  2WAQ G;  3RN2 A;  4NB3 A;  3CXC A;  3G4S A;  3BZK A;  4LF9 L;  4LF8 Q;  2I5L X;  2K5V A;  2VZA A;  2I0Q A;  1A62 A;  2JEB I;  2ZM6 Q;  4K0K L;  1I94 L;  5JJK A;  4LF7 L;  1VQ8 A;  1PA6 A;  3OTO Q;  5H1S E;  4DV6 Q;  3HOV H;  4ME3 A;  3TQY A;  3TS2 A;  2VQF L;  4LF5 L;  2R92 H;  4BXX G;  1CKM A;  1HNZ Q;  3S2H H;  2H5X A;  2YYZ A;  2LSS A;  4PMW A;  2R92 G;  4BXX H;  1I6H H;  4IPD A;  5IWA Q;  1N8R C;  4LF5 Q;  1Y1V G;  3F8T A;  2IT1 A;  4DV6 L;  3OTO L;  1JT8 A;  4GS3 A;  4UP9 A;  1M1K C;  1VQF A;  2PNH A;  3M4P A;  3H15 A;  1I94 Q;  4YCU A;  3CC4 A;  2ZM6 L;  2XGT A;  4C2M H;  1WJJ A;  4WJ3 M;  2ZJQ A;  1S3O A;  3RZD H;  3CCE A;  2DUD A;  5IP7 G;  4IFD G;  5IP7 H;  1U0L A;  1X9N A;  2F52 A;  1VQ6 A;  3STB C;  3CAM A;  2JA9 A;  5JEA J;  3G6E A;  4A75 A;  3S14 H;  3E0E A;  4X6A H;  1X3F A;  3CD6 A;  3M4O H;  2MNA A;  4GNX A;  4A3F H;  1Y1W H;  5IYB G;  3M3Y H;  4A3B H;  1Y1W G;  4JI6 Q;  3PUY A;  1MKH A;  2N49 A;  4DR1 L;  3HOW H;  2QEX A;  4ALP A;  2D62 A;  3FKI G;  4AYB G;  4OXP A;  1WI5 A;  3CCU A;  3EIV A;  1UE1 A;  3FKI H;  4JI5 L;  4X66 Q;  2VQE L;  3TRZ A;  4BBS H;  2UUC L;  4L5R C;  1SE8 A;  4DK6 C;  3S16 H;  4HJA A;  3KF6 A;  3I4N G;  4BBS G;  1H95 A;  2AMC B;  3K7U C;  4B3M Q;  5IE8 A;  4KHP Q;  5GAH C;  1IBM Q;  1N33 Q;  1AH9 A;  1HJP A;  3RR5 A;  4DUZ Q;  4DV3 L;  4NXM L;  3TEH B;  2ID0 A;  1KAW A;  3RZO H;  1Q12 A;  1YZ6 A;  3K7A H;  5K36 G;  3S2D H;  5FLM H;  2CKZ B;  5FLM G;  3G48 A;  1YEZ A;  5JJI A;  3RLO A;  3CCM A;  1KHI A;  4C3I H;  4HIM A;  2OWO A;  4OON A;  5E7N A;  4GNX B;  3UE0 A;  1B8A A;  3H0G H;  2KCM A;  1EIY B;  2B29 A;  2R7Z H;  1E24 A;  2AKW B;  3AEV A;  1UE5 A;  4OO1 G;  4PG3 A;  1KD1 C;  5M3F H;  4DV4 Q;  3S17 H;  1NMG A;  1Q1E A;  3LGJ A;  5M3F G;  4A3M H;  1PH5 A;  1K0R A;  4LUV A;  1VQD A;  1LYL A;  3HOU G;  1XMO L;  4L5Q A;  4LF4 L;  4IFD J;  4IPC A;  3J80 i;  1X56 A;  3UDG A;  3SGI A;  1OXV A;  4QL5 A;  2NN6 G;  2JEA I;  2AWN A;  5C44 G;  5J3B A;  2K5H A;  1J5E Q;  4JBK A;  1OXT A;  4DV7 L;  4IJL A;  4JI1 L;  4RG1 A;  4YWL A;  3JAM i;  5IY0 A;  3HKZ E;  2UUB Q;  4B3T Q;  3F2D A;  3A5U A;  4A3C G;  3CCS A;  4DV1 Q;  1X55 A;  2NVQ H;  1Q7Y C;  2VUM G;  2WB1 G;  3I7F A;  3Q8D A;  4A3K G;  4GLV B;  4HIO A;  1KRT A;  1VQN A;  4BA1 I;  1Q86 C;  3KOJ A;  3B6Y A;  3ULP A;  3K0X A;  2VNU D;  4YY3 Q;  3A5Z B;  3CPW A;  4B3R L;  1I5F A;  1VQA A;  4DV5 Q;  3S1M H;  4DR6 Q;  1VQC A;  4B3S L;  4MNO A;  5FJ8 G;  3VDY A;  2HQL A;  2HHH Q;  1N32 L;  2YTV A;  2CWP A;  3S24 A;  4JI2 L;  2R7F A;  2KBN A;  4JI0 L;  1KRS A;  4A3J H;  1YVC A;  4DR5 L;  3L0O A;  2YTY A;  5LMN Q;  4JI3 L;  1X65 A;  5IYB H;  1XNQ L;  2V1C C;  3GTG H;  5M5W H;  2MO0 A;  1PV4 A;  1WCM H;  4DAY B;  2GN5 A;  2K4K A;  2VS1 A;  4DR7 L;  3PUW A;  4KHZ A;  1S40 A;  1KIX A;  4JI7 L;  2E2H H;  4K0K Q;  2ES2 A;  4R4Q A;  4JBJ A;  2QA4 A;  1V43 A;  2NZO A;  1VQ5 A;  3PV0 A;  1HNX L;  4Y52 H;  3I55 A;  1B7Y B;  4L5T A;  5C4X G;  1OXU A;  3GTK H;  4GN5 A;  4P75 A;  3U4V A;  1XTD A;  1Q46 A;  3E9H A;  1PH2 A;  3KJP A;  2Q2T A;  3S1Q H;  1PH8 A;  1E3P A;  1D7Q A;  2KCT A;  2E2I H;  5IYD H;  3HKS A;  1E22 A;  1ASY A;  3F2C A;  3L7Z C;  2RHQ B;  3DLL A;  1UWV A;  3KF6 B;  1E1O A;  5DLQ E;  1GM5 A;  2CCZ A;  3KDF B;  1EYG A;  3CCL A;  4BY1 H;  4DR7 Q;  2PI2 A;  4JOI A;  3FP9 A;  4X64 Q; 
#chains in the Genus database with same CATH topology
 3BYT B;  1MI2 A;  3KLW A;  3GTG B;  3EN2 A;  1IYV A;  4LWC A;  2K75 A;  1XPR A;  4APV A;  3KBX A;  4J1M A;  4JI2 Q;  2I5H A;  2J4X A;  1SND A;  2RBM A;  1PH3 A;  2Q2H A;  4DXG A;  1BBW A;  1F9R A;  2RKS A;  2NUC A;  1CZW A;  5KIX A;  4C3J H;  3J80 E;  5BN3 A;  2RA4 A;  5D3D A;  2HDL A;  2O4X A;  3VYU A;  4DV1 L;  4JI8 L;  4H02 A;  1KQS A;  3K5O A;  2K5W A;  4FNF A;  1O7I A;  4RFB A;  2K6A A;  2ZT9 C;  3A8J E;  1SE4 A;  1D1K A;  1CSP A;  1TWC H;  2KCC A;  4HSP A;  1P16 A;  1ML0 D;  4N9T A;  1JWU D;  3CC2 A;  3AU7 A;  1A3V A;  3TP8 A;  2A69 C;  3M7G A;  1FJG Q;  2K5Q A;  3K81 C;  3Q0A A;  1ENC A;  1I4H A;  1B3Q A;  3RMH A;  1KDA A;  3WDN A;  3NWT A;  1AW7 A;  3E9I A;  1VQ7 A;  4ZLT F;  2A6E C;  3CMA A;  4JI6 L;  4XIG S;  3HOW B;  1GUO A;  1JJG A;  3BVG A;  1SE2 A;  1LV9 A;  1GKH A;  3NWS A;  1HZ9 A;  1CZG A;  4XYO A;  1AE3 A;  1BCP D;  5EAY A;  1CHP D;  5C4J H;  1HXY D;  1YHQ A;  2BDN A;  1DD2 A;  1IL2 A;  1BUV T;  1JOQ A;  5KYI A;  1UE7 A;  5EJW A;  1DCZ A;  1FNV A;  1PH6 A;  1VQJ A;  1QUQ A;  2X69 A;  2I46 A;  2WAC A;  3J7A V;  1HZA A;  4I7A A;  5IWA L;  1JWM D;  2DGY A;  1AE2 A;  1STY A;  5HGT A;  3AQQ A;  1BXT A;  1SEB D;  4LF7 Q;  1SYG A;  3FHW A;  2AQ2 B;  3TDQ A;  4X64 Q;  1BBU A;  3U4Z A;  3PIP A;  1PHJ A;  4LF9 Q;  1NNX A;  2HT1 A;  5E4X A;  2JA6 H;  4C56 C;  2B2U A;  1HZC A;  3E0J A;  4KMU C;  3TBI B;  2B2V C;  4JG2 A;  2PZU A;  3AYH B;  4DU9 A;  1JB3 A;  4YCW A;  3D6C A;  1EOT A;  2IHF A;  4R1J A;  2E2H B;  3UDX A;  5I6W A;  3UE1 A;  1F2L A;  4LJZ C;  1S5E D;  3MXG A;  2WKD A;  1EY5 A;  1HR0 W;  2F4V L;  4MTN A;  5JEA H;  3HOU H;  3PCO B;  2NYZ D;  3GQB A;  2K50 A;  4DR3 L;  1AEX A;  4JVZ A;  1PZI D;  1FD7 D;  1EY9 A;  1YIJ A;  1BVS A;  1BDO A;  1C7Y A;  3BS1 A;  1NE3 A;  4JV5 L;  1J8I A;  2JE6 I;  1EY6 A;  1WTX A;  5BR8 Q;  4GKJ L;  1G51 A;  3BDC A;  1WD1 A;  1K9M C;  3GD7 A;  1NCV A;  2Y0S G;  4ME5 A;  1RCV D;  2B2T A;  4LF6 Q;  4JOI C;  1HQR D;  1BR9 A;  3PIP 3;  1FVI A;  2F3W A;  2PW7 A;  4P72 A;  3FEW X;  2RF4 A;  1DOK A;  1QVC A;  3D3R A;  5FLX L;  3GTJ H;  3HOX B;  5LMU L;  4DV2 Q;  4E6I A;  4ODG A;  2ZTE A;  5GAE C;  3VYT A;  4C3J B;  1WCM G;  3F1Z A;  4A3E H;  3GV6 A;  2Z6B A;  3PF5 A;  2EVB A;  3LWE A;  3PF4 A;  4K5V A;  1EQR A;  4PZ6 A;  2UXC Q;  4LAA A;  1EZ8 A;  2NWG A;  1FGU A;  2EY6 A;  4QF4 A;  4CKE A;  3ICE A;  1V1P A;  1TKW B;  1TY2 A;  4ZUJ A;  5TSS A;  4IJH A;  1QVG A;  2EXD A;  1SRO A;  3HZX A;  4JBM A;  4LUO A;  2VXW A;  2YTX A;  4K5X A;  5CBA E;  1SFO H;  4NPS A;  1LTG D;  1MJC A;  2R6G A;  1I3Q H;  4DK3 C;  3QO2 A;  2EZV A;  1EZ6 A;  1FNU A;  4O42 A;  1EL0 A;  5CV9 A;  1EWI A;  3K8A A;  4DV0 Q;  4N9P A;  5I9P A;  4A3G H;  4HCE A;  4R4O A;  3RNU A;  3DHQ A;  4ZRZ A;  4B08 A;  2DY8 A;  1XNR Q;  1PYS B;  1EYD A;  4IO9 A;  4KKS A;  1Y8N B;  1PTO F;  1V1Q A;  1EUJ A;  3RD4 A;  2KEE A;  2Z6K A;  1G91 A;  4LFC L;  1SR3 A;  1ZEQ X;  3BDL A;  1M8A A;  2WB1 B;  5LMN L;  1W3S A;  4A3J B;  4KLK A;  1ROD A;  1VQG A;  4BBR B;  1NJI C;  3T1Y Q;  3HP3 A;  1LT4 D;  4QCL A;  4DR6 L;  1QNK A;  1EY0 A;  1BO0 A;  2GVA A;  4HSV A;  4B3R Q;  4YY3 L;  1V1P B;  4XQJ A;  1NUC A;  1CUK A;  4H13 C;  2A8V A;  3DWP A;  2Q8R E;  4IPH A;  1EEI D;  3I8Z A;  3HKZ G;  2RCF A;  1GHK A;  3DM3 A;  2JQO A;  5M3M G;  2PZW A;  1JWS D;  3BZD B;  5C0X G;  4DR4 Q;  2NVQ B;  3PIO A;  2HIX A;  3CQZ H;  5G3L D;  4R8I A;  3K80 C;  4FXG C;  4ZCK A;  3FPP A;  1AN8 A;  4R8N A;  1Q82 C;  1PZK D;  5DAU A;  1B9N A;  2FMC A;  4QGU A;  1TWF B;  2ENB A;  4Q5V A;  1LTL A;  2Y0S E;  3STB D;  3CPF A;  1PDQ A;  4PZ7 A;  1EIG A;  1ONL A;  4A4I A;  4LW1 A;  1CFM A;  3PUX A;  1U9R A;  3W1G A;  1KDC A;  2WII B;  1BCP C;  3J81 c;  1SJE D;  2K5N A;  3GO5 A;  1SMY C;  4B3M L;  3J81 j;  2PO4 A;  5EKL A;  5CGK A;  1PYW D;  1IBK Q;  3U9S A;  3GTQ H;  4X3S A;  4JI4 L;  3SHL A;  2UUA L;  2PQE A;  5I4D A;  1Q8I A;  3A7A B;  2RHS B;  1H9K A;  1VQL A;  1WTV A;  4DK0 A;  3S1M B;  3CXC A;  3BZK A;  2QF7 A;  4LF8 Q;  1S5C D;  2I5L X;  2FIN B;  3L9A X;  4BS9 A;  3TS2 A;  3OTO Q;  5H1S E;  3TQY A;  1QG7 A;  3TN2 A;  2R92 H;  4BXX G;  4PMW A;  3VR2 A;  3NQI A;  1FYC A;  2BOS A;  3OTO L;  4GS3 A;  1JT8 A;  1VQF A;  2D2C C;  2K04 A;  4YCU A;  2DN8 A;  5ELE A;  3EQL C;  4C2M H;  1A15 A;  4DAP A;  2ZJQ A;  4WJ3 M;  3CCE A;  5IP7 G;  4IFD G;  4FF2 A;  1HPC A;  3CAM A;  5JEA J;  3G6E A;  4GNX A;  5IYB G;  4KD4 A;  4MHE A;  4A3B H;  2EY1 A;  1Y8O B;  4H44 C;  2N49 A;  2ZXP A;  4BBS H;  1XX8 A;  4L5R C;  1J9O A;  1H95 A;  2HQE A;  4HJA A;  3I4N G;  3NTI A;  4WOR A;  4B3M Q;  3DEO A;  2HD3 A;  1HJP A;  3A8K E;  4DUZ Q;  1D6E C;  1PRT C;  5JPM C;  1KAW A;  1YZ6 A;  2X6G A;  3K7A H;  4HTH A;  4X3K A;  2CKZ B;  3G48 A;  1LT3 D;  3J80 L;  1SE3 A;  5JJI A;  1GXD C;  2OWO A;  1TU2 B;  5IIF A;  5E7N A;  4RGT A;  3H0G H;  1U4M A;  1RDP D;  3E3X A;  3AEV A;  4PG3 A;  5EQ0 A;  3M4Y A;  1YNN C;  4DV4 Q;  1D5X C;  1Q1E A;  4FVM A;  1VQD A;  1EY8 A;  1D2B A;  3UDG A;  2X6L A;  4RWS C;  4QL5 A;  5FOB B;  2Z8L A;  4HMI A;  4C3H B;  5J3B A;  2NN6 H;  1O7Z A;  2B2V A;  4JI1 L;  2F0S A;  4YWL A;  3OWE B;  3HKZ E;  4XYQ A;  1V1O A;  2VB2 X;  3A5U A;  2K1B A;  1AP0 A;  3I7F A;  1KRT A;  2SOB A;  1Q86 C;  4YY3 Q;  3A5Z B;  3JAM L;  4B3R L;  1ET9 A;  4DR6 Q;  3VDY A;  3IKJ A;  1SNC A;  3S24 A;  1QB5 D;  2L5T A;  2KBN A;  1YVC A;  4DR5 L;  3L0O A;  2B8G A;  2YTY A;  3TP7 A;  5LMN Q;  3DM1 A;  1PRT F;  3Q23 A;  4DXF A;  4AYB B;  4G7H C;  3I3C A;  4DR7 L;  2LY7 A;  4KHZ A;  1S40 A;  1QOH A;  1EY4 A;  3OHX C;  2QA4 A;  2NZO A;  5DM7 3;  1SYD A;  4DNR B;  3I55 A;  1B7Y B;  2NTT A;  5EBC A;  1OXU A;  3HOV B;  1EEF D;  3KJP A;  3H6M A;  1ENA A;  3T53 B;  1E3P A;  5CBE E;  2M00 A;  2CW0 C;  1JC7 A;  2D5D A;  1YNJ C;  3HKS A;  3S17 B;  1EWH A;  2VUM B;  1D5M C;  1UWV A;  3GP7 A;  3KF6 B;  2A6H D;  2CCZ A;  3X3M A;  5ELD A;  4BY1 H;  4A3F H;  5GAD C;  3FP9 A;  5DM6 3;  5CV8 A;  1O7Y A;  3UDF A;  3V96 A;  4A3C H;  2N8N A;  4JI3 Q;  5M3M H;  5C4H A;  4A3K H;  4JI0 Q;  3CW2 C;  1JMC A;  1K83 H;  2HHH L;  1Q1B A;  3VYR A;  3H3V I;  1C9O A;  2HIV A;  1AFP A;  2JA7 H;  3KFU A;  1KNA A;  4IUU A;  1H9S B;  2EE1 A;  2F0E A;  1GO3 E;  4NP5 A;  1E0B A;  1WVL A;  4DAV A;  3VYS A;  1ENF A;  3N52 A;  3NBH B;  1STA A;  4A3G B;  2OQK A;  4DV7 Q;  2MHV A;  3TME A;  1JIC A;  4LF6 L;  3DEP A;  5CMD A;  2JA5 B;  3HKZ B;  3O13 A;  2JYO A;  2F0H A;  2NVY B;  4KY7 A;  5GAG C;  4JV5 Q;  2Z0S A;  2R7Z B;  3D4R A;  1R9T H;  3NEN A;  2A1A A;  4A93 B;  4DR3 Q;  2F0P A;  5T1G A;  2ZTD A;  4RCO A;  1D5Z C;  3K5M A;  2IY5 B;  4PV1 C;  4QB4 A;  4RMF A;  4L5S A;  5JEA G;  2F4V Q;  1N9W A;  3VR6 A;  2CFM A;  2EYL A;  2Q2U A;  2KQ3 A;  4TSS A;  2MP1 A;  3HOV G;  1IZ6 A;  5IT9 c;  4BY7 G;  1SN8 A;  1QZG A;  2H1E A;  3WWV A;  4AYB E;  3PO2 H;  2F4I A;  2J7Z A;  4A3I B;  2RQX A;  1TWC B;  3V2T A;  3CP0 A;  3J81 E;  4KHV A;  1F9S A;  1CT1 D;  3FVQ A;  4YWK A;  3H91 A;  4FP5 D;  4V0B A;  4RHR A;  4RKL A;  1SLJ A;  3D8G A;  4RH6 A;  3MWY W;  3NBH A;  4C3H G;  4RGN A;  4FF4 A;  2EXZ A;  4L8J A;  2LKV A;  2RSN A;  3K0Y A;  2D0O A;  2A73 B;  2VQF Q;  1LT6 D;  1TWG H;  2WFW A;  2MFI A;  2B2U C;  1E2Z A;  4A3E G;  2BH2 A;  1T9H A;  2RDH A;  2K14 A;  3H0G B;  2MQH A;  4FXK C;  3H3V C;  3MA2 B;  1DZ1 A;  3J80 c;  1J6Q A;  2VB3 X;  1NY4 A;  3QOL A;  2UU9 L;  1RKN A;  4IUT A;  4OHJ A;  3CCQ A;  5ELF A;  1S5F D;  2XNA C;  4DR2 Q;  1O7L A;  2FHT A;  3PO3 G;  1OXX K;  5C0X J;  1ZXT A;  3H0G G;  2E75 C;  4TKO B;  4YHH L;  1Y69 U;  2EJG C;  4B9X A;  2PZT A;  1P8L A;  1K8G A;  5FKA C;  2LXK A;  5M5W B;  2WAQ B;  5CR3 A;  2F0I A;  1VS0 A;  1A2U A;  2L9H A;  4HCS A;  2E5L L;  2NBF A;  4QMG A;  1FJG L;  2BH8 A;  2JK8 A;  2QIL A;  2VUM H;  2I5M X;  3LNN A;  2KHI A;  1PH9 A;  2UXD L;  2UXB L;  1HQM C;  1FR3 A;  1DYQ A;  3ZYY X;  3MFG A;  1LLR D;  1MIU A;  3I4M H;  4WFN 3;  3AFP A;  1H9R A;  2AUK A;  1PH4 A;  1T5E A;  4CDF C;  2R7Z G;  4JI8 Q;  1MBY A;  2F0O A;  1QIL A;  1HCZ A;  1CKO A;  5C5L A;  3I56 A;  4Z9C B;  4A3M B;  4HED A;  1HNW L;  2CQO A;  1L1O B;  1UEB A;  3I90 A;  4IUN A;  1SYB A;  2A19 A;  3A8I E;  3D31 A;  2XN9 C;  1PTO C;  3KUP A;  3OSO A;  3KDF A;  4RHS A;  1EWC A;  1HA6 A;  1LTR D;  1SAP A;  3M85 A;  2R93 H;  2A68 C;  5C0X H;  1Y1V H;  4CDE C;  4O2D A;  4X64 L;  3EVQ A;  3WOF A;  1TT2 A;  1O80 A;  4K2K A;  1TWA H;  3HFZ B;  3C46 A;  5J39 A;  2RCN A;  4HJ7 A;  3TRE A;  1VQI A;  1X6O A;  2EYM A;  3R8B A;  3DUZ A;  2KHS A;  1KC8 C;  4EGV A;  1VDZ A;  4X62 L;  1R9T B;  2F0Q A;  3CRL C;  3H09 A;  4A3B G;  5I6Y A;  5LMN W;  3ULJ A;  2OCE A;  1U4R A;  4GKK Q;  1GD7 A;  2K01 A;  1EIF A;  1MHW C;  2EDG A;  3HRZ C;  1II3 A;  2JA8 G;  3Q22 A;  1HNX Q;  2SDF A;  1XPO A;  2EYP A;  1VQB A;  1N34 L;  4JI7 Q;  3A7L A;  4KD3 A;  4FF1 A;  3S1R H;  4OWW B;  2IPK D;  1IW7 D;  4TVA B;  1CM9 A;  2L4N A;  3M4O B;  5L37 A;  3SVM A;  4OX9 Q;  2FMM A;  4KJO A;  4KTA A;  1PFS A;  3CME A;  1GUN A;  4PMC A;  3HOZ G;  1LTB D;  3QIA A;  3IRB A;  3S14 B;  2XRQ D;  1HUN A;  3ZJY C;  1FL0 A;  3M4Q A;  5FK9 C;  3T16 A;  5A2Q E;  3OMC A;  3MXN B;  1ET6 A;  2ICE C;  4IN3 A;  2EY2 A;  2Z4I A;  4DNI A;  4A93 H;  1GUW A;  5LL6 S;  2IHE A;  4PMB A;  3A55 A;  1EQQ A;  5A35 A;  3F2B A;  5K5P A;  4LF4 Q;  1BNZ A;  5JPN C;  3K5L A;  3SK5 A;  1Q81 C;  5M5Y H;  3S9W A;  4XTC S;  4BA2 I;  1CQF A;  5M5X B;  1MGS A;  4P74 A;  4R4I A;  1GOZ A;  4J8Q A;  1PLF A;  5LHY 1;  3CKI B;  2MUY A;  3HOY H;  3V05 A;  2K52 A;  1SRU A;  2OF1 A;  1WCM B;  1VCI A;  2F0V A;  4DV3 Q;  1RL2 A;  2AQ3 B;  3EBE A;  5C5M A;  3SE0 A;  4C1N K;  4X66 L;  2VQE Q;  4IOC A;  4P73 A;  5CYU A;  3E5S A;  4LFB L;  2PI2 E;  1LO5 D;  2QDL A;  4PZ8 A;  1SBB B;  1K8A C;  2VW9 A;  4FXD A;  1BF4 A;  1SMX A;  1F2Z A;  5COR A;  1F2Y A;  1IXR A;  4WJW A;  4KKU A;  4NB3 A;  2NVT B;  4KKT A;  2I0Q A;  3T4A C;  2ZM6 Q;  1GHJ A;  1JQY D;  3KF8 A;  4DV6 Q;  4N8F A;  1TWG B;  3S2H H;  1HNZ Q;  1CK1 A;  2YYZ A;  1I6H B;  2LSS A;  4LF5 Q;  1Y1V G;  2IT1 A;  2EYF A;  4UP9 A;  2PNH A;  4XQQ A;  3TZD A;  4IUR A;  2Y0S B;  1ILQ A;  5KEE A;  1MSH A;  3OWF A;  1Z6H A;  5LL6 X;  4CDD C;  4DFA A;  4DK1 A;  5EPK A;  1X9N A;  2L0C A;  2F52 A;  1EY7 A;  1CA5 A;  2JA9 A;  4X6A H;  1CHQ D;  1JR0 D;  1X3F A;  1VF5 C;  1TR5 A;  4HR7 B;  3M3Y H;  2EJF C;  3NHH A;  1QJO A;  1SNQ A;  3SR1 A;  4DR1 L;  1Y1W G;  1F9Q A;  2Z9H A;  2WV6 D;  4K2L A;  3CCU A;  1WI5 A;  4JI5 L;  5C3W A;  3S16 H;  4DK6 C;  3KF6 A;  1KAA A;  2AMC B;  3J7Y W;  4KHP Q;  1AH9 A;  3TSS A;  1IBM Q;  5C4X B;  4NXM L;  1PFB A;  2ID0 A;  1Q12 A;  5C4Z A;  2BE5 D;  1WTP A;  3S2D H;  3I73 A;  5FLM G;  4CDC C;  3I4M B;  3RLO A;  3CCM A;  3GTP B;  1KHI A;  4C3I H;  4HIM A;  2EOT A;  2KCM A;  4TRD A;  2A6H C;  2AKW B;  2B2W A;  3IFT A;  2O5I C;  1PH5 A;  4A3M H;  2K32 A;  1I3Q B;  3W2D A;  5JVG 3;  4FYD A;  4IFD J;  2A6E D;  3J80 i;  1OXV A;  2B2T C;  2B2W C;  1J5E Q;  1VMP A;  1OXT A;  4RG1 A;  5IY0 A;  2PMZ B;  5ELC A;  4B3T Q;  3MC0 B;  3F2D A;  5C3E B;  4A3C G;  4C1N I;  2FJ2 A;  1Q7Y C;  3LX0 A;  3PMF A;  4A3K G;  4GLV B;  2A5H A;  4LK1 C;  4HIO A;  5IOD A;  4BA1 I;  1RHP A;  1B44 D;  3OW7 A;  4RGM A;  3CPW A;  1QE6 A;  1I5F A;  1VQA A;  3S1M H;  1VQC A;  2HCI A;  4MNO A;  2HQL A;  1N32 L;  2CWP A;  2F0N A;  5C44 B;  2R7F A;  1NAP A;  2R61 A;  5E3F A;  4A3J H;  3RZO B;  1PXU A;  1ESF A;  3MHB A;  3S1N B;  4OIJ A;  3AB9 A;  1PV4 A;  2NVX B;  2AUJ D;  1EU3 A;  2VS1 A;  2XVS A;  1I4G A;  3HOY B;  4K0K Q;  2ES2 A;  2QDB A;  4JBJ A;  4RAU C;  3TZU A;  1V43 A;  4F7X A;  3PV0 A;  3T13 A;  1K0S A;  5FLX E;  1B53 A;  2NTS A;  1IW7 C;  1WTH A;  1TS5 A;  1Q46 A;  1S5D D;  1XTD A;  5ISR A;  3QOJ A;  1UEA B;  2Q2T A;  4H7B A;  3S1Q H;  2OXP A;  3ND8 A;  1D7Q A;  2KCT A;  2QCP X;  4C2M B;  2E2I H;  1E22 A;  4G57 A;  3NP8 A;  1ASY A;  1PRT B;  4IAL A;  3F2C A;  5D14 A;  4YIJ A;  2KCN A;  2RHQ B;  3T56 B;  1TS3 A;  3IL8 A;  3DLL A;  1GM5 A;  4BBS B;  1EYA A;  1H9J A;  1A3U A;  4HJ5 A;  4KN7 C;  4IUV A;  2R93 B;  5BN5 A;  2HCC A;  2BA0 A;  4IUP A;  1HTL D;  2K33 A;  1SYF A;  4NXN Q;  2B3G A;  2CH4 W;  1VQ9 A;  1RD9 D;  2ICI A;  2ZJR A;  3L3O C;  2NVY H;  2BDO A;  2SEB D;  3BJU A;  4R4C A;  1JOO A;  3W3A A;  4JW0 A;  3BDO A;  2R92 B;  5C3E G;  3SXH A;  4K6D A;  2PYK A;  3NE5 B;  1HR0 Q;  1MJE A;  1R4P B;  2EY5 A;  1VQM A;  1PTO H;  3RUZ A;  1YJW A;  3CU7 A;  3RLF A;  3U58 A;  2F0F A;  4DUY L;  1TXY A;  5K36 H;  1VQH A;  4R4T A;  2BE5 C;  4R9W A;  3TP6 A;  2L15 A;  4X3U A;  2E8G A;  3OYY A;  1KLG D;  3S1Q B;  3R3O A;  3GTP H;  4OEL B;  2QGQ A;  3VA5 A;  5G3L F;  1UUP A;  4LFA Q;  4JYA L;  4FDB A;  3HOU B;  4KHP L;  1U4L A;  2CWA A;  2B8F A;  4XT1 B;  5AJ3 L;  4JI5 Q;  3C1F A;  4OL7 A;  3SK8 A;  2E76 C;  3MAQ A;  2RVL A;  2B63 B;  4DR1 Q;  4A3B B;  1JOK A;  1A63 A;  4UY8 C;  2DNC A;  1YI2 A;  1W2B A;  3C1E A;  1L1O A;  1SNP A;  2JSO A;  3G7L A;  1K73 C;  3U50 C;  4PNY A;  1XWE A;  1Y8P B;  4YWM A;  1ICF B;  1YHA A;  1G6Z A;  4EQP A;  1XTC D;  1CKN A;  4C3H H;  2PQA A;  2JA5 G;  5I2X A;  1HNZ L;  1B9M A;  4FO2 A;  1STE A;  1V8Q A;  4NKL A;  3S15 B;  5KGU A;  2M2L A;  1UNS A;  3D4W A;  3QR8 A;  4UP7 A;  3I4N H;  2JA6 G;  2M9V A;  4DF7 A;  3FDT A;  2PW5 A;  2IL8 A;  5JJZ A;  2ZXR A;  1N36 Q;  4FF3 A;  1HHV A;  2KOL A;  3JAM c;  1PMR A;  3Q6S A;  4GNX C;  1YBY A;  3MFY A;  3PUZ A;  2ZJP A;  4LFB Q;  4N8X 1;  4ID6 A;  1PVO A;  2O5J C;  1DGS A;  2EJM A;  4OO1 I;  2F3I A;  1W6K A;  2CH4 A;  3NXW A;  4NMZ A;  5DEH A;  1L0W A;  3K5N A;  3GTM B;  4UP8 A;  2NB0 A;  2YU9 H;  2RSO A;  3QWN A;  4GLA C;  4ZUI A;  2IX0 A;  3HOW G;  1B50 A;  1NTG A;  2L1B A;  2MPM A;  5M3F B;  3QJY A;  3URY A;  2A68 D;  1E7Z A;  1UE6 A;  3HOX H;  2JA8 H;  1JOR A;  5ELO A;  3K58 A;  2KEC A;  3I4L A;  1BBX C;  4X65 L;  1CKN B;  1XMQ L;  2PQA B;  1HFN A;  1CI3 M;  4QQB X;  3H94 A;  3MTS A;  3K6O A;  4QJF A;  3CCV A;  3R2I A;  3BVM A;  1VQO A;  3MEF A;  4A3J G;  2DNE A;  2F0T A;  4OO1 H;  3OPO A;  3T1H Q;  4K6L A;  3ITP A;  1DOM A;  1IBL L;  1CA6 A;  4ZAI A;  4UHV A;  4U68 A;  3PO2 B;  2BA1 A;  2K5D A;  2E74 C;  2KUM A;  1Q3L A;  5KNB A;  1F9P A;  2OQ0 A;  2SNS A;  3H3V H;  3BZC A;  1K28 A;  2F03 A;  1EIH A;  4F88 A;  4GZY C;  1DM0 B;  4OX9 L;  5M3M B;  4AQY L;  2XSC A;  4A3D H;  2L12 A;  1QNU A;  5E4W C;  1JJC B;  3GTL B;  1S72 A;  3JAM E;  4HMJ A;  3P7J A;  1TII D;  5EBD A;  3PIO 3;  3FPU B;  4A76 A;  1N34 Q;  4A93 G;  4LMQ D;  2EQS A;  3NEM A;  3JC6 6;  4L6T B;  3W5O A;  5CV7 A;  2H4O A;  4EX5 A;  5CV6 A;  1JCK B;  3DWA A;  3KYH C;  2E2I B;  4A3F G;  4GOP A;  4GKK L;  4G4K A;  2F0K A;  3NEL A;  3G6J B;  1E1T A;  5GQO A;  2ZTC A;  4X62 Q;  3D4D A;  1PRT D;  3KBG A;  2LFN A;  1LM0 A;  4A3G G;  2F3V A;  1KL9 A;  1JB7 A;  3T51 B;  3X3N A;  4A3L G;  5I9O A;  1G2S A;  2A69 D;  5HUR A;  2C9O A;  4ZKC B;  2B63 H;  4KI0 A;  3TS0 A;  1YHB A;  3KF8 B;  5HGQ A;  1HH2 P;  3NSW A;  1SNM A;  5C0X I;  3S1N H;  1XNQ Q;  4P71 A;  1WFQ A;  4JBW A;  4ZK9 B;  1PH7 A;  1XPU A;  1Q90 A;  1SXT A;  2CVR A;  3A54 A;  3C2P A;  2XWB B;  3PSI A;  3P1H A;  4B3S Q;  4DV5 L;  1GUT A;  1WD0 A;  1GJX A;  3CF5 A;  2VY3 A;  3K59 A;  3SEB A;  1VQ4 A;  2FXQ A;  1HNW Q;  4IFD I;  1I50 H;  3P75 A;  1VMC A;  3ND9 A;  3ERS X;  3BG3 A;  3NTH A;  1DJR D;  5E1F A;  2UUB L;  3MVV A;  4TQU S;  1LT5 D;  4UPA A;  3FMC A;  4LUZ A;  1L2F A;  1XMO Q;  2TMP A;  1R4Q B;  4C3J G;  4GOP B;  2WIN B;  2F0L A;  4IFD H;  1TWH H;  2UXB Q;  3KLS A;  2UXD Q;  5JOB A;  2KEN A;  3A74 A;  2F0W A;  3CC7 A;  3AMU A;  1RTN A;  1Z47 A;  2PNR C;  3BYY B;  4X3T A;  2JJQ A;  2E5L Q;  1CTM A;  1RF2 D;  3KJO A;  3RN5 A;  5FLX c;  3GTM H;  5DNF A;  1D1I A;  1EOV A;  1N33 L;  3G71 A;  2R3Z A;  4Y7N H;  1ESR A;  1IKL A;  1L0X B;  1ZYR D;  2UUC Q;  4YCV A;  1A0I A;  4YHH Q;  1B70 B;  2N78 A;  3ER0 A;  4KK7 A;  3D0F A;  3GDE A;  1Y1V B;  4OWT B;  4BWG B;  4DR2 L;  2ASB A;  4OWX B;  5M5X H;  2B39 A;  5J22 A;  5FO7 B;  2P5Z X;  4J6H A;  4O1N A;  3L2P A;  2UU9 Q;  4A3M G;  3F2U A;  3RN2 A;  2BCO A;  2QKI C;  1PTO B;  2K5V A;  1PTO D;  2VZA A;  1A62 A;  2JEB I;  2LS0 1;  1I94 L;  5JJK A;  2OEO A;  4HN7 A;  1PA6 A;  1VQ8 A;  2VQF L;  4G7O C;  3R93 A;  2B2Y C;  3OIP A;  2R92 G;  4BXX H;  1SNO A;  4IUQ A;  4IPD A;  3NTK A;  3F8T A;  3P20 A;  3WOE A;  3M4P A;  1I94 Q;  4ABN A;  2Q8I B;  3GTO B;  2XGT A;  3DXJ C;  1S3O A;  4M1U B;  3RZD H;  2PPB C;  1U0L A;  2I07 B;  3S2D B;  2F1M A;  3STB C;  3S14 H;  3I72 A;  2MGS A;  2MNA A;  3M4O H;  1RTO A;  3FRP B;  1TQO A;  3PUY A;  3HOW H;  4ALP A;  4AYB G;  1HRJ A;  4OXP A;  3EIV A;  1UE1 A;  3FKI H;  3TRZ A;  2UUC L;  4BBS G;  1N33 Q;  3HG9 A;  3RR5 A;  1A6X A;  1I4Q A;  4G7Z C;  5K36 G;  1TVX A;  2N88 A;  5JAV A;  1K3B C;  4RGO S;  3PO3 B;  1FNW A;  1QWY A;  4GNX B;  1B8A A;  1TS2 A;  2R7Z H;  2B29 A;  4XQN A;  4OO1 G;  1B4O A;  4RA8 A;  3S17 H;  5M3F G;  1K0R A;  4LUV A;  2TSS A;  3HOU G;  1XMO L;  1X56 A;  2DJG C;  5D3I B;  2NN6 G;  1KLU D;  1K8M A;  1E2W A;  2K5H A;  5KYL A;  2WKC A;  4DV7 L;  2QW7 A;  3CRK C;  2XIW A;  3JAM i;  1O78 A;  2UUB Q;  4L63 B;  2HUG A;  1ILP A;  1X55 A;  2NVQ H;  1HTP A;  1NR4 A;  3Q8D A;  2JXM B;  4CBV A;  1DXM A;  1AZQ A;  5AFW A;  3KLR A;  1VQN A;  3KOJ A;  3B6Y A;  3DWQ A;  3K0X A;  2JN4 A;  2Q8T A;  4XXE A;  4DV5 Q;  4B3S L;  5FJ8 G;  2HHH Q;  2YTV A;  1A2T A;  1MSG A;  2YU9 B;  5EPJ A;  4JI0 L;  1KRS A;  3VR5 A;  4CKB A;  4A3K B;  4DAY A;  2IX3 A;  4JI3 L;  3J7A F;  1SYE A;  1XNQ L;  4IQZ A;  3GTG H;  1X3P A;  5IGE A;  2MO0 A;  1WTW A;  1IKM A;  2RDF A;  3PUW A;  5A2Q L;  1I4R A;  4R4Q A;  5NUC A;  2EYO A;  1VQ5 A;  4Y52 H;  2LMC B;  4EQO A;  2XWJ B;  4H0L C;  1XYI A;  3GTK H;  4GN5 A;  4P75 A;  3U4V A;  1SYC A;  3E9H A;  1PH2 A;  4CHT B;  2HDM A;  2B2Y A;  2CHB D;  1PH8 A;  1H9M A;  5C4J B;  2CW0 D;  5KND A;  1JE4 A;  2G5D A;  2DJF C;  1EYG A;  2E2J B;  3CCL A;  2SNM A;  2G9D A;  1S5B D;  2PI2 A;  5IT9 E;  4DR7 Q;  5EPL A;  1QVF A;  5COY A;  3MXN A;  2JA7 B;  3M3Y B;  1Y1W B;  4BY7 H;  1PFN A;  3EA6 A;  4DA2 A;  4AQY Q;  2R7D A;  4DR5 Q;  3OOC A;  4A3I H;  1W6J A;  1I6V C;  2EIF A;  1HZB A;  5FO9 B;  3QG1 A;  1C48 A;  1BQQ T;  3MEH A;  1Q8K A;  2YV5 A;  2JA7 G;  5IT9 L;  1VQK A;  3TP5 A;  3ULL A;  1IBL Q;  2Q2I A;  2KA7 A;  3T1H L;  2JA5 H;  4Y7N B;  3I4O A;  4QIW B;  5JVH 3;  3S2H B;  3ERQ A;  5C3E H;  3NPP A;  5EKK A;  2CQA A;  1NR2 A;  3PGZ A;  3GTO H;  2AWO A;  3NBI A;  1YJN A;  4JI1 Q;  1RIP A;  1XMQ Q;  2FFK B;  2MO1 A;  4X65 Q;  1G29 1;  2ATW A;  2JA8 B;  3VR3 A;  4K14 A;  1H9S A;  1ZYR C;  1TWF H;  4DV4 L;  5M5Y B;  3GTK B;  1C4Q A;  4LNQ A;  3A0J A;  2D9U A;  5EGT A;  1KXL A;  2XRS D;  4ZKB B;  4A3D G;  5ELN A;  3PO3 H;  1LTS D;  3CHB D;  1EU4 A;  5IYC G;  1BCP F;  1Y14 B;  1VF7 A;  1X3E A;  4B9W A;  4DUZ L;  2A74 C;  2RDG A;  1TWA B;  3ONA B;  3S16 B;  5IGC A;  1FGB D;  4XT3 B;  1Z9F A;  4BY1 G;  5C44 H;  4POF A;  4A3F B;  4O0A A;  3IAY A;  2NZ1 D;  1A3T A;  4Q0F A;  3PUV A;  3OIQ A;  1N36 L;  4QUF A;  5IGD A;  4RKB A;  1I4X A;  1YIT A;  4A3L H;  4UDU C;  2JA6 B;  4GOP C;  5FO8 B;  2B63 G;  2N55 A;  5J1Z A;  4XDX A;  5IP9 H;  4QUC A;  2IWH A;  3W1B A;  1STH A;  2V4D A;  2F0J A;  1DOL A;  1LUZ A;  4GN4 B;  3OW2 A;  3M9B A;  1HUM A;  5GRO A;  1X54 A;  4IPG A;  4LF8 L;  5IOC A;  2L55 A;  1YJ9 A;  1PFM A;  5I2Y A;  3M7N A;  1CQV A;  3DMU A;  2E2D C;  1U4P A;  2LXJ A;  4OGQ C;  2R93 G;  2UUA Q;  4JI4 Q;  1WOC A;  4WJ4 A;  5IYD G;  2F0M A;  2KHJ A;  3I2Z A;  1IBK L;  5AJ3 Q;  4BBR H;  3J7Z C;  2GA4 B;  5EKI A;  3J81 i;  3J7A 5;  1IHZ A;  5F2D A;  1OXS C;  1LAB A;  4LFA L;  4JYA Q;  3CCJ A;  4ZYS A;  2K7V A;  3NQT A;  2E2J H;  4NDX A;  5D65 A;  4POG A;  5IGF A;  1KDB A;  2F0U A;  4CJ2 C;  4DNT B;  3PO2 G;  3AFQ A;  1CSQ A;  4A3I G;  2AHO B;  4DUY Q;  3HOX G;  3UDI A;  4EQ5 A;  2DY7 A;  5HY6 A;  1QZH A;  1VQE A;  2PMZ E;  3D6W A;  2F0D A;  3I4N B;  3Q24 A;  1B2T A;  4CGY B;  4S3S A;  4ZQ3 A;  2NZH A;  3BU2 A;  3VA7 A;  2D0P A;  1HR0 L;  5C3X A;  5FJ8 H;  1K3R A;  1V9P A;  2C35 B;  1SSO A;  4A3D B;  2GVB A;  4DR4 L;  4HID A;  4HJ9 A;  2KJX A;  1S4Z A;  2OTL A;  2ALY B;  2QEJ C;  3NK9 A;  4HJ8 A;  2EPB A;  2WB1 E;  3MXU A;  2F0G A;  4MZ9 A;  3HOZ B;  2NVT H;  1YNJ D;  4MIU A;  4NXN L;  1NMF A;  3T1Y L;  4K5W A;  2WP8 J;  4AH6 A;  4DAM A;  1X3Q A;  2WAQ E;  4LFC Q;  1SJH D;  2KVM A;  3GTQ B;  1G6P A;  1STB A;  1X32 A;  2Z1C A;  1XJV A;  4EVO A;  2IJ0 A;  1K8O A;  4MTK A;  1XNR L;  4DPG A;  1PH1 A;  2OTJ A;  1QUQ B;  3ERO A;  1MD2 D;  3K57 A;  2NN6 I;  4DV0 L;  1D8L A;  2Z4H A;  4EQN A;  4JCV E;  1KNE A;  3CQZ B;  1NBW A;  2Z6K C;  3MZ5 A;  3I70 A;  2K03 A;  2J0T D;  3NUC A;  1PYB A;  1OTC A;  3BVZ A;  4RCN A;  4K0K L;  3I4M G;  3SK6 A;  1F77 A;  2N3S A;  1Z7T A;  1JJ2 A;  1ICW A;  2L11 A;  4ILW A;  1A8V A;  3I91 A;  1LTA D;  1PZJ D;  1L1O C;  1GVP A;  4WRD A;  2K28 A;  3OMG A;  1TS4 A;  1LTT D;  3FKI B;  4JPB W;  1N32 Q;  1STG A;  1DON A;  1JE5 A;  4P2C B;  2UXC L;  3HOZ H;  1UAP A;  4QIW E;  1LAC A;  3A56 A;  4JC0 A;  2IX1 A;  4CKC A;  5IGB A;  1BKB A;  3CCR A;  5LMU Q;  4DV2 L;  3MXP A;  4GLX A;  4KJN A;  1WYD A;  2VL6 A;  1C0A A;  1OO9 B;  1VQP A;  4B3T L;  3E6Z X;  4OEM B;  1EFI D;  3S15 H;  5IYC H;  4GN3 B;  1J5E L;  4BBR G;  4ULL A;  4HIK A;  1L0Y B;  4HAE A;  3C3L A;  1GUS A;  5BR8 L;  4GKJ Q;  3R2T A;  1U5K A;  3QB3 A;  3HOY G;  2NVX H;  4K8I A;  3GTL H;  1YNN D;  4IOA A;  4NXM Q;  1IYJ B;  3EFX D;  4KN4 C;  1IBM L;  5C4X H;  1GUG A;  1G2T A;  1I50 B;  3N6R A;  4AIM A;  1EFW A;  4CJ0 B;  1BCP B;  3HGB A;  1NSN S;  2XTI A;  5IP9 G;  1EQV A;  3GV3 A;  1M90 C;  1YNX A;  4QY7 A;  4J15 A;  3RLN A;  1X3G A;  4DKA C;  5C6A A;  1K83 B;  3J81 L;  1ASZ A;  2ZXO A;  5ELB A;  3RZD B;  2WAQ G;  4LF9 L;  3G4S A;  1TY0 A;  2MJ8 A;  4LF7 L;  3HOV H;  1QCB D;  4UAI A;  1KAB A;  4ME3 A;  4NW2 A;  3UI2 A;  4LF5 L;  5IGG A;  1CKM A;  2G9H D;  1F2M A;  1EYC A;  2H5X A;  1I6H H;  5IWA Q;  1N8R C;  4DV6 L;  1M1K C;  1BOS A;  3H15 A;  3CC4 A;  5CV5 A;  2ZM6 L;  1LTI D;  1WJJ A;  2DUD A;  3U9O A;  5IP7 H;  4KV6 A;  1VQ6 A;  3PQI A;  4A75 A;  3HS0 C;  1RJT A;  3E0E A;  1G8Z D;  3CD6 A;  3SK4 A;  1Y1W H;  4BY7 B;  4JI6 Q;  1MKH A;  2QEX A;  2D62 A;  3FKI G;  4F87 A;  4JBK A;  4X66 Q;  2VQE L;  1SDF A;  4BY1 B;  1B3A A;  5JJL A;  2O2L D;  1SE8 A;  5KNC A;  3K7U C;  5CV4 A;  5IE8 A;  5GAH C;  2IW3 A;  4DV3 L;  3TEH B;  3RZO H;  5FLM H;  3S1R B;  1IL8 A;  1M4V A;  1YEZ A;  2AQ1 B;  4OON A;  4KY6 A;  3UE0 A;  1EIY B;  1SMY D;  1WTR A;  1E24 A;  1UE5 A;  4DN4 M;  1KD1 C;  5M3F H;  1NMG A;  3LGJ A;  5BN4 A;  5KRU A;  1LYL A;  4MN3 A;  4LF4 L;  4L5Q A;  4IPC A;  1XXG A;  3SGI A;  1T5X D;  2C5C A;  1SFO B;  2JEA I;  4C3I B;  2AWN A;  5C44 G;  2EYJ A;  4IJL A;  4I65 A;  4CJ1 B;  1AZP A;  2EYH A;  3KK7 A;  3K7A B;  4F8M A;  3CCS A;  4DV1 Q;  5M9O A;  4OIK A;  2VUM G;  4PQX A;  2WB1 G;  1WTQ A;  4V19 0;  3LWU A;  3ULP A;  5CC4 A;  2VNU D;  1I4P A;  4JK1 C;  4JI2 L;  3SDZ A;  1E2V A;  1HA5 A;  4I7Z C;  3GTJ B;  5T1I A;  1X65 A;  2JP1 A;  5IYB H;  1EQT A;  2V1C C;  1KTK A;  5M5W H;  4A3E B;  1WCM H;  4DAY B;  4DGZ A;  2GN5 A;  2K4K A;  1ZKO A;  1KIX A;  4JI7 L;  2E2H H;  3IFD A;  1HNX L;  1HFG A;  4L5T A;  5C4X G;  1TWH B;  3KLS X;  1C8C A;  1WTO A;  4K8J A;  1IYU A;  2OT2 A;  4M8A A;  3EJI A;  4C3I G;  2KED A;  1B1Z A;  1STN A;  5IYD H;  4U67 3;  3L7Z C;  4IZ8 A;  5DLQ E;  1E1O A;  2K05 A;  3HEJ A;  2PCF B;  3KDF B;  3VR4 A;  4JOI A;  4KY5 A; 
#chains in the Genus database with same CATH homology
 1QVF A;  3UDF A;  3KLW A;  4A3C H;  3EN2 A;  4HJ5 A;  2N8N A;  4BY7 H;  4JI3 Q;  4LWC A;  4AQY Q;  2K75 A;  2R7D A;  4DR5 Q;  5M3M H;  1XPR A;  4APV A;  4A3K H;  2BA0 A;  4JI0 Q;  4JI2 Q;  2I5H A;  3CW2 C;  4A3I H;  1JMC A;  1K83 H;  2EIF A;  2HHH L;  4NXN Q;  1Q1B A;  1HZB A;  1PH3 A;  2B3G A;  2Q2H A;  3H3V I;  1C9O A;  2HIV A;  1BBW A;  2JA7 H;  3KFU A;  1VQ9 A;  1Q8K A;  2YV5 A;  2JA7 G;  1VQK A;  2ZJR A;  4C3J H;  3ULL A;  2NVY H;  1IBL Q;  2Q2I A;  3BJU A;  4R4C A;  3T1H L;  1GO3 E;  2JA5 H;  3I4O A;  4DV1 L;  4JI8 L;  4H02 A;  5C3E H;  3PGZ A;  5C3E G;  3NBH B;  3GTO H;  2AWO A;  1KQS A;  1YJN A;  1O7I A;  1HR0 Q;  4JI1 Q;  1RIP A;  2OQK A;  4DV7 Q;  1MJE A;  1XMQ Q;  2MO1 A;  4X65 Q;  1VQM A;  1G29 1;  1YJW A;  4LF6 L;  2ATW A;  3RLF A;  3U58 A;  1CSP A;  1TWC H;  4DUY L;  1TXY A;  1P16 A;  4DV4 L;  1TWF H;  1VQH A;  4R4T A;  4LNQ A;  3A0J A;  3CC2 A;  5GAG C;  2L15 A;  1KXL A;  4JV5 Q;  2E8G A;  2Z0S A;  3OYY A;  4A3D G;  5ELN A;  1FJG Q;  3PO3 H;  1R9T H;  3K81 C;  3GTP H;  3NEN A;  2A1A A;  5JJL A;  4DR3 Q;  5IYC G;  1Y14 B;  2QGQ A;  1X3E A;  2ZTD A;  4LFA Q;  4JYA L;  4FDB A;  2IY5 B;  4DUZ L;  4L5S A;  4RMF A;  2F4V Q;  5JEA G;  4KHP L;  1N9W A;  2CFM A;  2CWA A;  4BY1 G;  1Z9F A;  5C44 H;  3E9I A;  5AJ3 L;  4POF A;  1VQ7 A;  4JI5 Q;  2Q2U A;  4O0A A;  4DR1 Q;  3CMA A;  4JI6 L;  3HOV G;  4XIG S;  1IZ6 A;  5IT9 c;  4BY7 G;  1SN8 A;  1A63 A;  1QZG A;  4UY8 C;  1JJG A;  3PUV A;  3WWV A;  1GKH A;  4AYB E;  1YI2 A;  1W2B A;  1HZ9 A;  3PO2 H;  1L1O A;  1N36 L;  1AE3 A;  1K73 C;  5EAY A;  3U50 C;  1YIT A;  3CP0 A;  4A3L H;  5C4J H;  4GOP C;  1YHQ A;  4YWM A;  1IL2 A;  4YWK A;  2B63 G;  1YHA A;  1UE7 A;  1SLJ A;  1PH6 A;  1VQJ A;  1QUQ A;  5IP9 H;  3W1B A;  1CKN A;  4C3H H;  2PQA A;  1HZA A;  5IWA L;  2JA5 G;  2DGY A;  1LUZ A;  1HNZ L;  4GN4 B;  1AE2 A;  2D0O A;  3OW2 A;  2VQF Q;  3AQQ A;  1TWG H;  2WFW A;  4LF7 Q;  3M9B A;  2MFI A;  3FHW A;  5GRO A;  1X54 A;  4IPG A;  1T9H A;  4A3E G;  2BH2 A;  2K14 A;  2MQH A;  4LF8 L;  4UP7 A;  3PIP A;  1PHJ A;  3I4N H;  1BBU A;  3U4Z A;  4LF9 Q;  2JA6 G;  2HT1 A;  1YJ9 A;  2JA6 H;  3J80 c;  3M7N A;  1J6Q A;  1NY4 A;  2UU9 L;  1HZC A;  1N36 Q;  2LXJ A;  3CCQ A;  4JG2 A;  3JAM c;  4GNX C;  3AYH B;  2R93 G;  1YBY A;  2UUA Q;  4YCW A;  4DR2 Q;  4JI4 Q;  3PO3 G;  1OXX K;  1WOC A;  3PUZ A;  2IHF A;  5C0X J;  3H0G G;  4R1J A;  2ZJP A;  5IYD G;  4LFB Q;  4WJ4 A;  3UDX A;  2KHJ A;  3I2Z A;  4YHH L;  3UE1 A;  1IBK L;  5AJ3 Q;  4BBR H;  1P8L A;  1PVO A;  3J7Z C;  1K8G A;  2LXK A;  1DGS A;  3J81 i;  1HR0 W;  2F3I A;  3J7A 5;  4OO1 I;  1L0W A;  2F4V L;  4MTN A;  3HOU H;  1VS0 A;  4UP8 A;  1OXS C;  4JYA Q;  3PCO B;  4LFA L;  3CCJ A;  2YU9 H;  2K50 A;  4DR3 L;  4GLA C;  2E2J H;  2E5L L;  1FJG L;  2IX0 A;  1YIJ A;  1BVS A;  1C7Y A;  4POG A;  1NTG A;  2BH8 A;  3HOW G;  2JK8 A;  1NE3 A;  4JV5 L;  3PO2 G;  2JE6 I;  2VUM H;  2I5M X;  1PH9 A;  2KHI A;  2UXD L;  3AFQ A;  5BR8 Q;  4GKJ L;  1CSQ A;  4A3I G;  2AHO B;  2UXB L;  1G51 A;  4DUY Q;  3HOX G;  3UDI A;  4EQ5 A;  5HY6 A;  1K9M C;  1E7Z A;  1UE6 A;  3GD7 A;  1VQE A;  2PMZ E;  3HOX H;  1QZH A;  2Y0S G;  5ELO A;  2JA8 H;  4LF6 Q;  2NZH A;  4JOI C;  4X65 L;  1CKN B;  1XMQ L;  2PQA B;  3BU2 A;  1MIU A;  3I4M H;  2D0P A;  1HR0 L;  4QQB X;  3AFP A;  5FJ8 H;  1K3R A;  1V9P A;  1FVI A;  4QJF A;  3CCV A;  2C35 B;  1PH4 A;  2R7Z G;  2GVB A;  4P72 A;  4JI8 Q;  1VQO A;  4DR4 L;  4HID A;  4HJ9 A;  3MEF A;  4A3J G;  2RF4 A;  1QVC A;  3GTJ H;  1CKO A;  3I56 A;  5LMU L;  4DV2 Q;  3T1H Q;  2ZTE A;  5GAE C;  1HNW L;  2CQO A;  1IBL L;  1L1O B;  2OTL A;  1UEB A;  2ALY B;  1WCM G;  2BA1 A;  3F1Z A;  4A3E H;  4HJ8 A;  2WB1 E;  2A19 A;  4MZ9 A;  3PF5 A;  2NVT H;  3D31 A;  2OQ0 A;  3PF4 A;  4NXN L;  1NMF A;  1EQR A;  3BZC A;  4PZ6 A;  3H3V H;  3T1Y L;  2UXC Q;  1FGU A;  3KDF A;  2WP8 J;  3ICE A;  4OX9 L;  3M85 A;  4AQY L;  2R93 H;  4AH6 A;  4DAM A;  4IJH A;  1Y1V H;  4A3D H;  2WAQ E;  4LFC Q;  1QVG A;  2EXD A;  1JJC B;  1S72 A;  1SRO A;  4O2D A;  4JBM A;  1G6P A;  4LUO A;  4X64 L;  4A93 G;  4A76 A;  2YTX A;  1N34 Q;  1XJV A;  1SFO H;  4NPS A;  2EQS A;  3NEM A;  1TWA H;  1MJC A;  3JC6 6;  3W5O A;  1XNR L;  2R6G A;  3HFZ B;  1I3Q H;  4DK3 C;  4DPG A;  2RCN A;  1PH1 A;  4HJ7 A;  2OTJ A;  3TRE A;  1VQI A;  1X6O A;  4EX5 A;  1QUQ B;  3KYH C;  1KC8 C;  4A3F G;  4GOP A;  4GKK L;  4X62 L;  2NN6 I;  4DV0 L;  4A3B G;  1EWI A;  3NEL A;  5LMN W;  3K8A A;  4DV0 Q;  3ULJ A;  1D8L A;  2OCE A;  1E1T A;  5GQO A;  2ZTC A;  4JCV E;  4X62 Q;  4GKK Q;  1GD7 A;  4A3G H;  4R4O A;  1LM0 A;  1EIF A;  4A3G G;  3RNU A;  1KL9 A;  1NBW A;  2Z6K C;  1JB7 A;  4A3L G;  2JA8 G;  1XNR Q;  1HNX Q;  1PYB A;  1OTC A;  1XPO A;  1PYS B;  4IO9 A;  1VQB A;  2B63 H;  4KI0 A;  3TS0 A;  1V1Q A;  1YHB A;  1N34 L;  1EUJ A;  4JI7 Q;  3KF8 B;  2Z6K A;  5HGQ A;  2N3S A;  3I4M G;  1HH2 P;  3S1R H;  4OWW B;  1JJ2 A;  4LFC L;  4TVA B;  5C0X I;  1SR3 A;  3S1N H;  1A8V A;  1XNQ Q;  4P71 A;  5LMN L;  1L1O C;  1W3S A;  1WFQ A;  5GAD C;  4JBW A;  4KLK A;  1GVP A;  4OX9 Q;  1PH7 A;  1VQG A;  1XPU A;  1NJI C;  1N32 Q;  1PFS A;  3CME A;  3T1Y Q;  1JE5 A;  3PSI A;  4B3S Q;  4DR6 L;  2UXC L;  4DV5 L;  2GVA A;  3HOZ G;  4B3R Q;  4YY3 L;  3HOZ H;  4QIW E;  3CF5 A;  2VY3 A;  3IRB A;  1CUK A;  4JC0 A;  2IX1 A;  1VQ4 A;  2A8V A;  2FXQ A;  1HNW Q;  3ZJY C;  1FL0 A;  3M4Q A;  4IFD I;  1BKB A;  4IPH A;  1I50 H;  3CCR A;  3HKZ G;  5LMU Q;  4DV2 L;  4GLX A;  3DM3 A;  2JQO A;  5M3M G;  3ERS X;  5C0X G;  1WYD A;  4DR4 Q;  2VL6 A;  3PIO A;  1C0A A;  3MXN B;  1VQP A;  4B3T L;  2UUB L;  2HIX A;  3CQZ H;  4TQU S;  4DNI A;  3S15 H;  4A93 H;  3K80 C;  4GN3 B;  5IYC H;  4BBR G;  1J5E L;  2IHE A;  4UPA A;  4LUZ A;  4HIK A;  1EQQ A;  3F2B A;  1L2F A;  1Q82 C;  1XMO Q;  4LF4 Q;  4GOP B;  2UXB Q;  1TWH H;  4QGU A;  5BR8 L;  1Q81 C;  4GKJ Q;  2UXD Q;  5M5Y H;  2KEN A;  4XTC S;  1LTL A;  4BA2 I;  3A74 A;  1U5K A;  2Y0S E;  3CPF A;  3STB D;  3CC7 A;  4P74 A;  4R4I A;  1Z47 A;  4PZ7 A;  2JJQ A;  4A4I A;  4LW1 A;  2E5L Q;  3HOY H;  3PUX A;  3W1G A;  2K52 A;  3HOY G;  3KJO A;  1SRU A;  3RN5 A;  3J81 c;  2NVX H;  5FLX c;  1VCI A;  3GTL H;  3GTM H;  4IOA A;  2K5N A;  4DV3 Q;  3GO5 A;  4NXM Q;  1IYJ B;  1RL2 A;  1EOV A;  1IBM L;  1N33 L;  3EBE A;  5C4X H;  3G71 A;  4B3M L;  4Y7N H;  3J81 j;  2UUC Q;  4AIM A;  1EFW A;  4YCV A;  1A0I A;  4X66 L;  4YHH Q;  2VQE Q;  1B70 B;  4IOC A;  4P73 A;  1IBK Q;  2N78 A;  3ER0 A;  4LFB L;  3GTQ H;  2PI2 E;  2XTI A;  3D0F A;  3GDE A;  4PZ8 A;  5IP9 G;  4OWT B;  4DR2 L;  1K8A C;  1M90 C;  1YNX A;  2UUA L;  4QY7 A;  4JI4 L;  2VW9 A;  2ASB A;  4OWX B;  5M5X H;  1SMX A;  4J15 A;  1X3G A;  3RLN A;  4DKA C;  3L2P A;  2RHS B;  1ASZ A;  2UU9 Q;  1IXR A;  4A3M G;  1VQL A;  2WAQ G;  3RN2 A;  4NB3 A;  3CXC A;  3G4S A;  3BZK A;  4LF9 L;  4LF8 Q;  2I5L X;  2K5V A;  2VZA A;  2I0Q A;  1A62 A;  2JEB I;  2ZM6 Q;  4K0K L;  1I94 L;  5JJK A;  4LF7 L;  1VQ8 A;  1PA6 A;  3OTO Q;  5H1S E;  4DV6 Q;  3HOV H;  4ME3 A;  3TQY A;  3TS2 A;  2VQF L;  4LF5 L;  2R92 H;  4BXX G;  1CKM A;  1HNZ Q;  3S2H H;  2H5X A;  2YYZ A;  2LSS A;  4PMW A;  2R92 G;  4BXX H;  1I6H H;  4IPD A;  5IWA Q;  1N8R C;  4LF5 Q;  1Y1V G;  3F8T A;  2IT1 A;  4DV6 L;  3OTO L;  1JT8 A;  4GS3 A;  4UP9 A;  1M1K C;  1VQF A;  2PNH A;  3M4P A;  3H15 A;  1I94 Q;  4YCU A;  3CC4 A;  2ZM6 L;  2XGT A;  4C2M H;  1WJJ A;  4WJ3 M;  2ZJQ A;  1S3O A;  3RZD H;  3CCE A;  2DUD A;  5IP7 G;  4IFD G;  5IP7 H;  1U0L A;  1X9N A;  2F52 A;  1VQ6 A;  3STB C;  3CAM A;  2JA9 A;  5JEA J;  3G6E A;  4A75 A;  3S14 H;  3E0E A;  4X6A H;  1X3F A;  3CD6 A;  3M4O H;  2MNA A;  4GNX A;  4A3F H;  1Y1W H;  5IYB G;  3M3Y H;  4A3B H;  1Y1W G;  4JI6 Q;  3PUY A;  1MKH A;  2N49 A;  4DR1 L;  3HOW H;  2QEX A;  4ALP A;  2D62 A;  3FKI G;  4AYB G;  4OXP A;  1WI5 A;  3CCU A;  3EIV A;  1UE1 A;  3FKI H;  4JI5 L;  4X66 Q;  2VQE L;  3TRZ A;  4BBS H;  2UUC L;  4L5R C;  1SE8 A;  4DK6 C;  3S16 H;  4HJA A;  3KF6 A;  3I4N G;  4BBS G;  1H95 A;  2AMC B;  3K7U C;  4B3M Q;  5IE8 A;  4KHP Q;  5GAH C;  1IBM Q;  1N33 Q;  1AH9 A;  1HJP A;  3RR5 A;  4DUZ Q;  4DV3 L;  4NXM L;  3TEH B;  2ID0 A;  1KAW A;  3RZO H;  1Q12 A;  1YZ6 A;  3K7A H;  5K36 G;  3S2D H;  5FLM H;  2CKZ B;  5FLM G;  3G48 A;  1YEZ A;  5JJI A;  3RLO A;  3CCM A;  1KHI A;  4C3I H;  4HIM A;  2OWO A;  4OON A;  5E7N A;  4GNX B;  3UE0 A;  1B8A A;  3H0G H;  2KCM A;  1EIY B;  2B29 A;  2R7Z H;  1E24 A;  2AKW B;  3AEV A;  1UE5 A;  4OO1 G;  4PG3 A;  1KD1 C;  5M3F H;  4DV4 Q;  3S17 H;  1NMG A;  1Q1E A;  3LGJ A;  5M3F G;  4A3M H;  1PH5 A;  1K0R A;  4LUV A;  1VQD A;  1LYL A;  3HOU G;  1XMO L;  4L5Q A;  4LF4 L;  4IFD J;  4IPC A;  3J80 i;  1X56 A;  3UDG A;  3SGI A;  1OXV A;  4QL5 A;  2NN6 G;  2JEA I;  2AWN A;  5C44 G;  5J3B A;  2K5H A;  1J5E Q;  4JBK A;  1OXT A;  4DV7 L;  4IJL A;  4JI1 L;  4RG1 A;  4YWL A;  3JAM i;  5IY0 A;  3HKZ E;  2UUB Q;  4B3T Q;  3F2D A;  3A5U A;  4A3C G;  3CCS A;  4DV1 Q;  1X55 A;  2NVQ H;  1Q7Y C;  2VUM G;  2WB1 G;  3I7F A;  3Q8D A;  4A3K G;  4GLV B;  4HIO A;  1KRT A;  1VQN A;  4BA1 I;  1Q86 C;  3KOJ A;  3B6Y A;  3ULP A;  3K0X A;  2VNU D;  4YY3 Q;  3A5Z B;  3CPW A;  4B3R L;  1I5F A;  1VQA A;  4DV5 Q;  3S1M H;  4DR6 Q;  1VQC A;  4B3S L;  4MNO A;  5FJ8 G;  3VDY A;  2HQL A;  2HHH Q;  1N32 L;  2YTV A;  2CWP A;  3S24 A;  4JI2 L;  2R7F A;  2KBN A;  4JI0 L;  1KRS A;  4A3J H;  1YVC A;  4DR5 L;  3L0O A;  2YTY A;  5LMN Q;  4JI3 L;  1X65 A;  5IYB H;  1XNQ L;  2V1C C;  3GTG H;  5M5W H;  2MO0 A;  1PV4 A;  1WCM H;  4DAY B;  2GN5 A;  2K4K A;  2VS1 A;  4DR7 L;  3PUW A;  4KHZ A;  1S40 A;  1KIX A;  4JI7 L;  2E2H H;  4K0K Q;  2ES2 A;  4R4Q A;  4JBJ A;  2QA4 A;  1V43 A;  2NZO A;  1VQ5 A;  3PV0 A;  1HNX L;  4Y52 H;  3I55 A;  1B7Y B;  4L5T A;  5C4X G;  1OXU A;  3GTK H;  4GN5 A;  4P75 A;  3U4V A;  1XTD A;  1Q46 A;  3E9H A;  1PH2 A;  3KJP A;  2Q2T A;  3S1Q H;  1PH8 A;  1E3P A;  1D7Q A;  2KCT A;  2E2I H;  5IYD H;  3HKS A;  1E22 A;  1ASY A;  3F2C A;  3L7Z C;  2RHQ B;  3DLL A;  1UWV A;  3KF6 B;  1E1O A;  5DLQ E;  1GM5 A;  2CCZ A;  3KDF B;  1EYG A;  3CCL A;  4BY1 H;  4DR7 Q;  2PI2 A;  4JOI A;  3FP9 A;  4X64 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...