2MOUA

Solution structure of star-related lipid transfer domain protein 6 (stard6)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
220
Chain Sequence
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords StAR-related lipid transfer protein 6
total genus 49
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2mouA00
4B9RA 3NEFA 3TVRA 2E3PA 3KL1A 5JO2A 1LLTA 4N0GC 3IE5A 2K5GA 2LEQA 4A84A 4QIPA 2I9YA 1XFSA 2QIMA 3RT2A 4A86A 2L65A 1B6FA 2A1LA 4REIA 3NI8A 2LF2A 2E3RA 2BK0A 4N3EA 2WQLA 1T27A 4M9WA 4BKCA 4GY9A 3W9RA 3OH8A 3WG8A 5AMWA 1XDFA 2E3SA 1VJHA 2N4AA 2LIOA 2E3OA 3OQUA 5E4BA 2E3MA 1IFVA 2LDKA 3PU2A 3RD6A 3JRQB 3P0LA 4OICA 1XN5A 4LG5A 2LPXA 3ELIA 2MOUA 3UIDA 2KCZA 4LGAA 3P9VA 4LA7A 4IGXA 2QPVA 2FFSA 1QMRA 1KCMA 4IHRA 3NMPA 4IGVA 1EM2A 4JHHA 4MA6A 3FO5A 1FM4A 2LCGA 5BRLA 1BV1A 4BKDA 2IL5A 3C0VA 2Z9YA 3KAYA 4LGBA 4FPWA 4IH0A 3OTLA 3F08A 1XUVA 4A8UA 2M47A 1ZXFA 4DSBA 2N4BA 3JRSA 1X53A 2LE1A 5JO1A 1E09A 3Q6AA 1JSSA 2NS9A 3NR4A 3KB0A 4IH2A 3TVQA 4A81A 5JNNA 4IGYA 4REJA 2EJXA 1H2OA 3KLXA 4REHA 3NMNA 3NMHA 1LN2A 3KDHA 5E4MA 2VQ5A 2Z9ZA 3W9KA 4A83A 2PCSA 1Z94A 5I9JA 4DSCA 4C94A 3K3KA 4BTZA 3QSZA 4JHIA 5I8FA 3NJ1A 3NJOA 3NJ0A 2FLHA 4BK7A 2R55A 2D4RA 4PSBA 1FSKA 3NMTA 3IJTA 3NS2A 4BK6A 3KDIA 4JDAA 3NEGA 4JDLA 3P51A 2RESA 2PSOA 4C9CA 2LGHA 3NMVA 4MNSA 4Z3LA 4DS8A 4R7KA 3UQHA 3H3QA 3CNWA 3QN1A 3E85A 2KEWA 3Q63A 3UJLA 4WVOA 2L8OA 4A8VA 2NN5A 4A80A 2KTEA 4M9BA 3OJIA 3KAZA 4A85A 3PUTA 2KF2A 4RYVA 4XRWA 2LAKA 3H3SA 3R6PA 4C9IA 3RT0C 4Y31A 1T17A 3K90A 1LN1A 2M89A 4A88A 3TL1A 5E46A 3GGNA 3H3TA 1TXCA 2GKDA 1UW5A 3KB3A 2E3QA 4Q0KA 2VNEA 4A8GA 1BTVA 3TFZA 1LN3A 2RERA 4A87A 3ZVUA 2Q3QA 1XN6A 1TW0A 4IGWA 4MAPA 2REZA 2K7HA 3Q64A 5E4DA 5C9YA 2E3NA 2LUZA 4JHGA 1ICXA 3KDJA 4XRTA 3H3RA 2L9PA
chains in the Genus database with same CATH superfamily
4B9RA 3NEFA 3TVRA 2E3PA 3KL1A 5JO2A 1LLTA 4N0GC 3IE5A 2K5GA 2LEQA 4A84A 4QIPA 2I9YA 1XFSA 2QIMA 3RT2A 4A86A 2L65A 3HK2A 1B6FA 4N47A 2A1LA 4REIA 3NI8A 3HM9A 3HXMA 2LF2A 2E3RA 2BK0A 4E6FA 2LAFA 4N3EA 2WQLA 1T27A 4M9WA 4BKCA 4GY9A 3W9RA 3OH8A 3WG8A 5AMWA 1XDFA 2E3SA 3F73A 1VJHA 2N4AA 2LIOA 2E3OA 3OQUA 5E4BA 2E3MA 1IFVA 2LDKA 3PU2A 3RD6A 3JRQB 3GB4A 3P0LA 4OICA 1XN5A 4LG5A 2LPXA 3ELIA 2MOUA 3UIDA 4NCAA 2KCZA 4LGAA 3GKEA 3P9VA 4LA7A 4IGXA 2QPVA 2FFSA 1QMRA 1KCMA 4IHRA 3NMPA 4IGVA 1EM2A 4JHHA 4MA6A 3GOBA 3GL0A 3FO5A 1FM4A 2LCGA 5BRLA 1BV1A 4BKDA 2IL5A 3C0VA 2Z9YA 3KAYA 4LGBA 3GL2A 4FPWA 4IH0A 3OTLA 4QDDA 3F08A 4QDFB 3HVRA 1XUVA 4A8UA 2M47A 3TGOC 1ZXFA 2YH6A 4DSBA 2N4BA 3JRSA 1X53A 2LE1A 5JO1A 1E09A 3Q6AA 1JSSA 3NQNA 2NS9A 3NR4A 3KB0A 4IH2A 3TVQA 4A81A 5JNNA 4IGYA 4REJA 2EJXA 4QDFA 1H2OA 3KLXA 4REHA 3NMNA 4QDCA 3NMHA 1LN2A 2ZYLA 3KDHA 5E4MA 3DLBA 2VQ5A 3DLHA 2Z9ZA 3GTEA 3W9KA 4A83A 2PCSA 1Z94A 4N76A 5I9JA 4DSCA 4C94A 3K3KA 4BTZA 3QSZA 4JHIA 5I8FA 3NJ1A 3NJOA 3NJ0A 3HJFA 2FLHA 4BK7A 2R55A 2D4RA 4PSBA 1FSKA 3NMTA 3IJTA 3NS2A 4BK6A 3KDIA 4JDAA 3NEGA 4JDLA 3P51A 2RESA 2PSOA 4C9CA 2LGHA 3NMVA 4MNSA 4Z3LA 5EKQC 4DS8A 4R7KA 3UQHA 4JHYA 3H3QA 3CNWA 3QN1A 3E85A 2KEWA 3Q63A 3UJLA 4WVOA 2L8OA 4A8VA 2NN5A 4A80A 2KTEA 4N41A 4M9BA 3OJIA 3KAZA 4A85A 3PUTA 2KF2A 4RYVA 4XRWA 2LAKA 3H3SA 3R6PA 4C9IA 3RT0C 4Y31A 1T17A 3K90A 1LN1A 2M89A 4A88A 3TL1A 4KPYA 5E46A 3GGNA 3H3TA 1TXCA 2GKDA 1UW5A 3KB3A 2E3QA 4Q0KA 2VNEA 4A8GA 1BTVA 3TFZA 1LN3A 2RERA 4A87A 3ZVUA 2Q3QA 1XN6A 1TW0A 4IGWA 4MAPA 2REZA 2K7HA 3Q64A 5E4DA 3HO1A 5C9YA 2E3NA 2LUZA 4JHGA 4QCKA 1ICXA 3KDJA 4XRTA 4NCBA 3GTSA 3H3RA 2L9PA
chains in the Genus database with same CATH topology
4B9RA 3NEFA 3TVRA 2E3PA 3KL1A 5JO2A 1LLTA 4N0GC 3IE5A 2K5GA 2LEQA 4A84A 4QIPA 2I9YA 1XFSA 2QIMA 3RT2A 4A86A 2L65A 3HK2A 1B6FA 4N47A 2A1LA 4REIA 3NI8A 3HM9A 3HXMA 2LF2A 2E3RA 2BK0A 4E6FA 2LAFA 4N3EA 2WQLA 1T27A 4M9WA 4BKCA 4GY9A 3W9RA 3OH8A 3WG8A 5AMWA 1XDFA 2E3SA 3F73A 1VJHA 2N4AA 2LIOA 2E3OA 3OQUA 5E4BA 2E3MA 1IFVA 2LDKA 3PU2A 3RD6A 3JRQB 3GB4A 3P0LA 4OICA 1XN5A 4LG5A 2LPXA 3ELIA 2MOUA 3UIDA 4NCAA 2KCZA 4LGAA 3GKEA 3P9VA 4LA7A 4IGXA 2QPVA 2FFSA 1QMRA 1KCMA 4IHRA 3NMPA 4IGVA 1EM2A 4JHHA 4MA6A 3GOBA 3GL0A 3FO5A 1FM4A 2LCGA 5BRLA 1BV1A 4BKDA 2IL5A 3C0VA 2Z9YA 3KAYA 4LGBA 3GL2A 4FPWA 4IH0A 3OTLA 4QDDA 3F08A 4QDFB 3HVRA 1XUVA 4A8UA 2M47A 3TGOC 1ZXFA 2YH6A 4DSBA 2N4BA 3JRSA 1X53A 2LE1A 5JO1A 1E09A 3Q6AA 1JSSA 3NQNA 2NS9A 3NR4A 3KB0A 4IH2A 3TVQA 4A81A 5JNNA 4IGYA 4REJA 2EJXA 4QDFA 1H2OA 3KLXA 4REHA 3NMNA 4QDCA 3NMHA 1LN2A 2ZYLA 3KDHA 5E4MA 3DLBA 2VQ5A 3DLHA 2Z9ZA 3GTEA 3W9KA 4A83A 2PCSA 1Z94A 4N76A 5I9JA 4DSCA 4C94A 3K3KA 4BTZA 3QSZA 4JHIA 5I8FA 3NJ1A 3NJOA 3NJ0A 3HJFA 2FLHA 4BK7A 2R55A 2D4RA 4PSBA 1FSKA 3NMTA 3IJTA 3NS2A 4BK6A 3KDIA 4JDAA 3NEGA 4JDLA 3P51A 2RESA 2PSOA 4C9CA 2LGHA 3NMVA 4MNSA 4Z3LA 5EKQC 4DS8A 4R7KA 3UQHA 4JHYA 3H3QA 3CNWA 3QN1A 3E85A 2KEWA 3Q63A 3UJLA 4WVOA 2L8OA 4A8VA 2NN5A 4A80A 2KTEA 4N41A 4M9BA 3OJIA 3KAZA 4A85A 3PUTA 2KF2A 4RYVA 4XRWA 2LAKA 3H3SA 3R6PA 4C9IA 3RT0C 4Y31A 1T17A 3K90A 1LN1A 2M89A 4A88A 3TL1A 4KPYA 5E46A 3GGNA 3H3TA 1TXCA 2GKDA 1UW5A 3KB3A 2E3QA 4Q0KA 2VNEA 4A8GA 1BTVA 3TFZA 1LN3A 2RERA 4A87A 3ZVUA 2Q3QA 1XN6A 1TW0A 4IGWA 4MAPA 2REZA 2K7HA 3Q64A 5E4DA 3HO1A 5C9YA 2E3NA 2LUZA 4JHGA 4QCKA 1ICXA 3KDJA 4XRTA 4NCBA 3GTSA 3H3RA 2L9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9R A;  3NEF A;  3TVR A;  2E3P A;  3KL1 A;  5JO2 A;  1LLT A;  4N0G C;  3IE5 A;  2K5G A;  2LEQ A;  4A84 A;  4QIP A;  2I9Y A;  1XFS A;  2QIM A;  3RT2 A;  4A86 A;  2L65 A;  1B6F A;  2A1L A;  4REI A;  3NI8 A;  2LF2 A;  2E3R A;  2BK0 A;  4N3E A;  2WQL A;  1T27 A;  4M9W A;  4BKC A;  4GY9 A;  3W9R A;  3OH8 A;  3WG8 A;  5AMW A;  1XDF A;  2E3S A;  1VJH A;  2N4A A;  2LIO A;  2E3O A;  3OQU A;  5E4B A;  2E3M A;  1IFV A;  2LDK A;  3PU2 A;  3RD6 A;  3JRQ B;  3P0L A;  4OIC A;  1XN5 A;  4LG5 A;  2LPX A;  3ELI A;  2MOU A;  3UID A;  2KCZ A;  4LGA A;  3P9V A;  4LA7 A;  4IGX A;  2QPV A;  2FFS A;  1QMR A;  1KCM A;  4IHR A;  3NMP A;  4IGV A;  1EM2 A;  4JHH A;  4MA6 A;  3FO5 A;  1FM4 A;  2LCG A;  5BRL A;  1BV1 A;  4BKD A;  2IL5 A;  3C0V A;  2Z9Y A;  3KAY A;  4LGB A;  4FPW A;  4IH0 A;  3OTL A;  3F08 A;  1XUV A;  4A8U A;  2M47 A;  1ZXF A;  4DSB A;  2N4B A;  3JRS A;  1X53 A;  2LE1 A;  5JO1 A;  1E09 A;  3Q6A A;  1JSS A;  2NS9 A;  3NR4 A;  3KB0 A;  4IH2 A;  3TVQ A;  4A81 A;  5JNN A;  4IGY A;  4REJ A;  2EJX A;  1H2O A;  3KLX A;  4REH A;  3NMN A;  3NMH A;  1LN2 A;  3KDH A;  5E4M A;  2VQ5 A;  2Z9Z A;  3W9K A;  4A83 A;  2PCS A;  1Z94 A;  5I9J A;  4DSC A;  4C94 A;  3K3K A;  4BTZ A;  3QSZ A;  4JHI A;  5I8F A;  3NJ1 A;  3NJO A;  3NJ0 A;  2FLH A;  4BK7 A;  2R55 A;  2D4R A;  4PSB A;  1FSK A;  3NMT A;  3IJT A;  3NS2 A;  4BK6 A;  3KDI A;  4JDA A;  3NEG A;  4JDL A;  3P51 A;  2RES A;  2PSO A;  4C9C A;  2LGH A;  3NMV A;  4MNS A;  4Z3L A;  4DS8 A;  4R7K A;  3UQH A;  3H3Q A;  3CNW A;  3QN1 A;  3E85 A;  2KEW A;  3Q63 A;  3UJL A;  4WVO A;  2L8O A;  4A8V A;  2NN5 A;  4A80 A;  2KTE A;  4M9B A;  3OJI A;  3KAZ A;  4A85 A;  3PUT A;  2KF2 A;  4RYV A;  4XRW A;  2LAK A;  3H3S A;  3R6P A;  4C9I A;  3RT0 C;  4Y31 A;  1T17 A;  3K90 A;  1LN1 A;  2M89 A;  4A88 A;  3TL1 A;  5E46 A;  3GGN A;  3H3T A;  1TXC A;  2GKD A;  1UW5 A;  3KB3 A;  2E3Q A;  4Q0K A;  2VNE A;  4A8G A;  1BTV A;  3TFZ A;  1LN3 A;  2RER A;  4A87 A;  3ZVU A;  2Q3Q A;  1XN6 A;  1TW0 A;  4IGW A;  4MAP A;  2REZ A;  2K7H A;  3Q64 A;  5E4D A;  5C9Y A;  2E3N A;  2LUZ A;  4JHG A;  1ICX A;  3KDJ A;  4XRT A;  3H3R A;  2L9P A; 
#chains in the Genus database with same CATH topology
 4B9R A;  3NEF A;  3TVR A;  2E3P A;  3KL1 A;  5JO2 A;  1LLT A;  4N0G C;  3IE5 A;  2K5G A;  2LEQ A;  4A84 A;  4QIP A;  2I9Y A;  1XFS A;  2QIM A;  3RT2 A;  4A86 A;  2L65 A;  3HK2 A;  1B6F A;  4N47 A;  2A1L A;  4REI A;  3NI8 A;  3HM9 A;  3HXM A;  2LF2 A;  2E3R A;  2BK0 A;  4E6F A;  2LAF A;  4N3E A;  2WQL A;  1T27 A;  4M9W A;  4BKC A;  4GY9 A;  3W9R A;  3OH8 A;  3WG8 A;  5AMW A;  1XDF A;  2E3S A;  3F73 A;  1VJH A;  2N4A A;  2LIO A;  2E3O A;  3OQU A;  5E4B A;  2E3M A;  1IFV A;  2LDK A;  3PU2 A;  3RD6 A;  3JRQ B;  3GB4 A;  3P0L A;  4OIC A;  1XN5 A;  4LG5 A;  2LPX A;  3ELI A;  2MOU A;  3UID A;  4NCA A;  2KCZ A;  4LGA A;  3GKE A;  3P9V A;  4LA7 A;  4IGX A;  2QPV A;  2FFS A;  1QMR A;  1KCM A;  4IHR A;  3NMP A;  4IGV A;  1EM2 A;  4JHH A;  4MA6 A;  3GOB A;  3GL0 A;  3FO5 A;  1FM4 A;  2LCG A;  5BRL A;  1BV1 A;  4BKD A;  2IL5 A;  3C0V A;  2Z9Y A;  3KAY A;  4LGB A;  3GL2 A;  4FPW A;  4IH0 A;  3OTL A;  4QDD A;  3F08 A;  4QDF B;  3HVR A;  1XUV A;  4A8U A;  2M47 A;  3TGO C;  1ZXF A;  2YH6 A;  4DSB A;  2N4B A;  3JRS A;  1X53 A;  2LE1 A;  5JO1 A;  1E09 A;  3Q6A A;  1JSS A;  3NQN A;  2NS9 A;  3NR4 A;  3KB0 A;  4IH2 A;  3TVQ A;  4A81 A;  5JNN A;  4IGY A;  4REJ A;  2EJX A;  4QDF A;  1H2O A;  3KLX A;  4REH A;  3NMN A;  4QDC A;  3NMH A;  1LN2 A;  2ZYL A;  3KDH A;  5E4M A;  3DLB A;  2VQ5 A;  3DLH A;  2Z9Z A;  3GTE A;  3W9K A;  4A83 A;  2PCS A;  1Z94 A;  4N76 A;  5I9J A;  4DSC A;  4C94 A;  3K3K A;  4BTZ A;  3QSZ A;  4JHI A;  5I8F A;  3NJ1 A;  3NJO A;  3NJ0 A;  3HJF A;  2FLH A;  4BK7 A;  2R55 A;  2D4R A;  4PSB A;  1FSK A;  3NMT A;  3IJT A;  3NS2 A;  4BK6 A;  3KDI A;  4JDA A;  3NEG A;  4JDL A;  3P51 A;  2RES A;  2PSO A;  4C9C A;  2LGH A;  3NMV A;  4MNS A;  4Z3L A;  5EKQ C;  4DS8 A;  4R7K A;  3UQH A;  4JHY A;  3H3Q A;  3CNW A;  3QN1 A;  3E85 A;  2KEW A;  3Q63 A;  3UJL A;  4WVO A;  2L8O A;  4A8V A;  2NN5 A;  4A80 A;  2KTE A;  4N41 A;  4M9B A;  3OJI A;  3KAZ A;  4A85 A;  3PUT A;  2KF2 A;  4RYV A;  4XRW A;  2LAK A;  3H3S A;  3R6P A;  4C9I A;  3RT0 C;  4Y31 A;  1T17 A;  3K90 A;  1LN1 A;  2M89 A;  4A88 A;  3TL1 A;  4KPY A;  5E46 A;  3GGN A;  3H3T A;  1TXC A;  2GKD A;  1UW5 A;  3KB3 A;  2E3Q A;  4Q0K A;  2VNE A;  4A8G A;  1BTV A;  3TFZ A;  1LN3 A;  2RER A;  4A87 A;  3ZVU A;  2Q3Q A;  1XN6 A;  1TW0 A;  4IGW A;  4MAP A;  2REZ A;  2K7H A;  3Q64 A;  5E4D A;  3HO1 A;  5C9Y A;  2E3N A;  2LUZ A;  4JHG A;  4QCK A;  1ICX A;  3KDJ A;  4XRT A;  4NCB A;  3GTS A;  3H3R A;  2L9P A; 
#chains in the Genus database with same CATH homology
 4B9R A;  3NEF A;  3TVR A;  2E3P A;  3KL1 A;  5JO2 A;  1LLT A;  4N0G C;  3IE5 A;  2K5G A;  2LEQ A;  4A84 A;  4QIP A;  2I9Y A;  1XFS A;  2QIM A;  3RT2 A;  4A86 A;  2L65 A;  3HK2 A;  1B6F A;  4N47 A;  2A1L A;  4REI A;  3NI8 A;  3HM9 A;  3HXM A;  2LF2 A;  2E3R A;  2BK0 A;  4E6F A;  2LAF A;  4N3E A;  2WQL A;  1T27 A;  4M9W A;  4BKC A;  4GY9 A;  3W9R A;  3OH8 A;  3WG8 A;  5AMW A;  1XDF A;  2E3S A;  3F73 A;  1VJH A;  2N4A A;  2LIO A;  2E3O A;  3OQU A;  5E4B A;  2E3M A;  1IFV A;  2LDK A;  3PU2 A;  3RD6 A;  3JRQ B;  3GB4 A;  3P0L A;  4OIC A;  1XN5 A;  4LG5 A;  2LPX A;  3ELI A;  2MOU A;  3UID A;  4NCA A;  2KCZ A;  4LGA A;  3GKE A;  3P9V A;  4LA7 A;  4IGX A;  2QPV A;  2FFS A;  1QMR A;  1KCM A;  4IHR A;  3NMP A;  4IGV A;  1EM2 A;  4JHH A;  4MA6 A;  3GOB A;  3GL0 A;  3FO5 A;  1FM4 A;  2LCG A;  5BRL A;  1BV1 A;  4BKD A;  2IL5 A;  3C0V A;  2Z9Y A;  3KAY A;  4LGB A;  3GL2 A;  4FPW A;  4IH0 A;  3OTL A;  4QDD A;  3F08 A;  4QDF B;  3HVR A;  1XUV A;  4A8U A;  2M47 A;  3TGO C;  1ZXF A;  2YH6 A;  4DSB A;  2N4B A;  3JRS A;  1X53 A;  2LE1 A;  5JO1 A;  1E09 A;  3Q6A A;  1JSS A;  3NQN A;  2NS9 A;  3NR4 A;  3KB0 A;  4IH2 A;  3TVQ A;  4A81 A;  5JNN A;  4IGY A;  4REJ A;  2EJX A;  4QDF A;  1H2O A;  3KLX A;  4REH A;  3NMN A;  4QDC A;  3NMH A;  1LN2 A;  2ZYL A;  3KDH A;  5E4M A;  3DLB A;  2VQ5 A;  3DLH A;  2Z9Z A;  3GTE A;  3W9K A;  4A83 A;  2PCS A;  1Z94 A;  4N76 A;  5I9J A;  4DSC A;  4C94 A;  3K3K A;  4BTZ A;  3QSZ A;  4JHI A;  5I8F A;  3NJ1 A;  3NJO A;  3NJ0 A;  3HJF A;  2FLH A;  4BK7 A;  2R55 A;  2D4R A;  4PSB A;  1FSK A;  3NMT A;  3IJT A;  3NS2 A;  4BK6 A;  3KDI A;  4JDA A;  3NEG A;  4JDL A;  3P51 A;  2RES A;  2PSO A;  4C9C A;  2LGH A;  3NMV A;  4MNS A;  4Z3L A;  5EKQ C;  4DS8 A;  4R7K A;  3UQH A;  4JHY A;  3H3Q A;  3CNW A;  3QN1 A;  3E85 A;  2KEW A;  3Q63 A;  3UJL A;  4WVO A;  2L8O A;  4A8V A;  2NN5 A;  4A80 A;  2KTE A;  4N41 A;  4M9B A;  3OJI A;  3KAZ A;  4A85 A;  3PUT A;  2KF2 A;  4RYV A;  4XRW A;  2LAK A;  3H3S A;  3R6P A;  4C9I A;  3RT0 C;  4Y31 A;  1T17 A;  3K90 A;  1LN1 A;  2M89 A;  4A88 A;  3TL1 A;  4KPY A;  5E46 A;  3GGN A;  3H3T A;  1TXC A;  2GKD A;  1UW5 A;  3KB3 A;  2E3Q A;  4Q0K A;  2VNE A;  4A8G A;  1BTV A;  3TFZ A;  1LN3 A;  2RER A;  4A87 A;  3ZVU A;  2Q3Q A;  1XN6 A;  1TW0 A;  4IGW A;  4MAP A;  2REZ A;  2K7H A;  3Q64 A;  5E4D A;  3HO1 A;  5C9Y A;  2E3N A;  2LUZ A;  4JHG A;  4QCK A;  1ICX A;  3KDJ A;  4XRT A;  4NCB A;  3GTS A;  3H3R A;  2L9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...