2MOUA

Solution structure of star-related lipid transfer domain protein 6 (stard6)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
220
Chain Sequence
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords StAR-related lipid transfer protein 6
publication title Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 49
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2mouA00
3IJTA 1LN1A 2LPXA 1VJHA 4BTZA 2N4AA 3NJ0A 3OTLA 2REZA 3JRSA 1IFVA 4A84A 4B9RA 4C9CA 3W9RA 1XFSA 1LN3A 1XN6A 4M9BA 4JHIA 3FO5A 5E46A 3P0LA 3KAZA 4C94A 2KF2A 3PUTA 3RT0C 4A81A 1H2OA 4M9WA 4MAPA 4IGXA 4BKDA 4LGAA 2IL5A 3K90A 4Q0KA 2MOUA 3NR4A 4GY9A 3ELIA 2LF2A 3NEFA 4A87A 4OICA 2A1LA 2VQ5A 3F08A 2R55A 2E3PA 3KLXA 4IGVA 2E3NA 3H3SA 2BK0A 3JRQB 4IHRA 3RD6A 2K7HA 4LG5A 4REJA 2LGHA 4REIA 5E4MA 3OJIA 4FPWA 3UQHA 3TVRA 4LA7A 3NJOA 3Q63A 4BK6A 2KEWA 5I8FA 4JDLA 2E3QA 3P9VA 3KL1A 4A8UA 3NMTA 4N3EA 3KDIA 3NMPA 2E3SA 5E4DA 4JHGA 4A80A 2K5GA 4Y31A 4BK7A 3QN1A 3UJLA 3GGNA 3H3TA 2RESA 3H3RA 2I9YA 4DS8A 1UW5A 2EJXA 2L65A 4A8VA 3H3QA 3R6PA 4IGWA 3ZVUA 4XRTA 5C9YA 3W9KA 2LEQA 3NMNA 2PSOA 1LLTA 1T27A 4IH0A 1QMRA 3K3KA 1FSKA 4RYVA 3Q64A 4MNSA 4C9IA 1LN2A 2Z9YA 1T17A 2Z9ZA 1XN5A 1FM4A 5JNNA 3KB0A 2E3OA 4A8GA 3RT2A 1XDFA 5JO2A 3IE5A 2LCGA 1JSSA 4DSBA 3NS2A 2FLHA 4WVOA 3NJ1A 1TW0A 5AMWA 4A85A 1KCMA 1B6FA 2M47A 1XUVA 2NS9A 4R7KA 3TL1A 2LUZA 3TFZA 3KDHA 3QSZA 3CNWA 4A88A 1ICXA 4A83A 4BKCA 2VNEA 2M89A 2L9PA 3TVQA 4LGBA 3NI8A 3PU2A 1E09A 5JO1A 2L8OA 1BV1A 1TXCA 5BRLA 3Q6AA 2LIOA 5I9JA 4DSCA 4QIPA 3NMHA 4PSBA 1X53A 2KTEA 3NMVA 2LAKA 3UIDA 3OH8A 2GKDA 2E3MA 4IH2A 4IGYA 2FFSA 5E4BA 2E3RA 4JDAA 2RERA 2D4RA 2Q3QA 3NEGA 4MA6A 1Z94A 4N0GC 3KDJA 4JHHA 4XRWA 4Z3LA 2KCZA 2N4BA 3E85A 2WQLA 3WG8A 1BTVA 2LDKA 2LE1A 3KB3A 2QPVA 1ZXFA 1EM2A 2NN5A 2PCSA 3P51A 3OQUA 2QIMA 3KAYA 4REHA 3C0VA 4A86A
chains in the Genus database with same CATH superfamily
3IJTA 1LN1A 2LPXA 1VJHA 4BTZA 2N4AA 3NJ0A 3OTLA 2REZA 3GTSA 4Z3LA 3JRSA 1IFVA 4A84A 4B9RA 4C9CA 3W9RA 3HK2A 1XFSA 1LN3A 1XN6A 4M9BA 4JHIA 3FO5A 4QDFB 5E46A 3P0LA 3KAZA 3NQNA 4C94A 3HVRA 3DLBA 2KF2A 4KPYA 3PUTA 3RT0C 4A81A 1H2OA 4M9WA 4MAPA 4IGXA 4QDFA 4QDDA 4BKDA 4LGAA 2IL5A 3K90A 4Q0KA 2MOUA 3NR4A 4GY9A 3ELIA 3GTEA 2LF2A 3NEFA 4A87A 4OICA 2A1LA 4N47A 2VQ5A 3GKEA 3F08A 2R55A 2E3PA 3KLXA 4IGVA 2E3NA 3H3SA 2BK0A 3JRQB 4IHRA 3RD6A 3HJFA 2K7HA 4LG5A 4REJA 2LGHA 4REIA 5E4MA 3OJIA 4FPWA 3UQHA 3TVRA 4LA7A 3NJOA 3Q63A 4BK6A 2KEWA 5I8FA 4N41A 4JDLA 2E3QA 3P9VA 3KL1A 4A8UA 3NMTA 4N3EA 3KDIA 3NMPA 2E3SA 5E4DA 4JHGA 4A80A 2K5GA 4Y31A 4JHYA 4BK7A 3QN1A 3UJLA 3GGNA 3H3TA 2RESA 3H3RA 2I9YA 4DS8A 1UW5A 2EJXA 3GOBA 2L65A 4A8VA 3H3QA 3R6PA 4IGWA 3ZVUA 4QDCA 4XRTA 5C9YA 3W9KA 2LEQA 3NMNA 2PSOA 1LLTA 1T27A 4IH0A 1QMRA 3K3KA 1FSKA 4RYVA 3Q64A 3TGOC 4MNSA 4C9IA 1LN2A 3GL0A 2Z9YA 1T17A 2Z9ZA 1XN5A 1FM4A 5JNNA 3KB0A 2E3OA 4A8GA 4NCAA 3RT2A 1XDFA 5JO2A 3IE5A 2LCGA 1JSSA 4DSBA 3NS2A 2FLHA 4WVOA 3NJ1A 1TW0A 4N76A 5AMWA 3HO1A 4A85A 1KCMA 1B6FA 2M47A 1XUVA 3F73A 2NS9A 4R7KA 3TL1A 2LUZA 3TFZA 3KDHA 4NCBA 3QSZA 3CNWA 4A88A 1ICXA 4A83A 4BKCA 2VNEA 2LAFA 2M89A 2ZYLA 2L9PA 3TVQA 4QCKA 4LGBA 3GB4A 3NI8A 3PU2A 1E09A 5JO1A 2L8OA 3HM9A 1BV1A 1TXCA 5BRLA 5EKQC 3Q6AA 2LIOA 5I9JA 4DSCA 4QIPA 3NMHA 3GL2A 1X53A 4PSBA 2KTEA 3NMVA 2LAKA 3UIDA 3OH8A 2GKDA 3DLHA 2E3MA 4IH2A 4IGYA 2FFSA 5E4BA 2E3RA 4JDAA 2RERA 2D4RA 2Q3QA 3NEGA 4MA6A 1Z94A 2YH6A 3KDJA 4JHHA 4N0GC 4XRWA 4E6FA 2KCZA 2N4BA 3E85A 2WQLA 3HXMA 3WG8A 1BTVA 2LDKA 2LE1A 3KB3A 2QPVA 1ZXFA 2PCSA 1EM2A 2NN5A 3P51A 3OQUA 2QIMA 3KAYA 4REHA 3C0VA 4A86A
chains in the Genus database with same CATH topology
3IJTA 1LN1A 2LPXA 1VJHA 4BTZA 2N4AA 3NJ0A 3OTLA 2REZA 3GTSA 4Z3LA 3JRSA 1IFVA 4A84A 4B9RA 4C9CA 3W9RA 3HK2A 1XFSA 1LN3A 1XN6A 4M9BA 4JHIA 3FO5A 4QDFB 5E46A 3P0LA 3KAZA 3NQNA 4C94A 3HVRA 3DLBA 2KF2A 4KPYA 3PUTA 3RT0C 4A81A 1H2OA 4M9WA 4MAPA 4IGXA 4QDFA 4QDDA 4BKDA 4LGAA 2IL5A 3K90A 4Q0KA 2MOUA 3NR4A 4GY9A 3ELIA 3GTEA 2LF2A 3NEFA 4A87A 4OICA 2A1LA 4N47A 2VQ5A 3GKEA 3F08A 2R55A 2E3PA 3KLXA 4IGVA 2E3NA 3H3SA 2BK0A 3JRQB 4IHRA 3RD6A 3HJFA 2K7HA 4LG5A 4REJA 2LGHA 4REIA 5E4MA 3OJIA 4FPWA 3UQHA 3TVRA 4LA7A 3NJOA 3Q63A 4BK6A 2KEWA 5I8FA 4N41A 4JDLA 2E3QA 3P9VA 3KL1A 4A8UA 3NMTA 4N3EA 3KDIA 3NMPA 2E3SA 5E4DA 4JHGA 4A80A 2K5GA 4Y31A 4JHYA 4BK7A 3QN1A 3UJLA 3GGNA 3H3TA 2RESA 3H3RA 2I9YA 4DS8A 1UW5A 2EJXA 3GOBA 2L65A 4A8VA 3H3QA 3R6PA 4IGWA 3ZVUA 4QDCA 4XRTA 5C9YA 3W9KA 2LEQA 3NMNA 2PSOA 1LLTA 1T27A 4IH0A 1QMRA 3K3KA 1FSKA 4RYVA 3Q64A 3TGOC 4MNSA 4C9IA 1LN2A 3GL0A 2Z9YA 1T17A 2Z9ZA 1XN5A 1FM4A 5JNNA 3KB0A 2E3OA 4A8GA 4NCAA 3RT2A 1XDFA 5JO2A 3IE5A 2LCGA 1JSSA 4DSBA 3NS2A 2FLHA 4WVOA 3NJ1A 1TW0A 4N76A 5AMWA 3HO1A 4A85A 1KCMA 1B6FA 2M47A 1XUVA 3F73A 2NS9A 4R7KA 3TL1A 2LUZA 3TFZA 3KDHA 4NCBA 3QSZA 3CNWA 4A88A 1ICXA 4A83A 4BKCA 2VNEA 2LAFA 2M89A 2ZYLA 2L9PA 3TVQA 4QCKA 4LGBA 3GB4A 3NI8A 3PU2A 1E09A 5JO1A 2L8OA 3HM9A 1BV1A 1TXCA 5BRLA 5EKQC 3Q6AA 2LIOA 5I9JA 4DSCA 4QIPA 3NMHA 3GL2A 1X53A 4PSBA 2KTEA 3NMVA 2LAKA 3UIDA 3OH8A 2GKDA 3DLHA 2E3MA 4IH2A 4IGYA 2FFSA 5E4BA 2E3RA 4JDAA 2RERA 2D4RA 2Q3QA 3NEGA 4MA6A 1Z94A 2YH6A 3KDJA 4JHHA 4N0GC 4XRWA 4E6FA 2KCZA 2N4BA 3E85A 2WQLA 3HXMA 3WG8A 1BTVA 2LDKA 2LE1A 3KB3A 2QPVA 1ZXFA 2PCSA 1EM2A 2NN5A 3P51A 3OQUA 2QIMA 3KAYA 4REHA 3C0VA 4A86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJT A;  1LN1 A;  2LPX A;  1VJH A;  4BTZ A;  2N4A A;  3NJ0 A;  3OTL A;  2REZ A;  3JRS A;  1IFV A;  4A84 A;  4B9R A;  4C9C A;  3W9R A;  1XFS A;  1LN3 A;  1XN6 A;  4M9B A;  4JHI A;  3FO5 A;  5E46 A;  3P0L A;  3KAZ A;  4C94 A;  2KF2 A;  3PUT A;  3RT0 C;  4A81 A;  1H2O A;  4M9W A;  4MAP A;  4IGX A;  4BKD A;  4LGA A;  2IL5 A;  3K90 A;  4Q0K A;  2MOU A;  3NR4 A;  4GY9 A;  3ELI A;  2LF2 A;  3NEF A;  4A87 A;  4OIC A;  2A1L A;  2VQ5 A;  3F08 A;  2R55 A;  2E3P A;  3KLX A;  4IGV A;  2E3N A;  3H3S A;  2BK0 A;  3JRQ B;  4IHR A;  3RD6 A;  2K7H A;  4LG5 A;  4REJ A;  2LGH A;  4REI A;  5E4M A;  3OJI A;  4FPW A;  3UQH A;  3TVR A;  4LA7 A;  3NJO A;  3Q63 A;  4BK6 A;  2KEW A;  5I8F A;  4JDL A;  2E3Q A;  3P9V A;  3KL1 A;  4A8U A;  3NMT A;  4N3E A;  3KDI A;  3NMP A;  2E3S A;  5E4D A;  4JHG A;  4A80 A;  2K5G A;  4Y31 A;  4BK7 A;  3QN1 A;  3UJL A;  3GGN A;  3H3T A;  2RES A;  3H3R A;  2I9Y A;  4DS8 A;  1UW5 A;  2EJX A;  2L65 A;  4A8V A;  3H3Q A;  3R6P A;  4IGW A;  3ZVU A;  4XRT A;  5C9Y A;  3W9K A;  2LEQ A;  3NMN A;  2PSO A;  1LLT A;  1T27 A;  4IH0 A;  1QMR A;  3K3K A;  1FSK A;  4RYV A;  3Q64 A;  4MNS A;  4C9I A;  1LN2 A;  2Z9Y A;  1T17 A;  2Z9Z A;  1XN5 A;  1FM4 A;  5JNN A;  3KB0 A;  2E3O A;  4A8G A;  3RT2 A;  1XDF A;  5JO2 A;  3IE5 A;  2LCG A;  1JSS A;  4DSB A;  3NS2 A;  2FLH A;  4WVO A;  3NJ1 A;  1TW0 A;  5AMW A;  4A85 A;  1KCM A;  1B6F A;  2M47 A;  1XUV A;  2NS9 A;  4R7K A;  3TL1 A;  2LUZ A;  3TFZ A;  3KDH A;  3QSZ A;  3CNW A;  4A88 A;  1ICX A;  4A83 A;  4BKC A;  2VNE A;  2M89 A;  2L9P A;  3TVQ A;  4LGB A;  3NI8 A;  3PU2 A;  1E09 A;  5JO1 A;  2L8O A;  1BV1 A;  1TXC A;  5BRL A;  3Q6A A;  2LIO A;  5I9J A;  4DSC A;  4QIP A;  3NMH A;  4PSB A;  1X53 A;  2KTE A;  3NMV A;  2LAK A;  3UID A;  3OH8 A;  2GKD A;  2E3M A;  4IH2 A;  4IGY A;  2FFS A;  5E4B A;  2E3R A;  4JDA A;  2RER A;  2D4R A;  2Q3Q A;  3NEG A;  4MA6 A;  1Z94 A;  4N0G C;  3KDJ A;  4JHH A;  4XRW A;  4Z3L A;  2KCZ A;  2N4B A;  3E85 A;  2WQL A;  3WG8 A;  1BTV A;  2LDK A;  2LE1 A;  3KB3 A;  2QPV A;  1ZXF A;  1EM2 A;  2NN5 A;  2PCS A;  3P51 A;  3OQU A;  2QIM A;  3KAY A;  4REH A;  3C0V A;  4A86 A; 
#chains in the Genus database with same CATH topology
 3IJT A;  1LN1 A;  2LPX A;  1VJH A;  4BTZ A;  2N4A A;  3NJ0 A;  3OTL A;  2REZ A;  3GTS A;  4Z3L A;  3JRS A;  1IFV A;  4A84 A;  4B9R A;  4C9C A;  3W9R A;  3HK2 A;  1XFS A;  1LN3 A;  1XN6 A;  4M9B A;  4JHI A;  3FO5 A;  4QDF B;  5E46 A;  3P0L A;  3KAZ A;  3NQN A;  4C94 A;  3HVR A;  3DLB A;  2KF2 A;  4KPY A;  3PUT A;  3RT0 C;  4A81 A;  1H2O A;  4M9W A;  4MAP A;  4IGX A;  4QDF A;  4QDD A;  4BKD A;  4LGA A;  2IL5 A;  3K90 A;  4Q0K A;  2MOU A;  3NR4 A;  4GY9 A;  3ELI A;  3GTE A;  2LF2 A;  3NEF A;  4A87 A;  4OIC A;  2A1L A;  4N47 A;  2VQ5 A;  3GKE A;  3F08 A;  2R55 A;  2E3P A;  3KLX A;  4IGV A;  2E3N A;  3H3S A;  2BK0 A;  3JRQ B;  4IHR A;  3RD6 A;  3HJF A;  2K7H A;  4LG5 A;  4REJ A;  2LGH A;  4REI A;  5E4M A;  3OJI A;  4FPW A;  3UQH A;  3TVR A;  4LA7 A;  3NJO A;  3Q63 A;  4BK6 A;  2KEW A;  5I8F A;  4N41 A;  4JDL A;  2E3Q A;  3P9V A;  3KL1 A;  4A8U A;  3NMT A;  4N3E A;  3KDI A;  3NMP A;  2E3S A;  5E4D A;  4JHG A;  4A80 A;  2K5G A;  4Y31 A;  4JHY A;  4BK7 A;  3QN1 A;  3UJL A;  3GGN A;  3H3T A;  2RES A;  3H3R A;  2I9Y A;  4DS8 A;  1UW5 A;  2EJX A;  3GOB A;  2L65 A;  4A8V A;  3H3Q A;  3R6P A;  4IGW A;  3ZVU A;  4QDC A;  4XRT A;  5C9Y A;  3W9K A;  2LEQ A;  3NMN A;  2PSO A;  1LLT A;  1T27 A;  4IH0 A;  1QMR A;  3K3K A;  1FSK A;  4RYV A;  3Q64 A;  3TGO C;  4MNS A;  4C9I A;  1LN2 A;  3GL0 A;  2Z9Y A;  1T17 A;  2Z9Z A;  1XN5 A;  1FM4 A;  5JNN A;  3KB0 A;  2E3O A;  4A8G A;  4NCA A;  3RT2 A;  1XDF A;  5JO2 A;  3IE5 A;  2LCG A;  1JSS A;  4DSB A;  3NS2 A;  2FLH A;  4WVO A;  3NJ1 A;  1TW0 A;  4N76 A;  5AMW A;  3HO1 A;  4A85 A;  1KCM A;  1B6F A;  2M47 A;  1XUV A;  3F73 A;  2NS9 A;  4R7K A;  3TL1 A;  2LUZ A;  3TFZ A;  3KDH A;  4NCB A;  3QSZ A;  3CNW A;  4A88 A;  1ICX A;  4A83 A;  4BKC A;  2VNE A;  2LAF A;  2M89 A;  2ZYL A;  2L9P A;  3TVQ A;  4QCK A;  4LGB A;  3GB4 A;  3NI8 A;  3PU2 A;  1E09 A;  5JO1 A;  2L8O A;  3HM9 A;  1BV1 A;  1TXC A;  5BRL A;  5EKQ C;  3Q6A A;  2LIO A;  5I9J A;  4DSC A;  4QIP A;  3NMH A;  3GL2 A;  1X53 A;  4PSB A;  2KTE A;  3NMV A;  2LAK A;  3UID A;  3OH8 A;  2GKD A;  3DLH A;  2E3M A;  4IH2 A;  4IGY A;  2FFS A;  5E4B A;  2E3R A;  4JDA A;  2RER A;  2D4R A;  2Q3Q A;  3NEG A;  4MA6 A;  1Z94 A;  2YH6 A;  3KDJ A;  4JHH A;  4N0G C;  4XRW A;  4E6F A;  2KCZ A;  2N4B A;  3E85 A;  2WQL A;  3HXM A;  3WG8 A;  1BTV A;  2LDK A;  2LE1 A;  3KB3 A;  2QPV A;  1ZXF A;  2PCS A;  1EM2 A;  2NN5 A;  3P51 A;  3OQU A;  2QIM A;  3KAY A;  4REH A;  3C0V A;  4A86 A; 
#chains in the Genus database with same CATH homology
 3IJT A;  1LN1 A;  2LPX A;  1VJH A;  4BTZ A;  2N4A A;  3NJ0 A;  3OTL A;  2REZ A;  3GTS A;  4Z3L A;  3JRS A;  1IFV A;  4A84 A;  4B9R A;  4C9C A;  3W9R A;  3HK2 A;  1XFS A;  1LN3 A;  1XN6 A;  4M9B A;  4JHI A;  3FO5 A;  4QDF B;  5E46 A;  3P0L A;  3KAZ A;  3NQN A;  4C94 A;  3HVR A;  3DLB A;  2KF2 A;  4KPY A;  3PUT A;  3RT0 C;  4A81 A;  1H2O A;  4M9W A;  4MAP A;  4IGX A;  4QDF A;  4QDD A;  4BKD A;  4LGA A;  2IL5 A;  3K90 A;  4Q0K A;  2MOU A;  3NR4 A;  4GY9 A;  3ELI A;  3GTE A;  2LF2 A;  3NEF A;  4A87 A;  4OIC A;  2A1L A;  4N47 A;  2VQ5 A;  3GKE A;  3F08 A;  2R55 A;  2E3P A;  3KLX A;  4IGV A;  2E3N A;  3H3S A;  2BK0 A;  3JRQ B;  4IHR A;  3RD6 A;  3HJF A;  2K7H A;  4LG5 A;  4REJ A;  2LGH A;  4REI A;  5E4M A;  3OJI A;  4FPW A;  3UQH A;  3TVR A;  4LA7 A;  3NJO A;  3Q63 A;  4BK6 A;  2KEW A;  5I8F A;  4N41 A;  4JDL A;  2E3Q A;  3P9V A;  3KL1 A;  4A8U A;  3NMT A;  4N3E A;  3KDI A;  3NMP A;  2E3S A;  5E4D A;  4JHG A;  4A80 A;  2K5G A;  4Y31 A;  4JHY A;  4BK7 A;  3QN1 A;  3UJL A;  3GGN A;  3H3T A;  2RES A;  3H3R A;  2I9Y A;  4DS8 A;  1UW5 A;  2EJX A;  3GOB A;  2L65 A;  4A8V A;  3H3Q A;  3R6P A;  4IGW A;  3ZVU A;  4QDC A;  4XRT A;  5C9Y A;  3W9K A;  2LEQ A;  3NMN A;  2PSO A;  1LLT A;  1T27 A;  4IH0 A;  1QMR A;  3K3K A;  1FSK A;  4RYV A;  3Q64 A;  3TGO C;  4MNS A;  4C9I A;  1LN2 A;  3GL0 A;  2Z9Y A;  1T17 A;  2Z9Z A;  1XN5 A;  1FM4 A;  5JNN A;  3KB0 A;  2E3O A;  4A8G A;  4NCA A;  3RT2 A;  1XDF A;  5JO2 A;  3IE5 A;  2LCG A;  1JSS A;  4DSB A;  3NS2 A;  2FLH A;  4WVO A;  3NJ1 A;  1TW0 A;  4N76 A;  5AMW A;  3HO1 A;  4A85 A;  1KCM A;  1B6F A;  2M47 A;  1XUV A;  3F73 A;  2NS9 A;  4R7K A;  3TL1 A;  2LUZ A;  3TFZ A;  3KDH A;  4NCB A;  3QSZ A;  3CNW A;  4A88 A;  1ICX A;  4A83 A;  4BKC A;  2VNE A;  2LAF A;  2M89 A;  2ZYL A;  2L9P A;  3TVQ A;  4QCK A;  4LGB A;  3GB4 A;  3NI8 A;  3PU2 A;  1E09 A;  5JO1 A;  2L8O A;  3HM9 A;  1BV1 A;  1TXC A;  5BRL A;  5EKQ C;  3Q6A A;  2LIO A;  5I9J A;  4DSC A;  4QIP A;  3NMH A;  3GL2 A;  1X53 A;  4PSB A;  2KTE A;  3NMV A;  2LAK A;  3UID A;  3OH8 A;  2GKD A;  3DLH A;  2E3M A;  4IH2 A;  4IGY A;  2FFS A;  5E4B A;  2E3R A;  4JDA A;  2RER A;  2D4R A;  2Q3Q A;  3NEG A;  4MA6 A;  1Z94 A;  2YH6 A;  3KDJ A;  4JHH A;  4N0G C;  4XRW A;  4E6F A;  2KCZ A;  2N4B A;  3E85 A;  2WQL A;  3HXM A;  3WG8 A;  1BTV A;  2LDK A;  2LE1 A;  3KB3 A;  2QPV A;  1ZXF A;  2PCS A;  1EM2 A;  2NN5 A;  3P51 A;  3OQU A;  2QIM A;  3KAY A;  4REH A;  3C0V A;  4A86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...