2MOUA

Solution structure of star-related lipid transfer domain protein 6 (stard6)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
220
structure length
220
Chain Sequence
b'MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords StAR-related lipid transfer protein 6
publication title Solution structure of StAR-related lipid transfer domain protein 6 (STARD6)
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 49
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01852 START START domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2mouA00
2LUZA 2N4AA 4OICA 2VNEA 4A8VA 3H3RA 4IGYA 4JHIA 1LLTA 3K90A 3Q6AA 4N0GC 1XUVA 4B9RA 3W9RA 4FPWA 2I9YA 3KB0A 2QIMA 5C9YA 4Y31A 3W9KA 4Z3LA 2IL5A 2FLHA 3IE5A 3QN1A 2Z9ZA 3C0VA 3H3QA 4A84A 3NJ1A 3OH8A 2M47A 1FSKA 3JRQB 2KF2A 2LCGA 3JRSA 1ZXFA 3TVRA 3KL1A 3IJTA 3NMTA 1XDFA 1EM2A 4JDAA 1KCMA 3WG8A 2KEWA 2A1LA 2Z9YA 3Q63A 3UJLA 5I9JA 4IH2A 2Q3QA 2R55A 3FO5A 4JHGA 2LGHA 3KDIA 4IH0A 3GGNA 4R7KA 4BKDA 1TW0A 3PUTA 4JDLA 1FM4A 1LN3A 2E3PA 1QMRA 3TVQA 3R6PA 4REHA 1H2OA 4C9IA 4LGBA 4M9BA 4A81A 5E4BA 2E3NA 4XRTA 1VJHA 2BK0A 2NS9A 4A83A 1X53A 2E3OA 4IGVA 3NMHA 3PU2A 2LF2A 4REIA 1E09A 4A85A 3KB3A 2PSOA 4XRWA 4DSBA 2REZA 4BK7A 4A88A 1Z94A 3P0LA 4DSCA 4DS8A 2L65A 3KDHA 3UIDA 5E46A 2D4RA 1XN5A 3RT0C 3KLXA 2LPXA 3E85A 4N3EA 4QIPA 3OQUA 3RT2A 4REJA 2E3SA 4MNSA 3NR4A 4BTZA 1UW5A 3NMPA 3KAZA 1B6FA 1LN2A 2LDKA 3CNWA 3KDJA 2RERA 3NI8A 3TL1A 4C94A 5JO1A 2NN5A 4C9CA 5I8FA 4A8UA 3NMNA 2GKDA 2MOUA 2E3QA 3P9VA 5AMWA 3ELIA 3KAYA 4IGXA 3NMVA 1XN6A 3UQHA 2LAKA 4GY9A 1LN1A 1XFSA 4IGWA 4A86A 3P51A 4WVOA 4IHRA 4MAPA 1T17A 3OJIA 4JHHA 1TXCA 3NJ0A 2KCZA 2L8OA 4A8GA 1BV1A 4LA7A 2LIOA 2KTEA 4RYVA 1JSSA 2K7HA 4PSBA 1ICXA 2N4BA 2WQLA 3H3SA 1T27A 4Q0KA 4A80A 3H3TA 2L9PA 3OTLA 2RESA 4A87A 5JO2A 1IFVA 3QSZA 4BKCA 3TFZA 2QPVA 3NS2A 5E4DA 5E4MA 3NEFA 2PCSA 4MA6A 5JNNA 4LGAA 4BK6A 3NJOA 2LEQA 4M9WA 4LG5A 2LE1A 2E3MA 2VQ5A 3RD6A 2E3RA 5BRLA 3K3KA 3F08A 2K5GA 3ZVUA 2EJXA 2FFSA 1BTVA 2M89A 3Q64A 3NEGA
chains in the Genus database with same CATH superfamily
2LUZA 2N4AA 4OICA 2VNEA 4A8VA 3H3RA 4IGYA 4JHIA 1LLTA 3K90A 3Q6AA 4N0GC 1XUVA 3HM9A 4B9RA 3W9RA 4FPWA 2I9YA 3KB0A 2QIMA 5C9YA 4Y31A 4QDFA 3W9KA 4Z3LA 2IL5A 2FLHA 3IE5A 3QN1A 2Z9ZA 3C0VA 3H3QA 4NCAA 4QDDA 3NJ1A 4A84A 3OH8A 3HJFA 2M47A 1FSKA 3JRQB 2KF2A 2LCGA 3JRSA 1ZXFA 3TVRA 3KL1A 3DLBA 4N47A 3IJTA 3NMTA 3GOBA 1XDFA 1EM2A 4JDAA 1KCMA 3F73A 3WG8A 2KEWA 2A1LA 3GKEA 4QCKA 2Z9YA 3Q63A 3UJLA 5I9JA 4IH2A 2Q3QA 2R55A 3FO5A 4JHGA 4QDCA 2LGHA 3KDIA 4E6FA 4IH0A 3GGNA 4JHYA 4R7KA 4N41A 4BKDA 1TW0A 3PUTA 3GL0A 4JDLA 1FM4A 1LN3A 2E3PA 1QMRA 2ZYLA 3R6PA 3TVQA 4REHA 1H2OA 4C9IA 4LGBA 4M9BA 4A81A 5E4BA 2E3NA 4XRTA 1VJHA 2BK0A 2NS9A 3HXMA 4A83A 1X53A 2E3OA 4IGVA 3NMHA 3PU2A 2LF2A 4REIA 1E09A 3TGOC 4A85A 3KB3A 3NQNA 2PSOA 3DLHA 4XRWA 4DSBA 2REZA 4BK7A 4A88A 1Z94A 3P0LA 4DSCA 4DS8A 2L65A 3KDHA 3UIDA 5E46A 2D4RA 1XN5A 3RT0C 3KLXA 2LPXA 3E85A 4N3EA 3HVRA 4N76A 4QIPA 3OQUA 3RT2A 4REJA 2E3SA 4MNSA 3NR4A 4BTZA 1UW5A 3NMPA 3KAZA 1B6FA 1LN2A 2LDKA 3CNWA 3KDJA 2RERA 3NI8A 3TL1A 4C94A 5EKQC 3HK2A 5JO1A 4KPYA 2NN5A 4C9CA 5I8FA 4A8UA 3NMNA 2GKDA 2MOUA 2E3QA 3GTEA 3P9VA 3GB4A 3ELIA 5AMWA 3KAYA 4NCBA 4IGXA 3NMVA 1XN6A 3UQHA 2LAKA 4GY9A 1LN1A 3GL2A 1XFSA 4IGWA 4A86A 3P51A 2LAFA 4IHRA 4MAPA 4WVOA 1T17A 3OJIA 4JHHA 1TXCA 3NJ0A 2KCZA 2L8OA 4A8GA 1BV1A 4LA7A 2LIOA 2KTEA 4RYVA 1JSSA 2K7HA 4PSBA 1ICXA 2N4BA 2WQLA 3H3SA 1T27A 4Q0KA 4A80A 3H3TA 2L9PA 3OTLA 2RESA 4A87A 5JO2A 1IFVA 3QSZA 4BKCA 3TFZA 4QDFB 2QPVA 3NS2A 5E4DA 5E4MA 3NEFA 2PCSA 4MA6A 5JNNA 4LGAA 4BK6A 3NJOA 2LEQA 4M9WA 4LG5A 2LE1A 2E3MA 2VQ5A 3RD6A 3HO1A 2YH6A 2E3RA 5BRLA 3K3KA 3F08A 2K5GA 3ZVUA 2EJXA 2FFSA 1BTVA 3GTSA 2M89A 3Q64A 3NEGA
chains in the Genus database with same CATH topology
2LUZA 2N4AA 4OICA 2VNEA 4A8VA 3H3RA 4IGYA 4JHIA 1LLTA 3K90A 3Q6AA 4N0GC 1XUVA 3HM9A 4B9RA 3W9RA 4FPWA 2I9YA 3KB0A 2QIMA 5C9YA 4Y31A 4QDFA 3W9KA 4Z3LA 2IL5A 2FLHA 3IE5A 3QN1A 2Z9ZA 3C0VA 3H3QA 4NCAA 4QDDA 3NJ1A 4A84A 3OH8A 3HJFA 2M47A 1FSKA 3JRQB 2KF2A 2LCGA 3JRSA 1ZXFA 3TVRA 3KL1A 3DLBA 4N47A 3IJTA 3NMTA 3GOBA 1XDFA 1EM2A 4JDAA 1KCMA 3F73A 3WG8A 2KEWA 2A1LA 3GKEA 4QCKA 2Z9YA 3Q63A 3UJLA 5I9JA 4IH2A 2Q3QA 2R55A 3FO5A 4JHGA 4QDCA 2LGHA 3KDIA 4E6FA 4IH0A 3GGNA 4JHYA 4R7KA 4N41A 4BKDA 1TW0A 3PUTA 3GL0A 4JDLA 1FM4A 1LN3A 2E3PA 1QMRA 2ZYLA 3R6PA 3TVQA 4REHA 1H2OA 4C9IA 4LGBA 4M9BA 4A81A 5E4BA 2E3NA 4XRTA 1VJHA 2BK0A 2NS9A 3HXMA 4A83A 1X53A 2E3OA 4IGVA 3NMHA 3PU2A 2LF2A 4REIA 1E09A 3TGOC 4A85A 3KB3A 3NQNA 2PSOA 3DLHA 4XRWA 4DSBA 2REZA 4BK7A 4A88A 1Z94A 3P0LA 4DSCA 4DS8A 2L65A 3KDHA 3UIDA 5E46A 2D4RA 1XN5A 3RT0C 3KLXA 2LPXA 3E85A 4N3EA 3HVRA 4N76A 4QIPA 3OQUA 3RT2A 4REJA 2E3SA 4MNSA 3NR4A 4BTZA 1UW5A 3NMPA 3KAZA 1B6FA 1LN2A 2LDKA 3CNWA 3KDJA 2RERA 3NI8A 3TL1A 4C94A 5EKQC 3HK2A 5JO1A 4KPYA 2NN5A 4C9CA 5I8FA 4A8UA 3NMNA 2GKDA 2MOUA 2E3QA 3GTEA 3P9VA 3GB4A 3ELIA 5AMWA 3KAYA 4NCBA 4IGXA 3NMVA 1XN6A 3UQHA 2LAKA 4GY9A 1LN1A 3GL2A 1XFSA 4IGWA 4A86A 3P51A 2LAFA 4IHRA 4MAPA 4WVOA 1T17A 3OJIA 4JHHA 1TXCA 3NJ0A 2KCZA 2L8OA 4A8GA 1BV1A 4LA7A 2LIOA 2KTEA 4RYVA 1JSSA 2K7HA 4PSBA 1ICXA 2N4BA 2WQLA 3H3SA 1T27A 4Q0KA 4A80A 3H3TA 2L9PA 3OTLA 2RESA 4A87A 5JO2A 1IFVA 3QSZA 4BKCA 3TFZA 4QDFB 2QPVA 3NS2A 5E4DA 5E4MA 3NEFA 2PCSA 4MA6A 5JNNA 4LGAA 4BK6A 3NJOA 2LEQA 4M9WA 4LG5A 2LE1A 2E3MA 2VQ5A 3RD6A 3HO1A 2YH6A 2E3RA 5BRLA 3K3KA 3F08A 2K5GA 3ZVUA 2EJXA 2FFSA 1BTVA 3GTSA 2M89A 3Q64A 3NEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUZ A;  2N4A A;  4OIC A;  2VNE A;  4A8V A;  3H3R A;  4IGY A;  4JHI A;  1LLT A;  3K90 A;  3Q6A A;  4N0G C;  1XUV A;  4B9R A;  3W9R A;  4FPW A;  2I9Y A;  3KB0 A;  2QIM A;  5C9Y A;  4Y31 A;  3W9K A;  4Z3L A;  2IL5 A;  2FLH A;  3IE5 A;  3QN1 A;  2Z9Z A;  3C0V A;  3H3Q A;  4A84 A;  3NJ1 A;  3OH8 A;  2M47 A;  1FSK A;  3JRQ B;  2KF2 A;  2LCG A;  3JRS A;  1ZXF A;  3TVR A;  3KL1 A;  3IJT A;  3NMT A;  1XDF A;  1EM2 A;  4JDA A;  1KCM A;  3WG8 A;  2KEW A;  2A1L A;  2Z9Y A;  3Q63 A;  3UJL A;  5I9J A;  4IH2 A;  2Q3Q A;  2R55 A;  3FO5 A;  4JHG A;  2LGH A;  3KDI A;  4IH0 A;  3GGN A;  4R7K A;  4BKD A;  1TW0 A;  3PUT A;  4JDL A;  1FM4 A;  1LN3 A;  2E3P A;  1QMR A;  3TVQ A;  3R6P A;  4REH A;  1H2O A;  4C9I A;  4LGB A;  4M9B A;  4A81 A;  5E4B A;  2E3N A;  4XRT A;  1VJH A;  2BK0 A;  2NS9 A;  4A83 A;  1X53 A;  2E3O A;  4IGV A;  3NMH A;  3PU2 A;  2LF2 A;  4REI A;  1E09 A;  4A85 A;  3KB3 A;  2PSO A;  4XRW A;  4DSB A;  2REZ A;  4BK7 A;  4A88 A;  1Z94 A;  3P0L A;  4DSC A;  4DS8 A;  2L65 A;  3KDH A;  3UID A;  5E46 A;  2D4R A;  1XN5 A;  3RT0 C;  3KLX A;  2LPX A;  3E85 A;  4N3E A;  4QIP A;  3OQU A;  3RT2 A;  4REJ A;  2E3S A;  4MNS A;  3NR4 A;  4BTZ A;  1UW5 A;  3NMP A;  3KAZ A;  1B6F A;  1LN2 A;  2LDK A;  3CNW A;  3KDJ A;  2RER A;  3NI8 A;  3TL1 A;  4C94 A;  5JO1 A;  2NN5 A;  4C9C A;  5I8F A;  4A8U A;  3NMN A;  2GKD A;  2MOU A;  2E3Q A;  3P9V A;  5AMW A;  3ELI A;  3KAY A;  4IGX A;  3NMV A;  1XN6 A;  3UQH A;  2LAK A;  4GY9 A;  1LN1 A;  1XFS A;  4IGW A;  4A86 A;  3P51 A;  4WVO A;  4IHR A;  4MAP A;  1T17 A;  3OJI A;  4JHH A;  1TXC A;  3NJ0 A;  2KCZ A;  2L8O A;  4A8G A;  1BV1 A;  4LA7 A;  2LIO A;  2KTE A;  4RYV A;  1JSS A;  2K7H A;  4PSB A;  1ICX A;  2N4B A;  2WQL A;  3H3S A;  1T27 A;  4Q0K A;  4A80 A;  3H3T A;  2L9P A;  3OTL A;  2RES A;  4A87 A;  5JO2 A;  1IFV A;  3QSZ A;  4BKC A;  3TFZ A;  2QPV A;  3NS2 A;  5E4D A;  5E4M A;  3NEF A;  2PCS A;  4MA6 A;  5JNN A;  4LGA A;  4BK6 A;  3NJO A;  2LEQ A;  4M9W A;  4LG5 A;  2LE1 A;  2E3M A;  2VQ5 A;  3RD6 A;  2E3R A;  5BRL A;  3K3K A;  3F08 A;  2K5G A;  3ZVU A;  2EJX A;  2FFS A;  1BTV A;  2M89 A;  3Q64 A;  3NEG A; 
#chains in the Genus database with same CATH topology
 2LUZ A;  2N4A A;  4OIC A;  2VNE A;  4A8V A;  3H3R A;  4IGY A;  4JHI A;  1LLT A;  3K90 A;  3Q6A A;  4N0G C;  1XUV A;  3HM9 A;  4B9R A;  3W9R A;  4FPW A;  2I9Y A;  3KB0 A;  2QIM A;  5C9Y A;  4Y31 A;  4QDF A;  3W9K A;  4Z3L A;  2IL5 A;  2FLH A;  3IE5 A;  3QN1 A;  2Z9Z A;  3C0V A;  3H3Q A;  4NCA A;  4QDD A;  3NJ1 A;  4A84 A;  3OH8 A;  3HJF A;  2M47 A;  1FSK A;  3JRQ B;  2KF2 A;  2LCG A;  3JRS A;  1ZXF A;  3TVR A;  3KL1 A;  3DLB A;  4N47 A;  3IJT A;  3NMT A;  3GOB A;  1XDF A;  1EM2 A;  4JDA A;  1KCM A;  3F73 A;  3WG8 A;  2KEW A;  2A1L A;  3GKE A;  4QCK A;  2Z9Y A;  3Q63 A;  3UJL A;  5I9J A;  4IH2 A;  2Q3Q A;  2R55 A;  3FO5 A;  4JHG A;  4QDC A;  2LGH A;  3KDI A;  4E6F A;  4IH0 A;  3GGN A;  4JHY A;  4R7K A;  4N41 A;  4BKD A;  1TW0 A;  3PUT A;  3GL0 A;  4JDL A;  1FM4 A;  1LN3 A;  2E3P A;  1QMR A;  2ZYL A;  3R6P A;  3TVQ A;  4REH A;  1H2O A;  4C9I A;  4LGB A;  4M9B A;  4A81 A;  5E4B A;  2E3N A;  4XRT A;  1VJH A;  2BK0 A;  2NS9 A;  3HXM A;  4A83 A;  1X53 A;  2E3O A;  4IGV A;  3NMH A;  3PU2 A;  2LF2 A;  4REI A;  1E09 A;  3TGO C;  4A85 A;  3KB3 A;  3NQN A;  2PSO A;  3DLH A;  4XRW A;  4DSB A;  2REZ A;  4BK7 A;  4A88 A;  1Z94 A;  3P0L A;  4DSC A;  4DS8 A;  2L65 A;  3KDH A;  3UID A;  5E46 A;  2D4R A;  1XN5 A;  3RT0 C;  3KLX A;  2LPX A;  3E85 A;  4N3E A;  3HVR A;  4N76 A;  4QIP A;  3OQU A;  3RT2 A;  4REJ A;  2E3S A;  4MNS A;  3NR4 A;  4BTZ A;  1UW5 A;  3NMP A;  3KAZ A;  1B6F A;  1LN2 A;  2LDK A;  3CNW A;  3KDJ A;  2RER A;  3NI8 A;  3TL1 A;  4C94 A;  5EKQ C;  3HK2 A;  5JO1 A;  4KPY A;  2NN5 A;  4C9C A;  5I8F A;  4A8U A;  3NMN A;  2GKD A;  2MOU A;  2E3Q A;  3GTE A;  3P9V A;  3GB4 A;  3ELI A;  5AMW A;  3KAY A;  4NCB A;  4IGX A;  3NMV A;  1XN6 A;  3UQH A;  2LAK A;  4GY9 A;  1LN1 A;  3GL2 A;  1XFS A;  4IGW A;  4A86 A;  3P51 A;  2LAF A;  4IHR A;  4MAP A;  4WVO A;  1T17 A;  3OJI A;  4JHH A;  1TXC A;  3NJ0 A;  2KCZ A;  2L8O A;  4A8G A;  1BV1 A;  4LA7 A;  2LIO A;  2KTE A;  4RYV A;  1JSS A;  2K7H A;  4PSB A;  1ICX A;  2N4B A;  2WQL A;  3H3S A;  1T27 A;  4Q0K A;  4A80 A;  3H3T A;  2L9P A;  3OTL A;  2RES A;  4A87 A;  5JO2 A;  1IFV A;  3QSZ A;  4BKC A;  3TFZ A;  4QDF B;  2QPV A;  3NS2 A;  5E4D A;  5E4M A;  3NEF A;  2PCS A;  4MA6 A;  5JNN A;  4LGA A;  4BK6 A;  3NJO A;  2LEQ A;  4M9W A;  4LG5 A;  2LE1 A;  2E3M A;  2VQ5 A;  3RD6 A;  3HO1 A;  2YH6 A;  2E3R A;  5BRL A;  3K3K A;  3F08 A;  2K5G A;  3ZVU A;  2EJX A;  2FFS A;  1BTV A;  3GTS A;  2M89 A;  3Q64 A;  3NEG A; 
#chains in the Genus database with same CATH homology
 2LUZ A;  2N4A A;  4OIC A;  2VNE A;  4A8V A;  3H3R A;  4IGY A;  4JHI A;  1LLT A;  3K90 A;  3Q6A A;  4N0G C;  1XUV A;  3HM9 A;  4B9R A;  3W9R A;  4FPW A;  2I9Y A;  3KB0 A;  2QIM A;  5C9Y A;  4Y31 A;  4QDF A;  3W9K A;  4Z3L A;  2IL5 A;  2FLH A;  3IE5 A;  3QN1 A;  2Z9Z A;  3C0V A;  3H3Q A;  4NCA A;  4QDD A;  3NJ1 A;  4A84 A;  3OH8 A;  3HJF A;  2M47 A;  1FSK A;  3JRQ B;  2KF2 A;  2LCG A;  3JRS A;  1ZXF A;  3TVR A;  3KL1 A;  3DLB A;  4N47 A;  3IJT A;  3NMT A;  3GOB A;  1XDF A;  1EM2 A;  4JDA A;  1KCM A;  3F73 A;  3WG8 A;  2KEW A;  2A1L A;  3GKE A;  4QCK A;  2Z9Y A;  3Q63 A;  3UJL A;  5I9J A;  4IH2 A;  2Q3Q A;  2R55 A;  3FO5 A;  4JHG A;  4QDC A;  2LGH A;  3KDI A;  4E6F A;  4IH0 A;  3GGN A;  4JHY A;  4R7K A;  4N41 A;  4BKD A;  1TW0 A;  3PUT A;  3GL0 A;  4JDL A;  1FM4 A;  1LN3 A;  2E3P A;  1QMR A;  2ZYL A;  3R6P A;  3TVQ A;  4REH A;  1H2O A;  4C9I A;  4LGB A;  4M9B A;  4A81 A;  5E4B A;  2E3N A;  4XRT A;  1VJH A;  2BK0 A;  2NS9 A;  3HXM A;  4A83 A;  1X53 A;  2E3O A;  4IGV A;  3NMH A;  3PU2 A;  2LF2 A;  4REI A;  1E09 A;  3TGO C;  4A85 A;  3KB3 A;  3NQN A;  2PSO A;  3DLH A;  4XRW A;  4DSB A;  2REZ A;  4BK7 A;  4A88 A;  1Z94 A;  3P0L A;  4DSC A;  4DS8 A;  2L65 A;  3KDH A;  3UID A;  5E46 A;  2D4R A;  1XN5 A;  3RT0 C;  3KLX A;  2LPX A;  3E85 A;  4N3E A;  3HVR A;  4N76 A;  4QIP A;  3OQU A;  3RT2 A;  4REJ A;  2E3S A;  4MNS A;  3NR4 A;  4BTZ A;  1UW5 A;  3NMP A;  3KAZ A;  1B6F A;  1LN2 A;  2LDK A;  3CNW A;  3KDJ A;  2RER A;  3NI8 A;  3TL1 A;  4C94 A;  5EKQ C;  3HK2 A;  5JO1 A;  4KPY A;  2NN5 A;  4C9C A;  5I8F A;  4A8U A;  3NMN A;  2GKD A;  2MOU A;  2E3Q A;  3GTE A;  3P9V A;  3GB4 A;  3ELI A;  5AMW A;  3KAY A;  4NCB A;  4IGX A;  3NMV A;  1XN6 A;  3UQH A;  2LAK A;  4GY9 A;  1LN1 A;  3GL2 A;  1XFS A;  4IGW A;  4A86 A;  3P51 A;  2LAF A;  4IHR A;  4MAP A;  4WVO A;  1T17 A;  3OJI A;  4JHH A;  1TXC A;  3NJ0 A;  2KCZ A;  2L8O A;  4A8G A;  1BV1 A;  4LA7 A;  2LIO A;  2KTE A;  4RYV A;  1JSS A;  2K7H A;  4PSB A;  1ICX A;  2N4B A;  2WQL A;  3H3S A;  1T27 A;  4Q0K A;  4A80 A;  3H3T A;  2L9P A;  3OTL A;  2RES A;  4A87 A;  5JO2 A;  1IFV A;  3QSZ A;  4BKC A;  3TFZ A;  4QDF B;  2QPV A;  3NS2 A;  5E4D A;  5E4M A;  3NEF A;  2PCS A;  4MA6 A;  5JNN A;  4LGA A;  4BK6 A;  3NJO A;  2LEQ A;  4M9W A;  4LG5 A;  2LE1 A;  2E3M A;  2VQ5 A;  3RD6 A;  3HO1 A;  2YH6 A;  2E3R A;  5BRL A;  3K3K A;  3F08 A;  2K5G A;  3ZVU A;  2EJX A;  2FFS A;  1BTV A;  3GTS A;  2M89 A;  3Q64 A;  3NEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...