2MPBA

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
145
structure length
145
Chain Sequence
MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords BA42
total genus 42
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2mpbA00
3PW9A 2LT2A 2KPTA 2KW7A 3PTJA 3PVHA 4OA3A 5ANPA 2MPBA
chains in the Genus database with same CATH superfamily
2HAWA 2AZPA 5H2GA 5ANPA 1I74A 2QB7A 4JCIA 4K7XA 1W61A 2KW7A 4JUUA 3W5WA 1WPMA 2ZXRA 3PTJA 4LS9A 3ICJA 3IGHX 4J9WA 3G7KA 5H2YA 3FVEA 4PY9A 2QB8A 2H9FA 2OTNA 1BWZA 1QYAA 3DEVA 1GQZA 4JD7A 1U1XA 2PW0A 2ZVFA 2ENXA 4OA3A 1XUAA 2PVZA 1XUBA 1U1WA 5IWEA 2ZXOA 4LB0A 1U1VA 1SDJA 1K23A 4K8LA 2LT2A 4JBDA 2Q9HA 1TM0A 1W62A 3PW9A 2EB0A 2KPTA 3EDNA 1K20A 4RPAA 2YMAA 4DUNA 4J9XA 2IW4A 4LG3A 2GKJA 2MPBA 1YM5A 1S7JA 4IJZA 4K7GB 3G98A 3WQZA 3EJXA 5HA4A 3PVHA 4IK0A 4Q60A 1T6KA 1IR6A 2Q9JA 4Q2HA 2GKEA 1U0KA 3EKMA 5M47A 2QB6A 1QY9A 4GL6A 1WPPA 2ZXPA
chains in the Genus database with same CATH topology
2HAWA 2AZPA 5H2GA 5ANPA 1I74A 2QB7A 4JCIA 4K7XA 1W61A 2KW7A 4JUUA 3W5WA 1WPMA 2ZXRA 3PTJA 4LS9A 3ICJA 3IGHX 4J9WA 3G7KA 5H2YA 3FVEA 4PY9A 2QB8A 2H9FA 2OTNA 1BWZA 1QYAA 3DEVA 1GQZA 4JD7A 1U1XA 2PW0A 2ZVFA 2ENXA 4OA3A 1XUAA 2PVZA 1XUBA 1U1WA 5IWEA 2ZXOA 4LB0A 1U1VA 1SDJA 1K23A 4K8LA 2LT2A 4JBDA 2Q9HA 1TM0A 1W62A 3PW9A 2EB0A 2KPTA 3EDNA 1K20A 4RPAA 2YMAA 4DUNA 4J9XA 2IW4A 4LG3A 2GKJA 2MPBA 1YM5A 1S7JA 4IJZA 4K7GB 3G98A 3WQZA 3EJXA 5HA4A 3PVHA 4IK0A 4Q60A 1T6KA 1IR6A 2Q9JA 4Q2HA 2GKEA 1U0KA 3EKMA 5M47A 2QB6A 1QY9A 4GL6A 1WPPA 2ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PW9 A;  2LT2 A;  2KPT A;  2KW7 A;  3PTJ A;  3PVH A;  4OA3 A;  5ANP A;  2MPB A; 
#chains in the Genus database with same CATH topology
 2HAW A;  2AZP A;  5H2G A;  5ANP A;  1I74 A;  2QB7 A;  4JCI A;  4K7X A;  1W61 A;  2KW7 A;  4JUU A;  3W5W A;  1WPM A;  2ZXR A;  3PTJ A;  4LS9 A;  3ICJ A;  3IGH X;  4J9W A;  3G7K A;  5H2Y A;  3FVE A;  4PY9 A;  2QB8 A;  2H9F A;  2OTN A;  1BWZ A;  1QYA A;  3DEV A;  1GQZ A;  4JD7 A;  1U1X A;  2PW0 A;  2ZVF A;  2ENX A;  4OA3 A;  1XUA A;  2PVZ A;  1XUB A;  1U1W A;  5IWE A;  2ZXO A;  4LB0 A;  1U1V A;  1SDJ A;  1K23 A;  4K8L A;  2LT2 A;  4JBD A;  2Q9H A;  1TM0 A;  1W62 A;  3PW9 A;  2EB0 A;  2KPT A;  3EDN A;  1K20 A;  4RPA A;  2YMA A;  4DUN A;  4J9X A;  2IW4 A;  4LG3 A;  2GKJ A;  2MPB A;  1YM5 A;  1S7J A;  4IJZ A;  4K7G B;  3G98 A;  3WQZ A;  3EJX A;  5HA4 A;  3PVH A;  4IK0 A;  4Q60 A;  1T6K A;  1IR6 A;  2Q9J A;  4Q2H A;  2GKE A;  1U0K A;  3EKM A;  5M47 A;  2QB6 A;  1QY9 A;  4GL6 A;  1WPP A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 2HAW A;  2AZP A;  5H2G A;  5ANP A;  1I74 A;  2QB7 A;  4JCI A;  4K7X A;  1W61 A;  2KW7 A;  4JUU A;  3W5W A;  1WPM A;  2ZXR A;  3PTJ A;  4LS9 A;  3ICJ A;  3IGH X;  4J9W A;  3G7K A;  5H2Y A;  3FVE A;  4PY9 A;  2QB8 A;  2H9F A;  2OTN A;  1BWZ A;  1QYA A;  3DEV A;  1GQZ A;  4JD7 A;  1U1X A;  2PW0 A;  2ZVF A;  2ENX A;  4OA3 A;  1XUA A;  2PVZ A;  1XUB A;  1U1W A;  5IWE A;  2ZXO A;  4LB0 A;  1U1V A;  1SDJ A;  1K23 A;  4K8L A;  2LT2 A;  4JBD A;  2Q9H A;  1TM0 A;  1W62 A;  3PW9 A;  2EB0 A;  2KPT A;  3EDN A;  1K20 A;  4RPA A;  2YMA A;  4DUN A;  4J9X A;  2IW4 A;  4LG3 A;  2GKJ A;  2MPB A;  1YM5 A;  1S7J A;  4IJZ A;  4K7G B;  3G98 A;  3WQZ A;  3EJX A;  5HA4 A;  3PVH A;  4IK0 A;  4Q60 A;  1T6K A;  1IR6 A;  2Q9J A;  4Q2H A;  2GKE A;  1U0K A;  3EKM A;  5M47 A;  2QB6 A;  1QY9 A;  4GL6 A;  1WPP A;  2ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...