2MPBA

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
145
structure length
145
Chain Sequence
MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
molecule keywords BA42
total genus 42
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2mpbA00
2MPBA 4OA3A 2LT2A 5ANPA 2KW7A 3PVHA 3PW9A 3PTJA 2KPTA
chains in the Genus database with same CATH superfamily
3ICJA 2MPBA 2OTNA 1GQZA 3IGHX 5ANPA 2ZVFA 4JBDA 2PVZA 5H2GA 3G7KA 2QB6A 4DUNA 4GL6A 1WPMA 1XUAA 4LG3A 2GKEA 4J9WA 3G98A 1K20A 1XUBA 5HA4A 4Q2HA 2ZXOA 1BWZA 2HAWA 1U0KA 3DEVA 1W61A 1T6KA 3EDNA 3PTJA 1U1WA 4K7GB 5IWEA 2H9FA 2ENXA 2Q9HA 4JUUA 4OA3A 2GKJA 4J9XA 2YMAA 1IR6A 1U1XA 2KW7A 4RPAA 4IJZA 4IK0A 2IW4A 1S7JA 1QYAA 2ZXRA 1YM5A 1TM0A 2EB0A 3PW9A 5H2YA 4LS9A 2QB7A 1K23A 4PY9A 2KPTA 4Q60A 2AZPA 3W5WA 2LT2A 4K7XA 2ZXPA 5M47A 3WQZA 1QY9A 4LB0A 2PW0A 4JD7A 3EKMA 3EJXA 3PVHA 1I74A 1W62A 4JCIA 3FVEA 1SDJA 1WPPA 1U1VA 2QB8A 2Q9JA 4K8LA
chains in the Genus database with same CATH topology
3ICJA 2MPBA 2OTNA 1GQZA 3IGHX 5ANPA 2ZVFA 4JBDA 2PVZA 5H2GA 3G7KA 2QB6A 4DUNA 4GL6A 1WPMA 1XUAA 4LG3A 2GKEA 4J9WA 3G98A 1K20A 1XUBA 5HA4A 4Q2HA 2ZXOA 1BWZA 2HAWA 1U0KA 3DEVA 1W61A 1T6KA 3EDNA 3PTJA 1U1WA 4K7GB 5IWEA 2H9FA 2ENXA 2Q9HA 4JUUA 4OA3A 2GKJA 4J9XA 2YMAA 1IR6A 1U1XA 2KW7A 4RPAA 4IJZA 4IK0A 2IW4A 1S7JA 1QYAA 2ZXRA 1YM5A 1TM0A 2EB0A 3PW9A 5H2YA 4LS9A 2QB7A 1K23A 4PY9A 2KPTA 4Q60A 2AZPA 3W5WA 2LT2A 4K7XA 2ZXPA 5M47A 3WQZA 1QY9A 4LB0A 2PW0A 4JD7A 3EKMA 3EJXA 3PVHA 1I74A 1W62A 4JCIA 3FVEA 1SDJA 1WPPA 1U1VA 2QB8A 2Q9JA 4K8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MPB A;  4OA3 A;  2LT2 A;  5ANP A;  2KW7 A;  3PVH A;  3PW9 A;  3PTJ A;  2KPT A; 
#chains in the Genus database with same CATH topology
 3ICJ A;  2MPB A;  2OTN A;  1GQZ A;  3IGH X;  5ANP A;  2ZVF A;  4JBD A;  2PVZ A;  5H2G A;  3G7K A;  2QB6 A;  4DUN A;  4GL6 A;  1WPM A;  1XUA A;  4LG3 A;  2GKE A;  4J9W A;  3G98 A;  1K20 A;  1XUB A;  5HA4 A;  4Q2H A;  2ZXO A;  1BWZ A;  2HAW A;  1U0K A;  3DEV A;  1W61 A;  1T6K A;  3EDN A;  3PTJ A;  1U1W A;  4K7G B;  5IWE A;  2H9F A;  2ENX A;  2Q9H A;  4JUU A;  4OA3 A;  2GKJ A;  4J9X A;  2YMA A;  1IR6 A;  1U1X A;  2KW7 A;  4RPA A;  4IJZ A;  4IK0 A;  2IW4 A;  1S7J A;  1QYA A;  2ZXR A;  1YM5 A;  1TM0 A;  2EB0 A;  3PW9 A;  5H2Y A;  4LS9 A;  2QB7 A;  1K23 A;  4PY9 A;  2KPT A;  4Q60 A;  2AZP A;  3W5W A;  2LT2 A;  4K7X A;  2ZXP A;  5M47 A;  3WQZ A;  1QY9 A;  4LB0 A;  2PW0 A;  4JD7 A;  3EKM A;  3EJX A;  3PVH A;  1I74 A;  1W62 A;  4JCI A;  3FVE A;  1SDJ A;  1WPP A;  1U1V A;  2QB8 A;  2Q9J A;  4K8L A; 
#chains in the Genus database with same CATH homology
 3ICJ A;  2MPB A;  2OTN A;  1GQZ A;  3IGH X;  5ANP A;  2ZVF A;  4JBD A;  2PVZ A;  5H2G A;  3G7K A;  2QB6 A;  4DUN A;  4GL6 A;  1WPM A;  1XUA A;  4LG3 A;  2GKE A;  4J9W A;  3G98 A;  1K20 A;  1XUB A;  5HA4 A;  4Q2H A;  2ZXO A;  1BWZ A;  2HAW A;  1U0K A;  3DEV A;  1W61 A;  1T6K A;  3EDN A;  3PTJ A;  1U1W A;  4K7G B;  5IWE A;  2H9F A;  2ENX A;  2Q9H A;  4JUU A;  4OA3 A;  2GKJ A;  4J9X A;  2YMA A;  1IR6 A;  1U1X A;  2KW7 A;  4RPA A;  4IJZ A;  4IK0 A;  2IW4 A;  1S7J A;  1QYA A;  2ZXR A;  1YM5 A;  1TM0 A;  2EB0 A;  3PW9 A;  5H2Y A;  4LS9 A;  2QB7 A;  1K23 A;  4PY9 A;  2KPT A;  4Q60 A;  2AZP A;  3W5W A;  2LT2 A;  4K7X A;  2ZXP A;  5M47 A;  3WQZ A;  1QY9 A;  4LB0 A;  2PW0 A;  4JD7 A;  3EKM A;  3EJX A;  3PVH A;  1I74 A;  1W62 A;  4JCI A;  3FVE A;  1SDJ A;  1WPP A;  1U1V A;  2QB8 A;  2Q9J A;  4K8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...