2MPBA

Nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
145
structure length
145
Chain Sequence
MSKIEEFLTAEEEKAIVDAIRDAEKNTSGEIRVHLEKTSEIDVFDRAMDVFHNLKMDNTKLQNGVLIYVAVEDKTFVIYGDKGINDVVSDDFWDTTRNAIQLQFKQGNFKQGLVDGIEKAGMALAKYFPWKKDDIDELPNTISKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BA42
publication title Solution and crystal structure of BA42, a protein from the Antarctic bacterium Bizionia argentinensis comprised of a stand-alone TPM domain.
pubmed doi rcsb
source organism Bizionia argentinensis
molecule tags Unknown function
total genus 42
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2mpbA00
3PTJA 3PVHA 3PW9A 2MPBA 5ANPA 2KW7A 4OA3A 2KPTA 2LT2A
chains in the Genus database with same CATH superfamily
4Q2HA 2GKEA 3PVHA 2IW4A 2KW7A 3IGHX 2PW0A 2GKJA 3DEVA 1QYAA 3EKMA 1W61A 4K7XA 1YM5A 2ZXOA 2OTNA 2ZXRA 4LS9A 2QB8A 5H2GA 5IWEA 2LT2A 3FVEA 2ZVFA 4Q60A 1K20A 3EDNA 2KPTA 1K23A 5ANPA 2QB7A 1I74A 3WQZA 3PW9A 5HA4A 2HAWA 1T6KA 1XUAA 3PTJA 3ICJA 4JCIA 4GL6A 1IR6A 1U1WA 1WPMA 4JBDA 4PY9A 2MPBA 2ENXA 1S7JA 3EJXA 4LB0A 5M47A 3G98A 2AZPA 1XUBA 2EB0A 1U0KA 1BWZA 1WPPA 4RPAA 2Q9HA 2H9FA 4OA3A 2YMAA 4JUUA 4LG3A 4J9XA 1QY9A 3W5WA 4DUNA 2ZXPA 5H2YA 1SDJA 2PVZA 2QB6A 1TM0A 4K8LA 2Q9JA 4IK0A 1U1VA 4IJZA 4J9WA 1W62A 3G7KA 4K7GB 4JD7A 1GQZA 1U1XA
chains in the Genus database with same CATH topology
4Q2HA 2GKEA 3PVHA 2IW4A 2KW7A 3IGHX 2PW0A 2GKJA 3DEVA 1QYAA 3EKMA 1W61A 4K7XA 1YM5A 2ZXOA 2OTNA 2ZXRA 4LS9A 2QB8A 5H2GA 5IWEA 2LT2A 3FVEA 2ZVFA 4Q60A 1K20A 3EDNA 2KPTA 1K23A 5ANPA 2QB7A 1I74A 3WQZA 3PW9A 5HA4A 2HAWA 1T6KA 1XUAA 3PTJA 3ICJA 4JCIA 4GL6A 1IR6A 1U1WA 1WPMA 4JBDA 4PY9A 2MPBA 2ENXA 1S7JA 3EJXA 4LB0A 5M47A 3G98A 2AZPA 1XUBA 2EB0A 1U0KA 1BWZA 1WPPA 4RPAA 2Q9HA 2H9FA 4OA3A 2YMAA 4JUUA 4LG3A 4J9XA 1QY9A 3W5WA 4DUNA 2ZXPA 5H2YA 1SDJA 2PVZA 2QB6A 1TM0A 4K8LA 2Q9JA 4IK0A 1U1VA 4IJZA 4J9WA 1W62A 3G7KA 4K7GB 4JD7A 1GQZA 1U1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTJ A;  3PVH A;  3PW9 A;  2MPB A;  5ANP A;  2KW7 A;  4OA3 A;  2KPT A;  2LT2 A; 
#chains in the Genus database with same CATH topology
 4Q2H A;  2GKE A;  3PVH A;  2IW4 A;  2KW7 A;  3IGH X;  2PW0 A;  2GKJ A;  3DEV A;  1QYA A;  3EKM A;  1W61 A;  4K7X A;  1YM5 A;  2ZXO A;  2OTN A;  2ZXR A;  4LS9 A;  2QB8 A;  5H2G A;  5IWE A;  2LT2 A;  3FVE A;  2ZVF A;  4Q60 A;  1K20 A;  3EDN A;  2KPT A;  1K23 A;  5ANP A;  2QB7 A;  1I74 A;  3WQZ A;  3PW9 A;  5HA4 A;  2HAW A;  1T6K A;  1XUA A;  3PTJ A;  3ICJ A;  4JCI A;  4GL6 A;  1IR6 A;  1U1W A;  1WPM A;  4JBD A;  4PY9 A;  2MPB A;  2ENX A;  1S7J A;  3EJX A;  4LB0 A;  5M47 A;  3G98 A;  2AZP A;  1XUB A;  2EB0 A;  1U0K A;  1BWZ A;  1WPP A;  4RPA A;  2Q9H A;  2H9F A;  4OA3 A;  2YMA A;  4JUU A;  4LG3 A;  4J9X A;  1QY9 A;  3W5W A;  4DUN A;  2ZXP A;  5H2Y A;  1SDJ A;  2PVZ A;  2QB6 A;  1TM0 A;  4K8L A;  2Q9J A;  4IK0 A;  1U1V A;  4IJZ A;  4J9W A;  1W62 A;  3G7K A;  4K7G B;  4JD7 A;  1GQZ A;  1U1X A; 
#chains in the Genus database with same CATH homology
 4Q2H A;  2GKE A;  3PVH A;  2IW4 A;  2KW7 A;  3IGH X;  2PW0 A;  2GKJ A;  3DEV A;  1QYA A;  3EKM A;  1W61 A;  4K7X A;  1YM5 A;  2ZXO A;  2OTN A;  2ZXR A;  4LS9 A;  2QB8 A;  5H2G A;  5IWE A;  2LT2 A;  3FVE A;  2ZVF A;  4Q60 A;  1K20 A;  3EDN A;  2KPT A;  1K23 A;  5ANP A;  2QB7 A;  1I74 A;  3WQZ A;  3PW9 A;  5HA4 A;  2HAW A;  1T6K A;  1XUA A;  3PTJ A;  3ICJ A;  4JCI A;  4GL6 A;  1IR6 A;  1U1W A;  1WPM A;  4JBD A;  4PY9 A;  2MPB A;  2ENX A;  1S7J A;  3EJX A;  4LB0 A;  5M47 A;  3G98 A;  2AZP A;  1XUB A;  2EB0 A;  1U0K A;  1BWZ A;  1WPP A;  4RPA A;  2Q9H A;  2H9F A;  4OA3 A;  2YMA A;  4JUU A;  4LG3 A;  4J9X A;  1QY9 A;  3W5W A;  4DUN A;  2ZXP A;  5H2Y A;  1SDJ A;  2PVZ A;  2QB6 A;  1TM0 A;  4K8L A;  2Q9J A;  4IK0 A;  1U1V A;  4IJZ A;  4J9W A;  1W62 A;  3G7K A;  4K7G B;  4JD7 A;  1GQZ A;  1U1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...