2MPFA

Solution structure human hcn2 cnbd in the camp-unbound state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
139
structure length
139
Chain Sequence
NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for the mutual antagonism of cAMP and TRIP8b in regulating HCN channel function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 26
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2mpfA00
3FE5A 2QJVA 1YFYA 2CAVA 4X6RB 4JTNA 1CAUB 4P9GA 2ZKLA 3SXWA 1RL3A 1YWKA 3NJZA 3OF1A 5KHIA 1J1LA 4IEPA 5CVRA 1OD5A 3TNQA 1CGPA 4LULA 5I91A 4BHPA 5I93A 3BB6A 2D5HA 2BNMA 5F1RA 2GC3A 3H7JA 4E2QA 5CADA 5FPZA 4L2NA 1O4TA 1DGWA 2PTMA 2BNNA 2HKXA 1IPJA 4XF3A 2Z2SB 3S7IA 4IEWA 3S0MA 4FBFA 2XHKA 1CX4A 2ETEA 3SCFA 4KL1A 3G7DA 4B29A 1EPZA 1VP6A 4XFBA 1UD1A 2F4PA 3RYRA 2QCSB 4Q0VA 4KWKA 4YYOA 1LKNA 4KU7A 1ZRCA 3R6SA 5BY5A 4IEVA 4BYYA 2PHDA 2MHFA 5T3NA 3H1MA 1J3PA 5I0SA 2GC1A 3WW2A 3DN7A 3IBMA 4QGMA 2GC0A 4X6QB 4AXOA 5I0UA 4RD7A 2IXLA 2OA2A 3NW4A 3FZ3A 3H8UA 1JUHA 3EBRA 3M3IA 4MGYE 4Z82A 1OMIA 4MH0E 1DGRA 2PQQA 3LOIA 4D7TA 4PIYA 1NE6A 4OLLA 2I45A 4J1XA 4XETA 2ET1A 5LEKA 1DZTA 2IC1A 3OCPA 1L3JA 4MGKE 3H3UA 2BNOA 2EVXA 3H7YA 4AQ2A 2GU9A 2H6BA 4QX5A 3E6BA 3IIAA 4WZCA 4HBNA 1ZVFA 3PLQA 4EWDA 4TLFA 4F7ZA 1FXZA 2OPKA 3I54A 2O1QA 2GAUA 2V09A 3CF6E 3RZZA 2VQAA 2D40A 4XF1A 1O3TA 1CAXB 3KGZA 2BEOA 4YARA 3I7DA 3SHRA 2GZWA 4I02A 2Q4SA 5JSOA 1SQ4A 2ET7A 4IESA 1OI6A 2IXCA 4I3PA 3CL1A 4F8AA 3BU7A 1ZREA 4QMAA 2QVSB 1QXJA 2OYZA 1X8MA 3LA2A 1ZRFA 4IEXA 2MPFA 5FCCA 2B5HA 4EWEA 1ZZ8A 3UKVA 3MPBA 3USSA 5BXXA 3DV8A 4XEZA 4A2UA 2XL7A 1CAXA 4LA2A 4HN1A 3OD0A 2B8MA 3S7EA 1QXRA 3IDBB 1LR5A 4MGZE 1PM7A 3NKTA 4EWAA 5HI0A 5FQ0B 3FWEA 2HJIA 3SCHA 1OFNA 2BYVE 1ZZ7A 4XFFA 2CV6A 2Q0AA 2VPVA 2D5FA 3HT2A 4Q0PA 3FHIB 3KCCA 3C3VA 3DKWA 3U11A 3PNAA 1IPKA 2FMYA 3KMHA 2C0ZA 4MUVA 4O9EA 5EFUA 1NXMA 4UXAA 5KHHA 2FQPA 2BGCA 1J3QA 4EV0A 2PFWA 3TNPB 3KSCA 3ACLA 5KBFA 2CGPA 3H9AA 2ZCWA 4LUMA 1J59A 1CAUA 2QDRA 2ATFA 3E6DA 2PYTA 4XFIA 4HMZA 4CYDA 4IEYA 1G6NA 5C6CA 2IXJA 5FQ0A 3LAGA 2XGXA 3E5UA 3NL1A 4QGLA 3RDIA 1X7NA 3SMHA 4MGIE 1O3QA 3WW3A 5AVPA 3NSTA 4ONUA 1O3SA 4IEUA 4Q0UA 2DCTA 3OTFA 3U10A 2H0VA 3O14A 4OFGA 2PAEA 4N9HA 3I59B 1H1IA 3EO6A 5JSRA 5JAXA 1O7FA 4KU8A 4XFHA 3H50A 2IXHA 3U0ZA 4MZUA 5E16A 4QXKA 4ZU4A 3ZDSA 3ST7A 5I0TA 3BPZA 4YSFA 1WGPA 3LWCA 1CAVB 2K9ZA 4JVAA 4K8FA 3H3ZA 1YFWA 3LA7A 5KHGA 5EZWA 4IEZA 1X82A 4I09A 5FLIA 5FDBA 4YRDA 2K0GA 4AVAA 1H1MA 4KWLA 2EAAA 4PIZA 3JZVA 4AVCA 1WLTA 1RC6A 4QM8A 2OZJA 3HIFA 4ZU7A 5J3UA 4IEQA 5I8TA 4FAGA 5FLJA 3BALA 1O3RA 5C8WA 3H1WA 1UCXA 1XRUA 2XKPA 1SFNA 4HLTA 1RUOA 5LRRA 1UIKA 3FX3A 2KXLA 1WA4A 3NVCA 3MDPA 3FJSA 5LRSA 2B9UA 3E5QA 4R52A 4BH9A 1EP0A 1FT9A 1ZZ9A 1XE8A 1GQHA 4BIFA 4PIXA 1LRHA 3GBFA 4HVOA 2PAMA 1VR3A 3UKTA 1PMIA 1O5LA 4XF0A 3ROUA 1EY2A 1RTVA 1YFXA 2PAKA 5JSPA 1ZX5A 3D0SA 4MX3A 5LEJA 1EYBA 3ETQA 4FAHA 3EQEA 5J48A 1SEFA 1I5ZA 3D0JA 4Q0QA 4ZU5A 2UYAA 4QM9A 4MV2A 4XF9A 3GYDA 5KHKA 4EROA 3CEWA 3UKNA 4D7SA 2EA7A 3LZZA 1Y3TA 2O8QA 4AQ6A 3DL3A 3L2HA 1ZNPA 1CAWB 2IXKA 4WVZA 5JR7B 5I0RA 1YHFA 1NYWA 4UBHA 4XFGA 5I8SA 5BUVA 2Q30A 5BV6A 2XL9A 4IEOA 2IXIA 1U12A 3QOPA 2Y0OA 4LUKA 2WFPA 4XFCA 1DZRA 1ZZ6A 4E2GA 1I6XA 4ORFA 1HW5A 4WBBA 1J58A 2GH2A 1ZZBA 3VHRA 3WW4A 3BCWA 3IWZA 1CAWA 1NZCA 2XKOA 3EHKA 4DINB 4JTOA 4LA3A 1FI2A 1ZRDA 3H1YA 2XLFA 4JV4A 3E6CC 2GC2A 3RYPA 1QWRA 4HVRA 4R8HA 1LB2A 1Q3EA 3E97A 5JCTA 4KWJA 2Q1ZB 3HT1A 3RYKA 4HSLA 4I01A 3E5XA 4Q29A 2Z69A 3KGLA 3IDCB 5K8SA 5BPXA 4UBGA 5CU1A 1YFUA 2P17A 2UY8A 3I59A 1YUDA 5KHJA 4XFAA 1NE4A 4GULA 4QGNA 3RNSA 2H6CA 1Q5OA 1VJ2A 4Z07A 2QNKA 2N7GA 4I0AA 2D93A 4H7LA 5FPXA 2XLGA 3N4MA 4AVBA 3M70A 4LEJA 4LTAA 2PA7A 5J7MA 3EJKA 1V70A 1UW8A 1X8EA 2PHLA 1CAVA 3CLPA 4J1WA 2OZ6A 4Q0SA 4N9IA 1YLLA 2WC2A 1XE7A 2UY9A 4YNIA 1QY4A 4NVPA 2E9QA 1RGSA 2VECA 3QACA 5D1IA 1UIJA 5FLHA 1J3RA 4HN0A 4I2OA 4IERA 5E1RA 3SCGA 1ZZCA 4PJYA 1GQGA 4E2SA 4LLOA 3B02A 2MNGA 5I8YA 3LA3A 2UYBA 3D82A 3OGJA 3RPQA 2XLAA 3PVBB 3ES1A 3HQXA 4HVQA 4I0BA 3CJXA 4FT8A 1RUNA 4HSJA 3ELNA 1UPIA 1Y9QA 3MYXA 3CO2A 4META 1ZRRA 4XF4A 3WW1A 4L11A 1TQ5A 4IETA 3FFQA 2CAUA 4O9GA 1Q43A 3MZHA 3ES4A 1O5UA 4HZFA
chains in the Genus database with same CATH superfamily
4TSVA 3VV1A 3ILRA 4LQRA 2V4VA 4BQXA 2ZEZA 5FZ7A 3WQBA 4G4FA 2RR12 4Q8KA 1UQXA 3TOJA 1H4GA 2PLV2 2XPJA 1S0IA 4P5YA 3KF5A 4P9IA 4PQ9A 1QDCA 3HN1A 4HL0A 1J1LA 3IKWA 4IEPA 3RWNA 1MS8A 2C9AA 5LW9A 5I91A 1GLHA 1LEDA 5FO8B 1IQDC 4BHPA 4EN0A 2FDJA 3KHCA 3GGLA 2GC3A 1TMF1 5CADA 2WNEA 3WVJA 3O1MA 1NQJA 1O8PA 2BPA2 1A8DA 3RMXA 3LDKA 2BNNA 1GP5A 3W21A 3ATGA 1HQWA 1ASJ1 2QQNA 4QD2A 4UW3A 1IQAA 2YXSA 1DCSA 1QJU3 5A7QA 2E6VA 2XHKA 4QPWA 1RXFA 5C71A 4Q8LA 1QQP3 2R043 1QJX2 4HXCA 1W39A 1C57A 3LPGA 4U2AA 4B29A 2YU2A 3ILFA 4AVVA 3WG1A 2ZHLA 5CAZA 1G7YA 1ZYBA 4XFBA 1UD1A 2A70A 4PQQA 5DG1A 3VBOB 4R9BA 3R0RA 2J1AA 3POGA 3S57A 1K5MC 3PUSA 4K1ZA 3WXPA 4QB1A 2QZ2A 1U0AA 3AVSA 1LKNA 4KU7A 3OEBA 1UL9A 1LULA 3R6SA 3GF6A 2DTYA 1PO12 2R071 4GMP0 4P9JA 4DO0A 3OB8A 3HNBM 3KVAA 1RMU1 5DUWA 1UOFA 4BYYA 2MHFA 3T2TA 4ATFA 4RHV2 4KGGA 2YYOA 3CJIA 3T09A 5FXXA 1BEV2 2JB8A 3WW2A 4YZ3A 4AFCA 4OYUA 5C8CA 4DOUA 4L8QA 2E63A 2RS12 5FZ3A 5I0UA 4AXOA 4FOWA 3NKGA 4AAPA 3NW4A 1R1ZA 4FP2A 2OXBA 1SHWB 3EBRA 4BU2A 4Z82A 1VBE1 2W3JA 1NY71 2AC1A 3KQRA 4ZXEA 1HB3A 4XUPA 2ES3A 2VXRA 1EAH2 1H8VA 1W0PA 2X09A 4UAPA 5FYBA 3WNMA 3NNGA 2W0XA 1Q8PA 2BDRA 4YZ2A 1UYXA 3MW4A 1HRI3 2I45A 4QDRA 5T54A 3AFGA 1AYM1 2ZACA 4XTPA 5F39A 3X29B 3ZFEA 5C33A 4OULA 1UMZA 3L2YA 3VBUA 1VB2A 5EXOA 4QPYA 2R062 4Q4W1 5IAVA 3AXEA 3AKQA 3UESA 1IS4A 2Q8CA 1HLCA 2ZGUA 1CR7A 2XBO1 1BBT1 4AQ2A 2GU9A 5FOBB 2ZBJA 2X5IC 5JOXA 4A42A 1PIV2 4HBNA 1W2AX 4COUA 5F32A 1FXZA 2DCYA 3ZR5A 4N53A 1STMA 1UXZA 2O1QA 3RI9A 2GAUA 2V09A 3CF6E 3RZZA 3HN3A 2E32A 3IZOA 5IJRA 2MEV1 4RSUA 2WL1A 5HXMA 2BEOA 4YARA 3W5NA 4D94A 3VBOC 5C9AC 2ZOEB 2D3SA 4XACA 4B4QA 2GSYA 3FN9A 3VKNA 1S4CA 4IESA 5F2WA 4AEKA 1C3HA 1AR73 5LBCA 4S2DA 1GZCA 3B01A 2DYCA 4F8AA 5T50A 3ZYBA 2W1QA 1ZREA 1D4M3 3BN6A 2RDNA 3HAGA 3RZMA 3VBHB 2ZEWA 1H9PA 3DYOA 3IPVB 3LA2A 2AH2A 4IEXA 1ULPA 1W6MA 2B5HA 2A6VA 1W8FA 3U4SA 3WDXA 5A3MA 2ZGRA 4Q1PA 2W46A 5BXXA 4IQPA 2FZ1A 3TEXA 1OQEA 2ZABA 3R4SA 1W8WA 1W05A 1XSQA 1RITA 4JKLA 2GN3A 3I2JA 3PU3A 3GHNA 4KGQA 4OUMA 1CAXA 3OY8B 4K3UA 1TMF2 4N43C 5EJ1B 2E33A 1WW4A 4P02B 1JN2P 4YGCA 5A3OA 1ZBE3 3UGGA 4A4AA 1IKPA 1EUUA 1QXPA 1VBC1 5JXIA 3VDBA 1RVF1 3IDBB 3NKTA 1ASJ2 1RIRA 5HCBA 1QF3A 2KM2A 2RM21 2A6WA 3FHAA 2RMU1 1ZZ7A 3M1HA 2Q0AA 4RS5C 2D5FA 5DAQA 1K42A 3OPTA 3RMYA 3K3OA 3KCCA 5L7OA 3DKWA 4P9WA 3ZXDA 5DAPA 1W2TA 3A22A 3KMHA 4G3YC 5C3SA 1OH3A 4MUVA 1RYYA 2C4XA 4UOJA 1NCRA 3OUJA 3GNEA 3N7KA 4UXAA 2DU1A 4JGZA 5CIRA 3SQOA 2J1SA 2WT0A 4COYA 3HJRA 2PHUA 3KM5A 3POJA 2R072 4JQTA 4OUSA 4QPGB 3KSCA 4NUBA 3KV4A 4PLNA 3APBA 2ZCWA 3H9AA 1P8JA 3LEGA 4R9DA 5A7WA 4KWUA 1J59A 1YXWA 4IE7A 4LNVA 2BZDA 1VBB3 3VD9A 5J1XA 4RGGA 3H8RA 4IEYA 1G6NA 3VKMA 2IXJA 4RS5B 3D3AA 2WZPP 3RDIA 4YVWC 3WQ1A 5BNOA 4BMBA 3OBZA 2C9KA 3AYCA 4XBLA 5IVEA 3NSTA 5LWBA 2VC9A 2VUDA 5KC5A 4MOAA 3KS7A 3PUHA 1PX4A 2WSUA 2WJSA 4COVA 1G9BA 4GALA 2DCTA 1VBE2 1OSGA 1NY72 3GBWA 3AC0A 4OQ8A 2W1UA 4M4PA 3WEZA 1YO8A 1DF0A 1YQ8A 2IUWA 1LOCA 1ZBA3 2NLRA 3FBMA 3KT1A 5FXZA 4E4SA 3BODA 5IWFA 3O12A 5FZIA 1YC61 4WVVA 3I59B 5FZ1A 1RUE3 1AYM2 1H1IA 2W2IA 2OKXA 1N3QA 1UZ0A 2D6PA 4UYBA 4PF5A 1JI6A 4RR3C 2BGPA 4Q4W2 1HB2A 1HN0A 2ENRA 1DQ6A 1O7FA 2OPWA 4KU8A 4YVWB 3ZDVA 5BNPC 5BNNB 1S2KA 2XBO2 5FOJB 3WG2A 4IE5A 1BBT2 5EJZB 4DZGA 3I2IA 5ANNA 4QXKA 5FJKA 3MFCA 1BJQA 2VQTA 3VD3A 3C7EA 4RL7A 2ZGMA 4YSFA 4K6BA 3LWCA 3LGRA 3NO8A 1CAVB 3EMRA 5FZKA 2K9ZA 4JVAA 2XUEA 4K8FA 3T2PA 3LA7A 2WAAA 3PUIA 5ABJC 5DABA 5KHGA 3W20A 2Y60A 3N9MA 3ABZA 2MEV2 4I09A 2JDKA 5FDBA 2K0GA 4AVAA 1KFUL 5A80A 1ST8A 4EJRA 1DZQA 1SPPA 2WZR1 4K1YA 3D4KA 2P3KA 4FQZA 4GIQA 4FTSA 1RC6A 3GZUC 4QM8A 2OZJA 4ZU7A 4TYSA 2GNDA 3MIBA 3T0DA 1UU6A 4CDXB 2VBBA 1UCXA 1YQ5A 5ISLA 2OS2A 1SFNA 1W2OA 3MICA 5F8PA 1YJKA 1Z7S1 4NHKA 5A1LA 1UIKA 3NNLA 3HNMA 4XQWA 2PHFA 4FPJA 2D6OX 4GWMA 4XBNA 4B1MA 1HX6A 1BQPA 5DZGA 5FXWA 5FAXA 1JYXA 5LRSA 1A6CA 4DNYA 4PLMA 3QH6A 2VMDA 3AFKA 4IXLA 1AR63 4CU9A 3WDTA 1CESA 4XDPA 5JOZA 3OGVA 4JKKA 4YG6A 1XE8A 3HWJA 3B7MA 1IPSA 4PIXA 4YFZA 5HCAA 1VBC2 1LOAA 5LA1A 2J7MA 2A6XA 4Y4YA 1RVF2 5FYCA 4UI9L 2RM22 5J09A 3PDQA 4BOWA 3WDVA 2RMU2 5F5CA 5L36A 4BISA 5CNAA 4ZPIA 4LK6A 2R30A 3PJYA 5FK7A 4XF0A 4AG4A 1QEXA 4GMP1 4JHZA 2IZWA 5JSPA 3D0SA 3MUZ1 4RGKA 3P5BA 4I30A 3ZSKA 5KR7A 4KMQA 1NT0A 4XPVA 5LEJA 1O8SA 4NAMA 2VBPA 1MVEA 1RUJ3 1NCQB 2XQXA 4AFAA 4QXBA 3TYJA 3ZIWA 5IHRA 4DRRA 3WDWA 3PTRB 3JD73 3MV11 4MV2A 1BCXA 4UW5A 1O6UA 2ZAHA 2PHTA 2JJ6A 1Y43B 3KLSA 4IV1A 3M8LA 5IVYA 3CJIC 4W4ZA 1JBCA 3ENRA 3THDA 4EROA 3CEWA 3I8TA 4Y33A 4M3CF 1N1YA 4EE2A 2VNVA 2W91A 5DZFA 5C8CC 1F4AA 2AACA 2WAOA 5DAWA 4CDUB 1V6IA 1ZNPA 3FHQA 3PURA 4CXWA 2XOMA 1DGRN 4LBKA 3UGHA 5I0RA 3W5MA 4AW7A 4S2FA 1GV9A 3NAPA 3SNMA 3K51A 1HQNA 3B69A 2HWF1 2Q30A 2H0BA 2QTWB 3WINE 5BV6A 2ARCA 2ID4A 4LHSA 4URAA 4M3CB 2OVUA 2O0OA 3PHMA 3ZFEC 4LPLA 3T08A 2Y64A 2DVDA 2IXIA 4XZPA 5J98B 3VBUC 3ZN5A 4CU8A 2Z5WA 4KI5M 1WW6A 1H2LA 4M4RA 3VHOA 1GMMA 2GNMA 2R7EB 5G04L 3WG3A 1PZ7A 3WQ0A 1XPWA 1DBNA 4XJ9A 2WFF3 2XHNA 3EB7A 3QBQA 4FPHA 1CZSA 1ND3A 1PGW1 1SMVA 1S0DA 3IWZA 1FMD1 4MYEA 4AI3A 2RS33 3I49A 1PO21 1H2MA 1NZCA 1QJEA 2HYKA 5JZGA 4AL9A 1JUIA 2CL2A 4KH9A 4N53C 3V0BB 2WYSA 1BHGA 4Q26A 2UU8A 1ND2A 1FI2A 1PVC1 3VBUB 1W6PB 3H1YA 2XLFA 2RDQA 4TXWA 2P2KA 2DCKA 5GLWA 1UAIA 4HVRA 1R093 2WZR2 5DQ0A 4AGVA 4DS0A 2YGMA 1HDKA 1ONAA 2F6BA 1SCSA 4H7MA 4ISRA 3WDUA 4C1XA 4LR4A 4Y1ZA 4DXZA 2Q1ZB 4I01A 1DLLA 4CDWB 3ZXGA 3KGLA 5FZOA 3VZLA 3AL5A 5K8SA 4LBJA 5GKAC 3ACHA 3TB0A 3BGAA 4Q4X2 1AR91 3TN93 5JOWA 2P17A 1Z7S2 4NOTA 2DVBA 5FZ0A 4HFSA 3GZEA 3CBNA 1GWMA 4N53B 3B94A 4ASKA 4XFAA 5ACA1 1JOPA 1POV0 3I4IA 4JAAA 2DTWA 4INDA 4WVMB 2BQPA 1YNAA 1WKYA 3IAQA 1DLCA 4OHZA 2J42A 4Z07A 1W8UA 4BK4A 1DU3D 2QNKA 2WDBA 4FSJA 3B3QE 3K75B 2WABA 2XLGA 2XQRA 4LBQA 4AVBA 1C5IA 4LEJA 1URXA 2PA7A 1OURA 4JDNA 3H8OA 2DDUA 3PVNA 2ADDA 4CCLA 2ERFA 4DXSA 4XMIA 3CLPA 1GOHA 4QQ2A 3ZFFA 4N9IA 1YLLA 1FYUA 3LEKA 2P4EA 3WT3A 1Y9GA 4D6QA 4AI2A 3THCA 5L7OC 1MS4A 1E5IA 1HV0A 4O65A 2BBAA 2DUOA 3M2MA 2XDVA 3MO4A 1Y9MA 2VECA 5D1IA 2V4AA 4HN0A 1TEIA 4JGZC 1HXS1 4IERA 2PQSA 5K0UA 3SCGA 1D0GA 1KDMA 1ZZCA 2GDFA 3KCXA 2JECA 2Y0IA 4IGQA 4MO3M 5FZ8A 5IATA 4H2AA 3B02A 5JXJA 2D98A 5GLUA 3ZX7A 5LA9A 5FP8A 5JVVA 3O1UA 2NMOA 4WM7A 1VAMA 4AQTA 3M4FA 3MIHA 3TAYA 1WLCA 5F2SA 3K4ZA 4ES8A 2JG8B 1JZ6A 1HRV1 1DQ5A 4HSJA 4A6OA 4DY5A 5D8AA 3ELNA 2GMEA 2W68A 5L7OB 1R64A 4CXXA 2I2SA 5BNOC 2Y6GA 1MR5A 1LJ7A 2CTVA 1W8OA 3DECA 4XUTA 3LSEA 1A3KA 1NCRB 1TQ5A 2V5DA 5EWSA 2DVAA 1WD4A 4O9GA 1Q43A 1W3XA 1BKZA 5B4XA 2QQJA 1AUYA 4FQ4A 1CZVA 1CONA 4BQYA 4HZFA 1YFYA 2HWF2 1OLME 5A7WB 1S2EA 1C1LA 1H8TB 1C28A 5A7NA 1H9WA 4K8RB 1YWKA 3SKVA 1GZ9A 1KJRA 4XAAA 5FP4A 4GH4A 5KHIA 1CGPA 3TNQA 4GB31 1HQLA 5C3PA 5I93A 1LGCA 2VZSA 2BBVA 1I9RA 1ULGA 3LOBA 2DUPA 3P6BA 2JKBA 3B9IA 4FP3A 4E4HA 4AHWA 1C4RA 4PBPA 4AI1A 4V2VA 1PGW2 5FPUA 4JX0A 1RUI3 1FMD2 3GXUA 3POYA 4CP9B 1SLBA 1PO22 3IIIA 1C8M3 3VZOA 4XE9A 1DYOA 4FI9A 1DGWX 3S0MA 1GWKA 3AZZA 5L73A 1L7LA 1JYWA 1MZ6A 1OF3A 2ETEA 5ANQA 3VBRB 2XXZA 3G7DA 4KL1A 4KBZA 3AJYA 2WO7A 1PVC2 1T6BX 4NR1A 1T6GC 3ZXLA 4HANA 4XQ4A 1GYKA 3MLLA 3OBAA 2HBUA 3RYRA 4Q4Y3 5CG9A 4AWDA 3WCSA 4HK8A 1MZEA 1UF2C 4DY3A 1O91A 4YYOA 1LGBA 1YQCA 2NQYA 1GANA 2RHPA 2WWJA 3MLKA 4AEDB 1ZRCA 5BY5A 1UYYA 1H30A 4IEVA 5FYZA 1LU1A 5L9VA 4XC9A 4ISQA 1AR92 1FAYA 1RUH1 3H1MA 3W9AA 1FPN1 3WR0A 1WCQA 5ACA2 2BUKA 1EV11 5LBFA 5FZ6A 3VD5A 3J8F3 5EYYA 3C7GA 5A3NA 1L7QA 1V00A 3O0WA 2YROA 3AMNA 4CP0A 1QU0A 4X6QB 4LHKA 2OA2A 2P6CA 4R4XA 1M4WA 4XUNA 3T2OA 3H8UA 2A73B 1JUHA 4MGYE 1SCRA 4GJZA 2EXJA 1DGRA 4MH0E 1O4ZA 2VQUA 1FV3A 2VCAA 2ZGSA 4FOVA 3UJOA 1LESA 4PIYA 1W06A 4OLLA 4HPKA 1QMJA 1AR81 1AL0G 3HQRA 3FUQA 2ZGKA 1K5JA 1BXHA 1MS9A 2ORZA 2VUCA 4XETA 3WNOA 2Q1MA 5GZEA 1DZTA 2IC1A 1QJU1 1T2XA 2GALA 3ME2A 1BVP1 2ZGQA 1QQP1 4MGKE 2R041 3H3UA 3WF1A 1HXS2 2BNOA 3Q9OA 2EVXA 2K2SA 5KC6A 2ZMKA 5GZFA 2CDPA 2H6BA 2J1UA 2ZX3A 3E6BA 4FXGB 2F4LA 4W6YA 3ZSJA 3VLBB 1JTZX 2GH8A 2XJVA 3JB4C 4FCAA 1F5JA 4GKYA 5BNQA 2CHHA 4Y26A 1NA1A 4AR2A 1COV1 4IV1C 3PLQA 4XIKA 3WQ7A 3FC0A 4F7ZA 2QQLA 2WS93 4EN7B 2AZ5A 2WA3A 4CVUA 1LHUA 1OLRA 1R1A3 2PN5A 1WCSA 4UFLA 5LBEA 5CZKA 3P3PA 1QH6A 3KGZA 4AFBA 5CFDA 5FPVA 1WUVA 2GNTA 4I02A 3B9CA 3ZFGA 1I3HA 3FFZA 1UY4A 1OA4A 1GKBA 2ET7A 5H9SA 1RB8G 1MQTB 5JLVA 4Y5Z0 1U5YA 3NAPC 1W90A 3IAPA 1OQ1A 3CL1A 2B7YA 3VDDA 1LGNA 4OI4A 4J6GA 1MS0A 3POFA 1MS5A 4QMAA 2QVSB 3ZMOA 3KV6A 1QXJA 2RR13 1SACA 4FFIA 1ZRFA 2NZ9A 3PU8A 2PLV3 5FCCA 4H14A 2X10A 4AHYA 1PNFA 2ZKNA 4R9AA 3WP5A 1OVPA 1A8MA 2BRTA 3MPBA 3ZOIA 5LY1A 3USSA 1MZFA 1FOD3 2CGNA 1LECA 1KXGA 1YRZA 1JZ2A 4XTMA 3N36A 2A3WA 1H4HA 4UW4A 3AMQA 5F6LB 5A3WA 1DYPA 2IWGB 3ZN4A 1ND3C 5CBLA 3P3NA 1DQ2A 4WV8A 5HBAA 5IFTA 4GZ9A 3SKJE 3RZLA 1GWLA 2CSGA 2PHRA 5JZGC 4MGZE 3N9NA 1W04A 1TZOA 2A3YA 3MF9A 5HI0A 4YM2A 5FQ0B 3THPA 5FYIA 4YZ4A 5FYMA 4XFFA 2CV6A 3HOBA 1QJX3 1ND2C 2WNVA 4NHXA 3WNXA 5C70A 1IPKA 1AYN3 4QDQA 2C0ZA 2V72A 3ACIA 3AVRA 4O9EA 3DEMA 1H6XA 1F31A 1CVNA 4F3JA 4ZHNA 1NXMA 4GXLA 4LIUA 1B09A 4YPJA 1VBD1 1SZBA 2ZX1A 3UGFA 3SH5A 1POV1 4QX7A 3PUAA 5FWEA 3JBG1 3HBZA 1PO13 1H6YA 5CKQA 5FP3A 1W03A 4TWTA 3WP4A 4Z8BA 1RUH2 1PM4A 4RHV3 1FPN2 1RJ8A 3E6DA 5LCWL 5A6YA 4XFIA 1EV12 1WWYA 3CIHA 3KZ4C 4HMZA 4CTEA 5C6CA 2XGXA 1ND2B 3NL1A 1CN1A 4QGLA 2XJRA 1X7NA 3SMHA 4AGGA 2AGSA 1XJAA 2VOKA 1NAEA 1S0FA 2JDZA 4AE2A 2RS13 4AGRA 1S1AA 1W0NA 2VE1A 2A7AA 1ZA4A 2QQPA 4IEUA 4Q0UA 3O1SA 4NPRA 2BFUS 4C1WA 1HB1A 4AEJA 1JYCA 4OMCA 3O14A 4WVWA 1EAH3 1OBNA 1W3VA 4OFGA 3ZFFC 5GZGA 1LHOA 3RI8A 1RUF1 3PMSA 1QOSA 2WT1A 2VU9A 1G9AA 2XG3A 4CUGA 1AR82 4ASMB 3O7OA 1W99A 2SLIA 3EO6A 4OI2A 3MW2A 1OPMA 5F5IA 5F5AA 3T0AA 4YW7A 5CISA 1W9YA 5JPMB 1K5MB 1QJU2 3M7AA 4RA0A 2VNOA 1SLAA 1Q56A 1QQP2 5K0UC 2R042 4LBQB 4NO4A 3OBRA 3H50A 2HH9A 5GJ6A 3VDCA 5CA6A 1JS9A 3OGGA 4MZUA 2EIGA 4ZXKA 1PIV3 3ST7A 4ARYA 3T1LA 2JENA 4WM7C 1DGLA 2PXJA 1WLWA 1COV2 5FYSA 4Y1UA 1ENRA 1JYNA 2P3JA 3BYWA 5FY9A 3ZKYA 3ZYIB 5FYUA 3H3ZA 3ZYRA 1CPNA 5D8AC 2E31A 5SV8A 1TE1B 1S0GA 4IEZA 1DG6A 5C4WA 1W6OA 1X82A 1UYZA 2DBIA 1IG3A 2AR6A 4YRDA 1W6QA 1H1MA 2WKKA 3A21A 3UK9A 5IK8A 2FDIA 1BK0A 2WZEA 4Q2FA 5FZFA 1LTEA 3WNPA 5K0UB 1VBA3 5DDJ1 4QX0A 4I0WB 3ASIA 2WUHA 3VHNA 3HIFA 4IEQA 2WQ8A 4WM8A 5FLJA 3WF2A 4QU2A 2ZHKA 3UT0A 1XRUA 2UURA 3K77A 5CYYA 2RJ2A 2Z4FA 3VKFC 3AP7A 4HLTA 5FZDA 5KWRA 4K7JA 4OCTA 4Y1YA 2BERA 5D8AB 2GP5A 1WA4A 3AMHA 4ZONA 3WUCA 4GH4C 2HEYF 2ZPXA 2VOVA 1BZWA 3MDPA 4CCEA 3OYWA 2VO5A 3DUIA 2D6MA 2X5IB 4IDZA 2R1BA 4LITA 4U36A 5F3IA 4CCMA 2XMLA 2ZEYA 5SV5A 1DDLA 3RFRA 1EP0A 1MS1A 4LHNA 2BFUL 1UKGA 1OFSA 1LRHA 1D2SA 4GKXA 2JD9A 3DYPA 4HVOA 1JHJA 2ZGNA 2CY6A 1ASJ3 1H2KA 3UKTA 1RUG1 1CZTA 4OQ9A 3HVDA 2JXAA 5JXHA 3L9JT 3BIEA 5T5OA 1VPHA 2TBVA 4RFT0 5FY4A 5DMYA 3WZ1A 1HIXA 5C9AB 3KQ4B 1R081 2ZZQA 2W9XA 4GH4B 2ADEA 4RYDA 5A70A 1EYBA 1UU4A 4CEYC 1XB9A 2XWJB 5DUXA 3LEMA 5FXVA 5T55A 1IGOA 1SEFA 1VBD2 2VNGA 2G4IA 2CWSA 1I5ZA 4Q0QA 3JBG2 2FMDA 1GQPA 2R073 5JUVA 1ULFA 1Q8OA 4XF9A 5I0DA 4XJUA 4QX2A 2CGOA 3LKJA 5T52A 3V56A 3K4DA 3VDAA 4BZ4A 2EA7A 2W1SA 4MSVA 1OT5A 1Y3TA 2O8QA 3BTAA 4AQ6A 3DL3A 4BK5A 2R0FA 4NIHA 1G86A 1SBDA 2XH6A 2XJQA 2K46A 4N43B 5HCFA 4QQHA 2YFUA 3N7LA 1YQ2A 1RMU2 4O61A 4IE6A 3WCRA 4CEWA 3GJAA 1YHFA 2WWSA 3JCIA 1NYWA 2ORXA 1VAVA 2CWMA 5BUVA 2FDFA 1XC6A 3MFAA 1RUF2 1WLDA 5FZ4A 4FPEA 2HLEA 2YY1A 4IEOA 4HETA 2ZTNA 4OHVA 5FZ9A 2VOXA 1JYTA 1AYM3 1UY0A 3MGUA 1AL21 2AUYA 2WBKA 4W6XA 3I3QA 2Q8OA 4SLIA 1VMFA 2BTVC 4NRMA 5LZ6A 1FNZA 2Y0OA 4LUKA 2WFPA 1OLMA 1I6XA 1JZ7A 4LIVA 3MI8A 2XBO3 4NIIA 2EALA 2J1TA 1BBT3 4DUWA 3ZSMA 2GNBA 3H42B 3D5OA 4FOQA 4WBBA 3WOGA 4MGTA 4XXPA 5JXGA 1ZZBA 1NA1C 4PT6A 3WW4A 3ZYJB 4MXWA 1CAWA 2QQUA 3IDEA 3SH3A 3EHKA 4CU7A 3C7OA 4FVVA 3NJVA 1KGYA 5IVFA 4HPKB 3TEWA 1PZ8A 2DURA 3VZKA 2QQIA 4Q4V1 2MEV3 2WIIB 4JV4A 5CFDC 1XOYA 2DVGA 3RYPA 4Z92B 3ZFGC 4JDMA 3O1PA 3WV6A 4GWNA 1B35A 1Q3EA 5FV3A 4NWVA 5DDJ2 4CA9A 4EN9B 3POBA 4KWJA 1MEC1 3HT1A 3J7MA 3VDDC 1OVSA 2B4KA 1GZWA 3KT4A 1JXNA 3UYJA 1NA1B 5JIAA 5BPXA 1PGSA 5G05L 2YDEA 1YUDA 3KHBA 4JHTA 4NN0A 4IV3A 4RR3B 5E8AA 4YW4A 1RUC1 1NE4A 4E4ZA 4XHXA 4GULA 4QGNA 1AVBA 2JKXA 1VRH1 1ENSA 2Q5TA 3MIEA 5BNPB 2FHRA 1Z78A 1Q5OA 3F2ZA 2N7GA 2HWE3 2VGDA 3ZXAC 3N4MA 4XJ8A 3ZR6A 4MGQA 3ZFGB 3O1TA 2HWC1 4AHZA 1VB4A 1UYPA 1VBC3 1FNYA 1LHVA 1V70A 3A0KA 1IG0A 4OI1A 4LORA 5ABJB 2Z79A 1RUG2 1MVQA 2RM23 1OA3A 2WFF1 3CU7A 4NAOA 1ZA7A 2QDNA 2RMU3 1W6NA 5L19A 1X36A 5KXBA 2WNVC 2OUHA 1WA6X 3CZJA 1Y4WA 1OKOA 3U07A 1G9FA 4XMAA 1W9WA 4XJZA 1R082 3DPRA 3AZVA 3T3YA 3ZMNA 2ZHMA 1JZ5A 3T4HB 4E2SA 1GQGA 1LU2A 3ACGA 4LLOA 2ZAAA 5EJ3A 3AYEA 2MNGA 4QXHA 3MHZA 1UKRA 1R091 1W9FA 4UF0A 4YWAA 3SC7X 1UOGA 2O14A 5LY2A 2FCUA 4C0HA 3ZXFA 3ZLIA 3ES1A 2RS51 2E7AA 1W28A 3CJXA 4FT8A 1LOFA 1UY3A 2RG4A 5A6QA 1S0CA 1Y9QA 3MYXA 3TWIA 2JEMA 4ZKTB 1N47A 3G6JB 4H3WA 1AJOA 5E88A 5B2GB 4L11A 4LO6B 5BYNA 3CQOA 4PBOA 3VL9A 4IETA 3W58A 1V6NA 2CAUA 3OPWA 2WO3A 2E51A 1G8WA 4D69A 1EUTA 2NPIA 3D8CA 2VMGA 1VLNA 3WF0A 3ES4A 1O5UA 3MF6A 2VOTA 5FPAA 2VG9A 2CAVA 2HEVF 3PJQA 4AVTA 4P9GA 2YBSA 4DPNA 1GOFA 5C3RA 4XABA 4B7KA 3SXWA 1AL22 4AEMA 1RL3A 3AP5A 1A78A 2WNUA 1F9KA 5JI7A 1OXCA 3RJ2X 1OD5A 5AC93 1OA2A 2JDAA 2RJLA 1D0HA 1ENXA 4FPOB 1WD3A 1OOPA 3BB6A 2BNMA 1REEA 1RHI1 1VAKA 2JG9A 3AL6A 3AZXA 3C2UA 3H7JA 1OC1A 1OH4A 1QJFA 5H9PA 4E2QA 2XONA 4EZ4A 1W2NA 4L2NA 1O4TA 3CJIB 1DGWA 2NM1A 4UFMA 2VW2A 3AJZA 2FDGA 1Q8VA 1Z0HA 2WLQA 2Z2SB 2WA4A 4M3CE 3OGRA 5DZEA 3I2FA 4UFHA 3DXTA 3WHUA 4L97A 4YW6A 4FBFA 2PHXA 4Q1RA 5C8CB 2VCCA 3MEPA 4BCUA 4PDWA 3SCFA 2VZTA 5C4WC 4W50A 4DEVA 3EYPA 4Q4V2 3T2QA 3U75A 3NV2A 4E8CA 3NRUA 4YW5A 1EPZA 1VP6A 2EXHA 2JD4A 2QUOA 3ZN6A 4E9KA 3MIGA 4EN6B 4W65A 2BVBA 2WZR3 2QCSB 3GHMA 1QNWA 2R49A 1V9U1 4Q0VA 4Y3OA 4WM8C 1MEC2 1RUD1 1E57A 3A23A 4GJYA 4YGEA 3CKHA 4XUQA 4PCRA 5FZLA 5T5JA 1QKQA 2YGLA 2ZZJA 5FO7B 3E1F1 1E5RA 3U14A 2PHDA 3KB5A 1SFYA 2VUJA 2B45X 2EXIA 3HQUA 3PIJA 4Q4X3 1JU3A 5FMCA 5CG8A 1Z7S3 3LIGA 1GOGA 3OGSA 1UZYA 5KHKA 4QDSA 1RUC2 1UOJA 4CXYA 2GC1A 5A32A 2NMNA 3ZYFA 5C4WB 1DYKA 1W6OB 1VRH2 3USUA 4COZA 4JGYA 4L99A 5IT6A 4H55A 2QFEA 3UL2A 1K45A 4D3WA 1S2BA 4QGMA 2GC0A 1ULOA 3LQCA 4RD7A 3UNPA 2IXLA 1HJFA 2RDSA 3TEZA 2P34A 2HWC2 1V6KA 4BPZA 2A71A 3HD8B 4QWNA 4XJWA 4YG0A 4WM8B 3IMMA 5JDBA 2HEWF 2ZX2A 5FKCA 5FREA 1KDKA 4N7IA 2J1VA 1JU4A 2XJPA 1NE6A 2XB6C 4AI8A 1RUI1 4J1XA 2LW8A 4Z2AA 3PMEA 5FY8A 4XIOA 2ET1A 3LDBA 4E4DX 2NN8A 2P3IA 4CPBA 4XZUG 1TNFA 3OYWB 1L3JA 1XYPA 4BXFA 2WZ8A 5AFBA 4LK7A 1JHNA 1QJY3 2P3YA 3MIDA 4UWDA 1RJ7A 4QX5A 3WSOA 4UT5A 4C8DA 2W52A 4DB5A 1O4YA 4XCAA 4WZCA 2YFZA 1SFPA 4DRVA 4Q4Y1 1XU2A 1W6MB 2VMCA 1U5ZA 2XR4A 2OQ6A 2RS52 5C7GA 2OPKA 3I54A 4UW6A 1XQNA 1VMHA 3R05A 4M00A 5FJHA 1UO9A 3DCQA 2VQAA 1F5FA 4XF1A 4LKEA 3AYAA 2QE3A 1EPWA 1O3TA 1CAXB 2JDNA 2LALA 3I7DA 1PZ9A 2GZWA 2X8KA 2Q4SA 5JSOA 1IKQA 1SQ4A 3FL7A 4CEWC 5HV0A 1OI6A 1XU1A 4FPYA 2IXCA 4BE3A 4RQPA 1CJDA 3N9LA 2AEZA 2HWD1 4DXRA 3BTZA 3I2GA 3BU7A 4AF9A 1GNYA 3ZIXA 3HMYA 4CCJA 1TME3 1AXZA 1AX1A 2TEPA 4K20A 2OYZA 3WY6A 3CDZB 2W94A 4TN7A 1X8MA 2UWAA 1VALA 4ZZ8A 2DCZA 1JYIA 1JOJA 2MPFA 2ZHNA 4EWEA 4P9LA 4JGZB 3UKVA 2ZGTA 1F15A 2I07B 4E8DA 1V0AA 4NMIA 4XQDA 3SEPA 5FUIA 4A2UA 1Y7BA 2XL7A 4FPKA 4BWOA 1RHI2 2TUNA 3RVHA 1CQ9A 1E5SA 1S55A 4CEWB 4FTEA 4HN1A 3GZAA 4QXCA 3KCYA 5IK7A 1QXRA 2BVVA 3AZYA 1PM7A 4OVEA 4EWAA 3F95A 2HJIA 1H1AA 1OFNA 3RJRA 3ILNA 2E7TA 4LBQD 5BNOB 1PNGA 2YPDA 3U37A 2VPVA 4L9BA 2D6NA 3FHIB 4YVSA 1MPXA 1PVC3 3N7JA 3TEYA 3VBHA 4NHMA 2FMYA 1R1A1 1N3OA 1B35C 2WYFA 4K40A 5KHHA 1V9U2 2FQPA 5LA2A 1AX0A 1JYVA 2BGCA 1RUD2 4OZOA 4XURA 1BVVA 1J3QA 1OF4A 5FPLA 3TNPB 3ACLA 4DUVA 3OY8A 4LUMA 1AR93 4XOGA 2B46X 3SEEA 1CAUA 2DF7A 4IV3C 1LOBA 2PYTA 4URTA 3UETA 1D4VB 1YEWA 2HYXA 1NZIA 4QHOA 4CEYA 1JH5A 2VZ3A 5T5LA 3KD4A 2QQMA 3E5UA 4OHXA 4PLOA 2HBTA 3WW3A 2VZOA 1XNTA 5AVPA 3J7LA 4BQ3A 4ONUA 1B35B 3N3HA 1FV2A 4G9SB 1O3SA 2EIBA 3PUQA 1WMEA 1WCDJ 2ZA9A 4YM1A 4B3NA 3RRDA 4EYUA 1FOD1 3OTFA 3U10A 2JWPA 3Q8CA 3MW3A 4YM0A 1GZWB 1ULDA 2B42B 2PAEA 3POEA 3PIGA 3IT8A 2VBDA 3QH7A 1DQ0A 2IFWA 3VBFA 1PGL1 1RUI2 4QPGA 2C1FA 1SPPB 5JSRA 2ZJCA 2ZX0A 4CP9A 3DPRC 1GNHA 4MGSA 5JAXA 2OT7A 5IUQA 4A44A 5FK8A 3U4XA 2J1EA 3NV1A 5CFCA 1HXS3 3K46A 1I1EA 3TRSB 4NHYA 2W87A 1BYHA 4ZS3A 2EAKA 3ZDSA 5HXVA 1AYN1 1V6MA 3R4DB 3M3QA 5I0TA 4QAWA 5FZMA 5A7SA 5F3EA 5LBBA 1WGPA 1FX5A 4LLFA 1CX1A 4FFHA 4JKMA 2R32A 5A3LA 1LOFC 1PO11 2Y6KA 1F2NA 2W95A 1C5HA 4BQ1A 1YYNA 4YLZA 3PVEA 5A33A 4OZXA 3NJYA 5FLIA 3AKSA 4QQOA 1NLQA 3DPRB 1QDOA 5GM0A 2VCBA 2EAAA 2WN2A 2Y6HA 3K3NA 4PIZA 4CE8A 3JZVA 3LE0A 5LASA 2ZMNA 1WLTA 1F8VA 3T1MA 5J3UA 2VQ0A 4AI9A 5BNNA 4FAGA 5I8TA 1HRV2 2VMHA 2HWB3 2YMZA 2HWD2 3KV5A 4UF0B 3JUUA 4DXTA 5C8WA 1O3RA 1Q8SA 5IK4A 4XUOA 2E26A 4DUXA 2XKPA 1XNDA 5LRRA 3N7MA 1OD3A 2ZMLA 3GCWA 5FZAA 2D44A 2GMMA 2QQKA 4IE0A 1V6JA 3FX3A 2D3RA 2WNUC 3VUOA 3B00A 2FD8A 3AP4A 3B93A 1JZ8A 4N7UA 2XJTA 3NVCA 2A5ZA 3WF3A 3O1RA 3FJSA 2B9UA 2AYHA 3V65A 1OOPC 3VD7A 2JG9C 4BH9A 4XW3A 3WP3A 1L7RA 4Y5TA 1FT9A 1ZZ9A 4D0QA 4LBOA 1UZVA 1GQHA 2ARBA 4IV1B 4BIFA 3NV3A 3GBFA 3O1OA 5KXCA 3I3DA 2ZXQA 5TSWA 5C5UA 3NQHA 3IM0A 3INAA 4QKBA 4GB32 4PDWC 4HT1T 3WX5A 1HRI1 4CDXA 3BPSA 5LK5A 5CB7A 4LXLA 4OUEA 2P37A 1SBEA 2OIIA 4CCOA 3ROUA 1ODNA 1W8NA 1BK1A 1EY2A 1RTVA 2WNUB 3J4UH 4QPIA 1YFXA 2ARAA 4MX3A 2VD7A 2OX0A 2DV9A 3LIHA 1GNZA 3ETQA 4LE4A 4FAHA 3AMPA 4SBVA 3NAPB 3TBDA 2BU9A 1OOPB 1AXYA 5IVCA 5FMOS 3D0JA 1OUXA 2W5FA 1RINA 3DGTA 2L9LA 3LDRA 2WT2A 1D2QA 4QM9A 3VKLA 4CUBA 1NOVA 2G19A 1WBFA 2NYYA 1VBA1 2VCMA 1RUH3 2Y26A 3GYDA 3GZTB 3P1IA 4UFIA 3WHTA 1J83A 1QOTA 4TLGA 1XBFA 5A7OA 1EV13 4HOOA 3IB3A 3LZZA 1QH7A 1DFQA 4JGYC 3BI3A 5T5PA 2DU0A 3L2HA 5IVBA 1MZ5A 4A7ZA 2YB7A 3ZN6B 1ND3B 2VZUA 2JB4A 4N8MA 1AJKA 1QHDA 2IXKA 4WVZA 3QCWA 4AVSA 1XYOA 2QZ3A 1KJLA 5JR7B 2LM3A 5JZGB 4TTGA 3CNAA 1AR71 2G1MA 1FOD2 2VNRA 4XFGA 5I8SA 2FBEA 1NCQA 1BEV3 1LOEA 4LBNA 2VZVA 1D4M1 1E5HA 2XL9A 4DMIA 1WW7A 1GFF2 2BW8A 2WNOA 1PGL2 5A1AA 1AR83 3I2DA 4LHLA 3NV4A 5A32B 3FUOA 3M3CA 4N90A 5FYYA 3ZO0B 1N1TA 3USUB 4JGYB 4XFCA 1DZRA 1NUKA 3ZFEB 4FFFA 4M01A 4AQSA 3V64A 1POQA 4ORFA 2JIGA 4W6WA 2P5BA 5FZOB 2X05A 2XJUA 1HW5A 4CDUA 5IAXA 5EPAA 3LSDA 1AYN2 2VMFA 2GH2A 1ZBE1 2V5YA 1V6OA 2A1XA 3BCWA 5F5QA 3VKOA 3ZVXA 1LOGA 1COV3 1WZXA 1M06G 2XKOA 2D97A 3BU0A 1SBFA 4B4PA 2R063 2UWBA 4DINB 5IVVA 1XE0A 3Q8EA 5DUVA 3ZXJA 3UV9A 1DIWA 3MIFA 1LENA 2CYFA 2ZS6B 4CU6A 5ERLA 1S0EA 4ZS2A 2BJSA 5JMOA 3ECQA 4M3CA 3ACFA 3E6CC 3AB0A 2GC2A 4AFDA 1WBLA 1WW5A 1LB2A 2D3PA 1N1VA 3AXDA 3E97A 5FMOL 1KRIA 1SDWA 5C3QA 3VB9A 3ZFFB 4RQPC 3NNFA 5F7UA 2WINB 3E5XA 1VIWB 4IL7A 1F4HA 2XWBB 2VXJA 3IDCB 3N9PA 5F3GA 5J96B 1WCKA 5CU1A 5A6XA 1YFUA 4TZDA 1UY2A 2A6YA 1KS4A 2P6HA 4Y22A 2V73A 4B8EA 1VBB1 4XHBA 3VZMA 3ZYHA 2EIDA 4ARXA 1H0BA 3OJBA 3JQWA 4A45A 3SH4A 4MXVA 2VULA 5JR2A 3V0BA 2H6CA 4EZHA 2UWCA 2VY0A 3POIA 2YC2A 2D93A 5JOYA 5FPXA 3M70A 5FP7A 4LTAA 4WM7B 5GLTA 1W6PA 5J7MA 3AM2A 3EJKA 4RQPB 1W8TA 1IHMA 3ON7A 1ZBA1 5FY1A 2WO2A 4P9YA 4CCNA 2OZ6A 5FO9B 2XUMA 1IS3A 2R0HA 3ZXEA 4GD4A 4AYUA 3V0AA 4CDWA 1HRI2 1XE7A 1RUE1 2GMPA 4YVSC 4AAXA 4B4RA 4YNIA 4GQ7A 2LS6A 4YG3A 3K2OA 3VBHC 1QGLA 2Q8DA 1TMF3 2RDRA 1HJGA 4QKNA 1SG3A 2E9QA 1RGSA 3QACA 4YW1A 5FLHA 1J84A 1J3RA 4FPCA 2JDMA 3RQ0A 4BMEA 4I2OA 3BUCA 1VBD3 2XVGA 4WVMA 5AVAA 3N9QA 4GA9A 4PJYA 1POV3 4ITCA 1G9DA 2DCJA 5FZCA 2IVJA 2BOJA 2ARXA 3JBG3 4M0NA 3ZPOA 3NNJA 4CDQA 2UYBA 1YJLA 3RPQA 1OPOA 5FYVA 2JDUA 1VBA2 3K4AA 1NKGA 4MHUA 2WQ4A 3C7HA 4R4ZA 4UFKA 1GBGA 5LK7B 1QJZA 5FY7A 2VVFA 1ODMA 1YQ6A 4I0BA 5EYXA 2VMIA 2FZ2A 3WP6A 3WF4A 5FIXA 2BWCA 3WNNA 2WWUA 4QB6A 1C1FA 4YGBA 3OEAA 4META 4Y1XA 1ZRRA 4YVSB 3EXUA 4D6SA 5EIYB 2X29A 4HKWA 4XF4A 5FTTC 4CCDA 4IGOA 3KVBA 3AP6A 1CIYA 4QKDA 1RMU3 2E53A 3RZJA 4BQWA 1GP4A 1DQ4A 1PK6A 1WMXA 3FFQA 1AR72 1PHMA 2HWE1 3MZHA 1HKDA 5CKMA 2WN3A 3FE5A 2QJVA 1D4M2 1RUF3 2EF6A 3PTYA 4X6RB 4JTNA 1CAUB 5E6HA 3VBFC 3CZUA 3I3EA 1HV1A 2ZKLA 4P5HA 4QPGC 5F6KA 4LKDA 4LT5A 1UWWA 1W0OA 4Q27A 3GM8A 3NJZA 4CEYB 3OF1A 5L9RA 4LKFA 1AF9A 5A3TA 2JG8A 5FRAA 4D7YA 3DXUA 4LO7A 5CVRA 1BMV1 1VBE3 4LULA 4BQ4A 2C24A 4P00B 4DFSA 4Z1VA 5CFCC 4B7EA 5A6ZA 1AR61 2D5HA 1VMJA 5F1RA 1OUSA 4K9SA 2JICA 4JQRA 5FPZA 1ZBE2 2BP6A 4W8JA 3S5AA 2PTMA 2VVDA 2VUAA 2HKXA 1IPJA 1W8ZA 4XF3A 2J1RA 2EIEA 3S7IA 4IEWA 5K7PA 5E89A 1XYNA 4Q4W3 5APAA 3ZKUA 4FPLA 4JC1A 4Q5OA 1FATA 1CX4A 3VBFB 1I5PA 2CNAA 5DN2A 2ZEXA 5GZDA 5C3OA 4KG0A 3I2KA 1NX9A 1JZ4A 3AX4A 1KS5A 1H8TA 3T4VA 3JU9A 3J7HA 3ALQA 2F4PA 1TVGA 1X33A 3ZXKA 5CFCB 1JW6A 1RUJ1 4YFWA 3GDBA 5DDJ3 1LODA 2D7FA 4KWKA 1UMHA 2JE7A 4OHWA 5BNNC 4M0HA 3VHPA 2G9ZA 3NMBA 3JD71 2FCTA 1QNYA 2B39A 3KV9A 2JDPA 2YG0A 4JRLA 5GZCA 3LEIA 2WLPA 3OSDA 1CJPA 5T3NA 3OUHA 1XNBA 1S0BA 1J3PA 1NXD1 3FLRA 1VBB2 5I0SA 1GU3A 2W92A 4BDVB 3DN7A 3IBMA 3LD8A 5A33B 4V2WA 2R1DA 5EV7A 3LF7A 3VBRA 3A4UA 1DQ1A 3MLJA 1CIWA 4YZ5A 1UOBA 1WCUA 2VVEA 3FZ3A 3VBSA 3M3IA 2Q8EA 4BIOA 1OMIA 2YC0A 4CUAA 4XXAA 1K12A 5AC91 3BKZA 4A7YA 3RS6A 5J37A 4XYXA 2PQQA 1V6LA 1ZBA2 2XJSA 2XVLA 1RUG3 1UZWA 2DFBA 2RV9A 3AKPA 3LOIA 4LJHA 1LEMA 4AEDA 4CCKA 4IUGA 4CDXC 4D7TA 2D43A 4LKSA 4ASLA 2PHWA 2VM9A 1RUE2 5CFDB 4ATEA 1ZM1A 1PX3A 3LPFA 2VR4A 3POWA 4QPIC 1R083 3HNYM 5LEKA 4LOTA 4OHYA 3M3OA 3OCPA 3FBYA 4Y20A 2VZRA 3QLQA 1RVF3 3VDDB 3Q8AA 3H7YA 2D6KA 3POSA 3VN4A 3IIAA 2C5DA 3URFA 2LROA 1PMHX 2OW4A 2RS31 5A3PA 1ZVFA 1RXGA 2CU5A 1NLSA 4FO9A 3OOXA 5GLZA 4EWDA 4YZ1A 4TLFA 3WDYA 4GWJA 2JDHA 4KQ7A 3HPNA 3OD4A 1QIQA 4XDOA 4NIAA 4P9XA 4NRPA 5DAXA 1VE0A 2D40A 2EXKA 2G9GA 4Q4X1 3U78A 1ACCA 4LE3A 2Y38A 2VMEA 4QPIB 3VL8A 3ZSLA 4LBMA 2FDKA 2AEYA 3SHRA 5FZEA 2XVKA 5AFEA 5IFPA 2WO1A 1J1TA 3RZHA 1YCIA 2YV8A 3PL0A 3WNLA 2HWE2 1NCQC 1REFA 4I3PA 4DQAA 1N3PA 2Y6JA 2BV4A 2WNVB 3TN91 4QHBA 5H9QA 4NHLA 1NQDA 1S0JA 4XAEA 5H9RA 4BLIA 1AL23 1IS6A 4XVHA 2IVIB 2J22A 3ZSEA 1ZZ8A 5A1FA 1H2NA 5FY5A 1BMV2 3QD6A 5DUUA 1GICA 1GP6A 3DV8A 4XEZA 2F17A 1AR62 4LMFA 1IZ3A 3T30A 4CDUC 1HB4A 3AZWA 3WLUA 5FWJA 2E7QA 4LA2A 4C0BA 3OD0A 3H0OA 2B8MA 2DBNA 3S7EA 2WRAA 1LR5A 4BXSV 1MQTA 1QJY1 1UY1A 1OLQA 5F37A 5FR3A 3FWEA 5K4LA 3SCHA 2P1BA 3I3BA 2BYVE 3GALA 3Q8FA 4Q0PA 3HT2A 4Q4V3 2W1WA 3C3VA 3U11A 3BOPA 3PNAA 3NWKA 4FFGA 3LFMA 4FPFA 2PELA 4RFRB 5EFUA 4AFMA 1MACA 3O0XA 1RUJ2 3ORJA 2YHJA 2Z42A 4I3GA 3ZPYA 5B4NA 2W47A 4NPMA 1ZRIA 4XCBA 3ITQA 1MEC3 2W39A 4EV0A 3JD72 3K48A 3J26N 2PFWA 2Q1FA 4O7XA 2YC4A 4KBBA 4F83A 3O1VA 2CGPA 2EICA 2Y33A 1UXXX 5GALA 3CHXA 4B1LA 2QDRA 5FP9A 3M3EA 4FPGA 2ATFA 3H3LA 4CCCA 3AMMA 1RUC3 2ZGLA 2LRPA 3OBTA 4CYDA 3DYMA 4HK9A 4RN5A 4BJ0A 5FQ0A 3LAGA 4BB3A 1VRH3 4XBQA 3BIWE 3T0BA 1TME1 4MGIE 4NPLA 1O3QA 5IVJA 1KFXL 5A7PA 2QQOA 1MS3A 4YW3A 4COWA 5FZBA 4AI0A 4D6RA 2HWC3 4QHZA 1SDDB 2OQ7A 5AC92 3RWKX 5JWPA 1REDA 2H0VA 4V1PA 3VZNA 3GJBA 4D8MA 2VOWA 4ES9A 4N9HA 2YUEA 1ALYA 4CDWC 2CDOA 3RZGA 1W6QB 4Y22B 3ZM8A 2JDYA 1NLRA 3FLPA 5FZHA 3WG4A 1UPSA 3KF3A 4JZRA 5M0TA 1GSLA 5DAVA 2VZ1A 3ZYPA 3O5SA 4MLOA 1PMJX 4QT6A 1UU5A 1KD7A 4XFHA 4Y1VA 1QOOA 1W8HA 3NJXA 2IXHA 2C6SA 2GN7A 3I2HA 2AREA 2QQVA 1APNA 2QQWA 3W59A 3WUDA 3U0ZA 2JE8A 5E16A 4QB2A 4ZU4A 2WFF2 4EQVA 4CDQC 3IDAA 3SITA 3BPZA 2RS32 1LHNA 1C8M1 2YBPA 3OUIA 4GMP3 4OMDA 3S30A 2RS53 1Q8QA 3D6EA 5EP9A 2ZGPA 1YFWA 3V0AB 1US3A 1VRBA 2VTXJ 3DKQA 4IGPA 2VTFA 3U1XA 5EZWA 1KITA 1UX7A 3S5QA 1LAJA 1OKQA 1U5IA 2O8OA 2TNFA 3R4UA 4JDOA 4KWLA 4NIDA 4NE9A 1R092 5GLVA 1JZ3A 4AVCA 2RJKA 1PK6C 2JIJA 4XILA 3KWVA 1JMUB 1A34A 1K5MA 5EQUA 4Y5SA 2DFCA 1AHSA 1LNSA 2DUQA 3BALA 4CDQB 2QKDA 3H1WA 5FKBA 4DEQA 3DF0A 3TN92 2I74A 1RUOA 1KEXA 1CWPA 4L92A 5JIUA 3N9OA 5CEHA 1AXKA 2KXLA 4JRAA 3LFIA 2JG8C 3J8F1 4YW2A 1N1SA 4AK3A 5DXDA 2ILMA 5JPNB 3JQXA 3E5QA 3RZKA 3THTA 4L0PA 4R52A 3RG0A 3OG2A 1RHI3 2LTNA 3J9SA 2HWF3 1PK6B 2Y34A 1YIPA 2VZPA 1NCRC 4ZZ5A 4XJAA 2D6LX 3PVOA 2PAMA 1QJY2 1VR3A 3A0NA 3N35A 1G9CA 1WMFA 3IN9A 4DIQA 1OQDA 2KR2A 1PMIA 1O5LA 2FCVA 4PI2A 5CKNA 5FYHA 3MPPG 3LCPA 4CP2A 5IYYA 4J25A 1X50A 1H8TC 1UNBA 2PAKA 1ZX5A 4LBLA 4QX8A 4ET7A 4BA6A 1KQRA 3EQEA 4PHZA 1FMD3 1PO23 5J48A 4CZSA 1V9U3 4PI0A 5JMCA 3BOWA 2Y6LA 4BM8A 4C91A 1IOAA 1RUD3 5LB6A 1ENQA 2X5IA 2UYAA 4ZU5A 5L9BA 3JB8A 3FLTA 3VD4A 1U5XA 3GCXA 3KT7A 4HG6B 4NRQA 4AOCA 4LOSA 2YZ4A 5FMDA 4CPBD 2WS91 5DG2A 2Y6FA 5D21A 1LCLA 4GAZA 4CRQA 2ZGOA 3GBGA 3UKNA 4D7SA 3IPVA 4A3ZA 2HWB1 1XXNA 4QX1A 1CD3G 2VH9A 1NG0A 1TME2 4LO8A 2R16A 4GWIA 3VBRC 4HKLA 4MXWB 3VBOA 5C9AA 1CAWB 3WD5A 5KBFA 3VBSC 4YGDA 3ETPA 4FXKB 5DPNA 4PF1A 3I97A 5D2AA 5HV4A 5ACA3 1W9TA 4UBHA 4CSWA 3WNKA 3AKTA 4QU1A 4AEDC 3UJQA 2DWRA 3VGIA 2VTXA 4LO5B 4P08A 4NROA 2RR11 1YI9A 4OI0A 1K3IA 1UN1A 1PVXA 2PLV1 2IFRA 5IW0A 1U12A 2VJXA 1SLCA 1UZZA 2G9FA 3QOPA 4UFJA 2VZQA 4IE4A 1GUIA 1ZZ6A 2GP3A 2ZX4A 4E2GA 5F9TA 1OHFA 4P14A 3BVCA 2WR9A 2VAUA 4ZY9A 2JX9A 2KA3A 2Y8KA 1J58A 4N43A 3VBSB 4E27A 2YU1A 1SLIA 3VHRA 2FDHA 2A6ZA 4IV3B 1O59A 5FYTA 1C8M2 4C90A 2RVAA 5FFOC 1GR3A 5FUPA 1CPMA 4S2HA 1IS5A 2C26A 3CMGA 4JTOA 4CUCA 5A3UA 5C5TA 5IK5A 4S2GA 4FTBA 4LA3A 3AK0A 1QJX1 1C8NA 1TNRA 4RS5A 1LHWA 4X8PA 4K21A 3HR9A 1ZRDA 1W2UA 3LB9A 1UMIA 4NWWA 4XDQA 1X9TA 4AZZA 1QWRA 4R8HA 4Y20B 5FPBA 4KG8A 3A7QA 4Q4Y2 2BWAA 4IW3A 5EHDA 3BTYA 5JCTA 2OUJA 2B9VA 4QX3A 3RYKA 4HSLA 4Q29A 4BLJA 1HRV3 5J36A 2Z69A 2HWD3 1W6NB 1GZTA 1ULEA 2VW0A 1TG7A 4UBGA 4A6SA 3FMGA 3JXSA 2VW1A 4RHV1 2SBAA 2UY8A 3AYDA 3I59A 4QKFA 5KHJA 4AHXA 4FOYA 1BEV1 5FBZA 3IMNA 4KNCA 1XNCA 3J8F2 4A41A 4WZFA 3RNSA 1DP0A 1HN1A 1SLTA 2LUWA 4EN8B 1WMDA 5FBJA 1VJ2A 3OPZA 4I0AA 3RGBA 3BTXA 4H7LA 4YVWA 4CP1A 2RS11 4YM3A 4MG2A 3ZYGA 5JI9A 3O0VA 5FZGA 4RGAA 5LATA 1BLZA 3HBKA 2KD7A 5HCHA 1UW8A 1MQTC 1EAH1 1X8EA 2BGOA 2AENA 2PHLA 2R6QA 1CAVA 4X8NA 4J1WA 4NJ4A 4Y24A 5FUNA 4A3XA 4BQ2A 3AKRA 4Q0SA 4R9CA 4GB33 2WSVA 2YPJA 2WC2A 3AP9A 2UY9A 1DHKB 3MBWA 2A75A 3HEIA 1QY4A 3NNMA 4NVPA 3VZJA 2DVFA 2R061 4RR3A 4JCKA 4LO4B 1UIJA 4BQ5A 4A7KA 1UX6A 4QQPA 5LA0A 5E1RA 5BNPA 2QBXA 4MADA 4MHRA 5FY0A 1JODA 2BOIA 3MV01 1JOBA 3I2OA 5I8YA 1PIV1 4QQLA 1AZDA 3C8XA 3LA3A 3H8XA 3D82A 3OGJA 2PMWB 4NIGA 4MVTA 1SLLA 2XLAA 4Y4RA 1AX2A 3PVBB 2WQZC 5FMBA 5F3CA 2WS92 3S6PA 3HQXA 5HPOA 1D7PM 5KXEA 4HVQA 1R1A2 1RUNA 3B5LB 3C7FA 2HWB2 3Q8BA 5ABJA 1ULCA 2JE9A 4HONA 1F35A 1UPIA 1YIFA 1XNKA 3CO2A 3SISA 3I3MA 1US2A 2JG9B 3RSJA 4Z2WA 1YI7A 5KXDA 2NP0A 5K9YA 3WW1A 1XSRA 3SLIA 2X53S 2VL4A 3J7NA 1XNAA 2YBKA 4HKOA 1FPN3 2RE9A 2W08A 3MUY1 1X9PA 2A3XA 1W9SA 4PDWB
chains in the Genus database with same CATH topology
4TSVA 3VV1A 3ILRA 4G4FA 2RR12 4Q8KA 3TOJA 1H4GA 2PLV2 2XPJA 1S0IA 4P9IA 4PQ9A 1QDCA 3HN1A 4HL0A 1J1LA 3IKWA 4IEPA 3RWNA 1MS8A 2C9AA 5I91A 1GLHA 1LEDA 5FO8B 4BHPA 4EN0A 2GC3A 1TMF1 5CADA 2WNEA 3WVJA 1NQJA 2BPA2 1A8DA 3RMXA 2BNNA 3ATGA 1HQWA 1ASJ1 4QD2A 4UW3A 1IQAA 2YXSA 1QJU3 2E6VA 2XHKA 4Q8LA 1QQP3 2R043 1QJX2 1W39A 1C57A 4B29A 3ILFA 4AVVA 3WG1A 2ZHLA 5CAZA 1G7YA 1ZYBA 4XFBA 1UD1A 2A70A 5DG1A 4R9BA 3R0RA 1K5MC 4K1ZA 3WXPA 2QZ2A 1U0AA 1LKNA 4KU7A 1UL9A 1LULA 3R6SA 3GF6A 2DTYA 1PO12 2R071 4GMP0 4P9JA 5DUWA 1RMU1 4BYYA 2MHFA 3T2TA 4ATFA 4RHV2 4KGGA 2YYOA 3CJIA 1BEV2 3WW2A 4YZ3A 4AFCA 5C8CA 4DOUA 4L8QA 2E63A 2RS12 4AXOA 5I0UA 4FOWA 3NKGA 3NW4A 1R1ZA 4FP2A 3EBRA 4Z82A 1VBE1 1NY71 3KQRA 2ES3A 2VXRA 1EAH2 1H8VA 1W0PA 2W0XA 1Q8PA 4YZ2A 3MW4A 1HRI3 2I45A 5T54A 5C33A 3AFGA 1AYM1 2ZACA 4XTPA 3ZFEA 3X29B 4OULA 1UMZA 3L2YA 3VBUA 1VB2A 5EXOA 4QPYA 2R062 4Q4W1 3AXEA 3AKQA 1IS4A 1HLCA 2ZGUA 1CR7A 2XBO1 1BBT1 4AQ2A 2GU9A 5FOBB 2ZBJA 2X5IC 5JOXA 1PIV2 4HBNA 4COUA 1FXZA 2DCYA 4N53A 2O1QA 3RI9A 2GAUA 2V09A 3CF6E 3RZZA 2MEV1 4RSUA 2WL1A 2BEOA 4YARA 4D94A 3VBOC 5C9AC 2ZOEB 2D3SA 4B4QA 2GSYA 3VKNA 4IESA 4AEKA 1C3HA 1AR73 4S2DA 1GZCA 3B01A 2DYCA 4F8AA 5T50A 1ZREA 1D4M3 3HAGA 3VBHB 3LA2A 1H9PA 3IPVB 2AH2A 4IEXA 1W6MA 2B5HA 2A6VA 3WDXA 5A3MA 2ZGRA 4Q1PA 5BXXA 4IQPA 2FZ1A 1OQEA 2ZABA 3R4SA 4U2AA 3ZN4A 3VBOB 1RITA 3ZXFA 2GN3A 3GHNA 4KGQA 4OUMA 1CAXA 3OY8B 4K3UA 1TMF2 4N43C 4FSJA 1WW4A 4YGCA 1JN2P 1ZBE3 1IKPA 1QXPA 1VBC1 1RVF1 3IDBB 3NKTA 1ASJ2 1RIRA 5HCBA 1QF3A 2KM2A 2RM21 2A6WA 2RMU1 1ZZ7A 3M1HA 2Q0AA 4RS5C 2D5FA 3RMYA 3KCCA 5L7OA 3DKWA 4P9WA 3ZXDA 3KMHA 4G3YC 4MUVA 1NCRA 3GNEA 3N7KA 4UXAA 2DU1A 4JGZA 5CIRA 2WT0A 4COYA 2PHUA 2R072 4OUSA 4QPGB 3KSCA 5KBFA 4PLNA 3APBA 2ZCWA 3H9AA 4R9DA 1J59A 1YXWA 4LNVA 1VBB3 4RGGA 4IEYA 1G6NA 3VKMA 2IXJA 4RS5B 2WZPP 3RDIA 4YVWC 3WQ1A 5BNOA 4BMBA 4XBLA 3AYCA 3NSTA 5KC5A 3KS7A 2WSUA 4COVA 2WJSA 1G9BA 4GALA 2DCTA 1VBE2 1OSGA 1NY72 3GBWA 1YO8A 1DF0A 4E4SA 1LOCA 1ZBA3 2NLRA 3FBMA 3KT1A 3BODA 3O12A 4WVVA 3I59B 1RUE3 1AYM2 1H1IA 1N3QA 2D6PA 4PF5A 4RR3C 4Q4W2 2ENRA 1DQ6A 1O7FA 4KU8A 4YVWB 5BNNB 5FOJB 5BNPC 1S2KA 2XBO2 3WG2A 1BBT2 4DZGA 4QXKA 3MFCA 1BJQA 4RL7A 2ZGMA 4YSFA 4K6BA 3LWCA 3LGRA 3NO8A 1CAVB 2K9ZA 4JVAA 4K8FA 3LA7A 5ABJC 5KHGA 2MEV2 4I09A 5FDBA 2K0GA 4AVAA 1KFUL 4EJRA 1DZQA 2WZR1 4K1YA 3D4KA 2P3KA 4FQZA 4GIQA 4FTSA 1RC6A 3GZUC 4QM8A 2OZJA 4ZU7A 4TYSA 2GNDA 3MIBA 1UU6A 4CDXB 1UCXA 1SFNA 3MICA 1YJKA 1Z7S1 4NHKA 1UIKA 4XQWA 2PHFA 4FPJA 2D6OX 4GWMA 4XBNA 1HX6A 1BQPA 5DZGA 5FAXA 5LRSA 1A6CA 4DNYA 4PLMA 3QH6A 3AFKA 4IXLA 1AR63 3WDTA 1CESA 5JOZA 4YG6A 1XE8A 3HWJA 3B7MA 4YFZA 4PIXA 5HCAA 1VBC2 1LOAA 2A6XA 4Y4YA 1RVF2 2RM22 5J09A 4BOWA 3WDVA 2RMU2 5L36A 5CNAA 2R30A 3PJYA 4XF0A 4AG4A 4GMP1 2IZWA 5JSPA 3D0SA 3ZSKA 4I30A 5LEJA 4XPVA 1MVEA 1RUJ3 1NCQB 4AFAA 3TYJA 3ZIWA 4DRRA 3WDWA 3JD73 4MV2A 1BCXA 4UW5A 2ZAHA 2PHTA 2JJ6A 1Y43B 3KLSA 4IV1A 3M8LA 4EROA 3CJIC 5KHKA 1JBCA 3ENRA 3CEWA 3I8TA 4M3CF 1N1YA 5DZFA 5C8CC 4CDUB 1V6IA 1ZNPA 1DGRN 4LBKA 5I0RA 4AW7A 4S2FA 1GV9A 3NAPA 3SNMA 3K51A 1HQNA 3B69A 2HWF1 2Q30A 2H0BA 3WINE 5BV6A 4M3CB 2OVUA 2O0OA 3PHMA 3ZFEC 2DVDA 2IXIA 4XZPA 5J98B 3VBUC 3ZN5A 2Z5WA 1WW6A 1H2LA 3VHOA 2GNMA 3WG3A 1PZ7A 3WQ0A 1DBNA 4XJ9A 2WFF3 3QBQA 4FPHA 1ND3A 1PGW1 1SMVA 1S0DA 4AI3A 3IWZA 1FMD1 4MYEA 2RS33 1PO21 1H2MA 1NZCA 2HYKA 5JZGA 1JUIA 2CL2A 4KH9A 4N53C 3V0BB 4Q26A 2UU8A 1ND2A 1FI2A 1PVC1 3VBUB 1W6PB 3H1YA 2XLFA 2P2KA 2DCKA 5GLWA 1UAIA 4HVRA 1R093 2WZR2 4AGVA 4DS0A 2YGMA 1HDKA 1ONAA 2F6BA 1SCSA 4H7MA 4ISRA 3WDUA 4C1XA 4LR4A 4Y1ZA 4DXZA 2Q1ZB 4I01A 1DLLA 4CDWB 3ZXGA 3KGLA 3VZLA 5K8SA 4LBJA 5GKAC 3TB0A 4Q4X2 3TN93 1AR91 5JOWA 2P17A 1Z7S2 4NOTA 2DVBA 5ACA1 4HFSA 4N53B 3B94A 4XFAA 3I4IA 1POV0 4JAAA 2DTWA 4INDA 4WVMB 1YNAA 2BQPA 4OHZA 4Z07A 1DU3D 2QNKA 3B3QE 2XLGA 4LBQA 4AVBA 1C5IA 4LEJA 1URXA 2PA7A 4JDNA 3PVNA 2ERFA 4XMIA 3CLPA 3ZFFA 4QQ2A 4N9IA 1YLLA 1FYUA 3WT3A 4AI2A 5L7OC 1MS4A 1HV0A 2DUOA 3M2MA 2VECA 5D1IA 4HN0A 1TEIA 4JGZC 1HXS1 4IERA 5K0UA 3SCGA 1D0GA 1KDMA 1ZZCA 2GDFA 3KCXA 2JECA 2Y0IA 3B02A 2D98A 5GLUA 3ZX7A 5JVVA 2NMOA 4WM7A 1VAMA 4AQTA 3M4FA 3MIHA 3TAYA 1WLCA 4ES8A 2JG8B 1HRV1 1DQ5A 4HSJA 4DY5A 5D8AA 3ELNA 2GMEA 2W68A 5L7OB 2I2SA 5BNOC 1MR5A 1LJ7A 2CTVA 3LSEA 1A3KA 1NCRB 1TQ5A 5EWSA 2DVAA 1WD4A 4O9GA 1Q43A 1BKZA 1AUYA 4FQ4A 1CONA 4HZFA 1YFYA 2HWF2 1C1LA 1H8TB 1C28A 1H9WA 1YWKA 1GZ9A 1KJRA 4GH4A 5KHIA 1CGPA 3TNQA 4GB31 1HQLA 5I93A 1LGCA 2BBVA 1I9RA 1ULGA 3LOBA 2DUPA 2JKBA 3B9IA 4FP3A 4AHWA 1C4RA 4PBPA 4AI1A 1PGW2 1RUI3 1FMD2 3POYA 1SLBA 1PO22 1C8M3 3VZOA 4XE9A 1DGWX 3S0MA 3AZZA 5L73A 1MZ6A 2ETEA 3VBRB 4KL1A 3G7DA 3AJYA 1PVC2 4NR1A 1T6GC 3ZXLA 4HANA 4XQ4A 1GYKA 3MLLA 3RYRA 4Q4Y3 5CG9A 4AWDA 3WCSA 4HK8A 1MZEA 1UF2C 4DY3A 1O91A 4YYOA 1LGBA 2NQYA 2RHPA 1GANA 3MLKA 4AEDB 1ZRCA 5BY5A 1H30A 4IEVA 1LU1A 4ISQA 1AR92 1FAYA 1RUH1 3H1MA 3W9AA 1FPN1 3WR0A 5ACA2 2BUKA 1EV11 3J8F3 5EYYA 1V00A 3O0WA 2YROA 3AMNA 4CP0A 1QU0A 4X6QB 4LHKA 2OA2A 4R4XA 1M4WA 3H8UA 2A73B 1JUHA 4MGYE 1SCRA 2EXJA 1DGRA 4MH0E 1O4ZA 1FV3A 4FOVA 2ZGSA 3UJOA 1LESA 4PIYA 4OLLA 4HPKA 1QMJA 1AR81 1AL0G 3FUQA 2ZGKA 1BXHA 1MS9A 4XETA 2Q1MA 5GZEA 1DZTA 2IC1A 1QJU1 2GALA 3ME2A 1BVP1 2ZGQA 1QQP1 4MGKE 2R041 3H3UA 1HXS2 2BNOA 3Q9OA 2EVXA 2K2SA 5KC6A 2ZMKA 5GZFA 2H6BA 2ZX3A 4FXGB 3E6BA 4W6YA 3ZSJA 3VLBB 1JTZX 2GH8A 2XJVA 3JB4C 4FCAA 1F5JA 4GKYA 5BNQA 4Y26A 1NA1A 1COV1 4IV1C 3PLQA 4XIKA 3WQ7A 3FC0A 4F7ZA 2WS93 4EN7B 2AZ5A 2WA3A 1LHUA 1OLRA 1R1A3 2PN5A 1WCSA 3P3PA 1QH6A 3KGZA 4AFBA 5CFDA 1WUVA 2GNTA 4I02A 3B9CA 3ZFGA 1I3HA 3FFZA 1OA4A 1GKBA 2ET7A 5H9SA 1RB8G 1MQTB 5JLVA 4Y5Z0 1U5YA 3NAPC 1OQ1A 3CL1A 2B7YA 3VDDA 1LGNA 4OI4A 4J6GA 1MS0A 1MS5A 4QMAA 2QVSB 3ZMOA 1QXJA 2RR13 1SACA 1ZRFA 2NZ9A 2PLV3 5FCCA 4H14A 4AHYA 1PNFA 2ZKNA 4R9AA 3WP5A 1A8MA 3MPBA 3USSA 1MZFA 1FOD3 2CGNA 1LECA 1KXGA 1YRZA 4XTMA 3N36A 2A3WA 1H4HA 4UW4A 3AMQA 5F6LB 1DYPA 2IWGB 5CBLA 1ND3C 3P3NA 1DQ2A 4WV8A 5HBAA 2PHRA 5JZGC 4MGZE 2A3YA 3MF9A 5HI0A 4YM2A 5FQ0B 3THPA 4YZ4A 4XFFA 2CV6A 1QJX3 1ND2C 2WNVA 3WNXA 1IPKA 1AYN3 2C0ZA 4O9EA 1F31A 1CVNA 4F3JA 1NXMA 4GXLA 1B09A 1VBD1 2ZX1A 3SH5A 1POV1 3JBG1 3HBZA 1PO13 4TWTA 3WP4A 4Z8BA 1RUH2 4RHV3 1FPN2 1RJ8A 3E6DA 4XFIA 1EV12 4HMZA 3KZ4C 4CTEA 5C6CA 2XGXA 1ND2B 3NL1A 1CN1A 4QGLA 2XJRA 1X7NA 3SMHA 4AGGA 2AGSA 2VOKA 1S0FA 2JDZA 4AE2A 2RS13 4AGRA 1S1AA 2A7AA 1ZA4A 2QQPA 4IEUA 4Q0UA 4NPRA 2BFUS 4C1WA 4AEJA 1JYCA 3O14A 4WVWA 1EAH3 3ZFFC 4OFGA 5GZGA 1LHOA 3RI8A 1RUF1 3PMSA 1QOSA 2WT1A 2VU9A 1G9AA 2XG3A 1AR82 4ASMB 3O7OA 2SLIA 3EO6A 4OI2A 3MW2A 1OPMA 5JPMB 1K5MB 1QJU2 3M7AA 4RA0A 2VNOA 1SLAA 1Q56A 1QQP2 5K0UC 2R042 4LBQB 4NO4A 3OBRA 3H50A 5GJ6A 5CA6A 3OGGA 4MZUA 2EIGA 4ZXKA 1PIV3 3ST7A 3T1LA 2JENA 4WM7C 1DGLA 1WLWA 1COV2 4Y1UA 1ENRA 2P3JA 3ZYIB 3H3ZA 3ZYRA 1CPNA 5D8AC 5SV8A 1TE1B 1S0GA 4IEZA 1DG6A 5C4WA 1W6OA 1X82A 2AR6A 4YRDA 1W6QA 1H1MA 2WKKA 3UK9A 5IK8A 4Q2FA 1LTEA 5K0UB 1VBA3 5DDJ1 4I0WB 3ASIA 3VHNA 3HIFA 4IEQA 4WM8A 5FLJA 4QU2A 2ZHKA 1XRUA 2UURA 3VKFC 3AP7A 4HLTA 5KWRA 4K7JA 4Y1YA 5D8AB 1WA4A 3AMHA 3WUCA 4GH4C 2HEYF 2ZPXA 2VOVA 1BZWA 3MDPA 3OYWA 3DUIA 2D6MA 2X5IB 2R1BA 4U36A 1DDLA 5SV5A 1EP0A 1MS1A 4LHNA 2BFUL 1UKGA 1OFSA 1LRHA 1D2SA 4GKXA 4HVOA 2ZGNA 2CY6A 1ASJ3 1H2KA 3UKTA 1RUG1 2JXAA 3L9JT 5T5OA 2TBVA 4RFT0 3WZ1A 1HIXA 5C9AB 1R081 2ZZQA 4GH4B 1EYBA 1UU4A 4CEYC 2XWJB 5DUXA 5T55A 1IGOA 1SEFA 1VBD2 2VNGA 2G4IA 2CWSA 1I5ZA 4Q0QA 3JBG2 2FMDA 2R073 1ULFA 1Q8OA 4XF9A 4XJUA 2CGOA 3LKJA 5T52A 3V56A 4BZ4A 2EA7A 4MSVA 1Y3TA 2O8QA 3BTAA 4AQ6A 3DL3A 2R0FA 1G86A 1SBDA 2XH6A 2XJQA 4N43B 5HCFA 4QQHA 3N7LA 1RMU2 3WCRA 4CEWA 1YHFA 2WWSA 3JCIA 1NYWA 5BUVA 1VAVA 2CWMA 3MFAA 1RUF2 1WLDA 4FPEA 2YY1A 4IEOA 4HETA 2ZTNA 4OHVA 2VOXA 1AYM3 3MGUA 1AL21 2AUYA 4W6XA 2Q8OA 4SLIA 2BTVC 1FNZA 2Y0OA 4LUKA 2WFPA 1I6XA 3MI8A 2XBO3 2EALA 1BBT3 3ZSMA 2GNBA 4WBBA 3D5OA 4FOQA 3WOGA 4XXPA 1ZZBA 1NA1C 3WW4A 3ZYJB 4MXWA 1CAWA 3IDEA 3SH3A 3EHKA 4FVVA 4HPKB 1PZ8A 2DURA 3VZKA 4Q4V1 2MEV3 2WIIB 4JV4A 5CFDC 2DVGA 3RYPA 4Z92B 3ZFGC 4JDMA 3WV6A 4GWNA 1B35A 1Q3EA 4NWVA 5DDJ2 4EN9B 4KWJA 1MEC1 3HT1A 3VDDC 3KT4A 1GZWA 1JXNA 1NA1B 5JIAA 5BPXA 1PGSA 2YDEA 1YUDA 4RR3B 4NN0A 4IV3A 5E8AA 4YW4A 1RUC1 1NE4A 4E4ZA 4XHXA 4GULA 4QGNA 1AVBA 1VRH1 1ENSA 2Q5TA 3MIEA 5BNPB 2FHRA 1Z78A 1Q5OA 2N7GA 2HWE3 2VGDA 3ZXAC 3N4MA 4XJ8A 3ZFGB 2HWC1 4AHZA 1VB4A 1VBC3 1FNYA 1LHVA 1V70A 3A0KA 4OI1A 5ABJB 2Z79A 1RUG2 1MVQA 2RM23 1OA3A 2WFF1 3CU7A 2QDNA 2RMU3 1W6NA 5L19A 1X36A 5KXBA 2WNVC 2OUHA 3U07A 1G9FA 4XMAA 4XJZA 1R082 3DPRA 3AZVA 3ZMNA 2ZHMA 4E2SA 1GQGA 1LU2A 4LLOA 2ZAAA 5EJ3A 3AYEA 2MNGA 1UKRA 1R091 4C0HA 3ES1A 2RS51 2E7AA 3CJXA 4FT8A 1LOFA 1S0CA 1Y9QA 3MYXA 3TWIA 2JEMA 4ZKTB 1N47A 3G6JB 4H3WA 1AJOA 5E88A 5B2GB 4L11A 4LO6B 5BYNA 4PBOA 3VL9A 4IETA 3W58A 1V6NA 2CAUA 2E51A 1G8WA 4D69A 2NPIA 3D8CA 2VMGA 1VLNA 3ES4A 1O5UA 3MF6A 2VG9A 2CAVA 2HEVF 3PJQA 4AVTA 4P9GA 4DPNA 4B7KA 3SXWA 1AL22 4AEMA 1RL3A 3AP5A 1A78A 2WNUA 1F9KA 5JI7A 3RJ2X 1OD5A 5AC93 1OA2A 2RJLA 1D0HA 1ENXA 4FPOB 1WD3A 1OOPA 3BB6A 2BNMA 1REEA 1RHI1 1VAKA 2JG9A 3KM5A 3AZXA 3C2UA 3H7JA 5H9PA 4E2QA 4L2NA 1O4TA 3CJIB 1DGWA 2NM1A 2VW2A 3AJZA 1Q8VA 1Z0HA 2WLQA 2Z2SB 2WA4A 4M3CE 5DZEA 3WHUA 4FBFA 5C8CB 4L97A 2PHXA 4Q1RA 3MEPA 4BCUA 4PDWA 3SCFA 5C4WC 4Q4V2 3NV2A 4YW5A 1EPZA 1VP6A 2EXHA 2JD4A 2QUOA 3ZN6A 4E9KA 3MIGA 4EN6B 4W65A 2BVBA 2WZR3 2QCSB 3GHMA 1QNWA 2R49A 1V9U1 4Q0VA 4WM8C 1MEC2 1RUD1 1E57A 4YGEA 4PCRA 5T5JA 1QKQA 2YGLA 2ZZJA 5FO7B 2PHDA 3KB5A 1SFYA 2VUJA 2B45X 2EXIA 4Q4X3 3ZFEB 5CG8A 1Z7S3 1UZYA 1RUC2 2GC1A 5A32A 2NMNA 5C4WB 1DYKA 1W6OB 1VRH2 3USUA 4COZA 4JGYA 4L99A 5IT6A 4H55A 2QFEA 3UL2A 4D3WA 1S2BA 4QGMA 2GC0A 4RD7A 2IXLA 2P34A 2HWC2 1V6KA 4BPZA 2A71A 3HD8B 4XJWA 4YG0A 4WM8B 5JDBA 2HEWF 2ZX2A 5FREA 1KDKA 4N7IA 2XJPA 1NE6A 2XB6C 4AI8A 1RUI1 4J1XA 3PMEA 4XIOA 2ET1A 4E4DX 2NN8A 2P3IA 1TNFA 3OYWB 1L3JA 1XYPA 5AFBA 1JHNA 1QJY3 3MIDA 1RJ7A 4QX5A 4DB5A 2W52A 1O4YA 4WZCA 4DRVA 4Q4Y1 1XU2A 1W6MB 1U5ZA 2RS52 2OPKA 3I54A 4UW6A 1XQNA 3R05A 4M00A 2VQAA 1F5FA 4XF1A 3AYAA 2QE3A 1EPWA 1O3TA 1CAXB 2LALA 3I7DA 1PZ9A 2GZWA 2X8KA 2Q4SA 5JSOA 1IKQA 1SQ4A 4CEWC 1OI6A 1XU1A 4FPYA 2IXCA 4BE3A 4RQPA 1CJDA 2HWD1 3BU7A 4AF9A 3ZIXA 3HMYA 1TME3 1AXZA 1AX1A 2TEPA 4K20A 2OYZA 3WY6A