2MPHA

Solution structure of human fk506 binding protein 25
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
224
structure length
224
Chain Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
publication title Solution Structure of human FK506 binding Protein 25
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 30
structure length 224
sequence length 224
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18410 BTHB Basic tilted helix bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.80 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 2mphA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mphA02
4QIBA 2M2AA 4W9OA 2XP4A 3O5EA 3VAWA 3B7XA 4DH0A 3IKDA 3NRKA 3UQBA 2ZQVA 3IK8A 3KZ7A 4IPXA 4DRPA 4JFJA 3GPKA 1FAPA 4U86A 1FKKA 4NNRA 2FKEA 3PRDA 5HW8A 1NMVA 2LC3A 1QPLA 3JYJA 4G50A 3TC5A 1ROUA 2XP3A 2RSEA 4JFKA 4ODNA 4ODOA 5DITA 3H9RB 1A7XA 3UQIA 2DG9A 2XPBA 5HTGA 4GIVA 2PV2A 3O5JA 1Y0OA 3UI4A 1FKTA 4IQ2A 4N19A 2F4EA 1FKDA 1NSGA 1JNSA 1QPFA 3PRBA 2XP6A 3UI6A 4TX0A 1J6YA 1D7JA 1U79A 5HKGA 1F40A 3MDYB 5DIVA 1FKBA 2ZR4A 5D75A 4TW6A 1FKRA 1FKGA 1J4RA 1FKIA 5HW7A 1ROTA 2MLYA 2RUDA 4TW8A 4U84A 3JXVA 4DRMA 4DZ3A 3UQAA 2Q5AA 2XP9A 5GPGA 3O5DA 4QT2A 1Q1CA 1FKLA 3OOBA 2LPVA 2PV3A 3O5OA 3O5IA 4W9QA 3CGNA 1FJDA 4G2PA 1JVWA 5HWBA 4ITZA 3ODKA 2AWGA 4O2TA 1J4IA 2RUQA 4DRNA 2JZVA 2KI3A 3JYMA 5B8IC 5I98A 3IKGA 1KT1A 1FD9A 1ZK6A 1W26A 1QZ2A 2XP5A 1N1AA 1D7IA 2ZQSA 3FAPA 1D6OA 1NMWA 2M08A 2M1IA 3O5QA 3O5FA 4TNSA 4C02B 4DRJA 1HXVA 5HWCA 4FN2A 2PPPA 4J4NA 4LAXA 2ITKA 1KT0A 3KCEA 3LUOA 4DT4A 2KE0A 2MLXA 1BKFA 2FAPA 4ODKA 2XPAA 5DIUA 3TCZA 1YW5A 3WH0A 1ZCNA 4DRIA 4R0XA 4QT3A 3O5GA 1B6CA 1C9HA 1TCOC 2ZQUA 3RGCA 1P5QA 2XP7A 1M5YA 2ZR5A 3IHZA 4GGQA 2PBCA 5HUAA 4ODLA 1T11A 2KR7A 2K8IA 2VN1A 2ZQTA 4LAVA 4ODPA 4DIPA 5HW6A 4U85A 3RFWA 1D7HA 2KFWA 1PBKA 1J4HA 2IF4A 4MSPA 3O5LA 1Q6UA 4ODQA 4FAPA 2UZ5A 1Q6HA 1YATA 2DG3A 2LGOA 4IQCA 3UF8A 4ODRA 1JNTA 2KGJA 3EY6A 1PINA 2PPOA 2KFVA 4TW7A 4JYSA 4DRQA 3CGMA 2N87A 2PPNA 3UI5A 4DZ2A 3KAHA 3KADA 2KO7A 4DRHA 3NI6A 4DRKA 4TYOA 4W9PA 5HT1A 2Y78A 2LKNA 3KAIA 4JFMA 3O5RA 1Q6IA 2LJ4A 2RUCA 3O5PA 1L1PA 3TDBA 2PV1A 1EYMA 2MLZA 2VCDA 2F2DA 3PA7A 4ODMA 2ZR6A 1F8AB 2D9FA 3O5KA 1BL4A 1FKFA 1R9HA 3I6CA 3NTPA 2RQSA 1FKJA 3KACA 2F21A 3KABA 1FKHA 4JFIA 2MF9A 4MGVA 5BXJA 2DG4A 2L2SA 4BF8A 3KAFA 4DROA 5J6EA 4LAWA 4JFLA 4LAYA 1FKSA 2XP8A 3KAGA 4J4OA 2RURA 2MPHA 2MNTA 1EQ3A 2OFNA 3O5MA
chains in the Genus database with same CATH superfamily
3VAWA 4DWSC 3O5EA 3B7XA 4DRPA 1FAPA 1H0IA 4NNRA 2FKEA 5HW8A 1NMVA 3TC5A 1ROUA 4JFKA 4ODOA 1ZBHA 4Z2IA 1E6PA 1A7XA 3PRAA 4GIVA 1XRVA 3O5JA 1H1JS 3UI4A 2F4EA 1FKDA 5GPRA 1LL7A 2XP6A 3FLGA 4MNJA 3CH9A 1D7JA 1ZBCA 1J6YA 4UZWA 1FKBA 1LL6A 5D75A 4TW6A 4Z2JA 1W1PA 1FKIA 3ARPA 1E6RA 2RUDA 2XP9A 2QNCA 3O5DA 4QT2A 1Q1CA 3OOBA 1X6LA 1TFVA 3LLRA 4MTVA 1FJDA 5DO2A 1W1VA 5HWBA 1GKUB 4WIWA 2DT2A 2RUQA 4DRNA 2JZVA 2KI3A 2YBTA 3ARXA 1QZ2A 1D7IA 3FAPA 3O5QA 1D6OA 2M1IA 1E7LA 2PPPA 1WNOA 3AS1A 4LAXA 2B31A 2ITKA 3KCEA 1WAWA 4DT4A 4MNKA 2KE0A 2FAPA 3TCZA 4R0XA 2QNFA 1LG1A 1P5QA 4GGQA 5JH8A 1JCHB 4WKFA 4ODLA 1JNEA 1EDQA 1ZBKA 4DIPA 4U85A 3RFWA 5CIUA 3WQWA 3W4RA 1NWTA 2DG3A 3G6LA 1ZU8A 1E6NA 4P8XA 2G41A 1A62A 3AS2A 3WD1A 4DRHA 1HKJA 2Y78A 3KAIA 4WKAA 1OGBA 5HBFA 1EYMA 2MLZA 2DSUA 3L0OA 3O5KA 1BL4A 3WL0A 3EIPA 1R9HA 3NTPA 1FKJA 3WD2A 3KABA 2DG4A 2RNOA 4WJXA 2XP8A 3B9EA 3KAGA 3B8SA 2MPHA 2MNTA 1EQ3A 1GJJA 2OFNA 3O5MA 2M2AA 3BXWA 4NZCA 2ZQVA 3ARSA 1NWUA 3ARTA 4JFJA 1GL9B 1EHNA 4U86A 4G50A 2XP3A 2RSEA 4ODNA 4Q22A 4Z2KA 1KFWA 3UQIA 1X6NA 2DG9A 1IX5A 2XPBA 2PV2A 1Y0OA 3WD0A 4KQZA 3WD3A 3ARZA 4Q7NA 2DT0A 5HKGA 5DIVA 4DWSA 4Z2LA 2A3CA 1JEIA 4IT4A 1OGGA 2F23A 1HKMA 2MLYA 3JXVA 1GUVA 1CTNA 4LGXA 1ZL1A 3CZ8A 3GTYX 4W5UA 1ITXA 4ITZA 3ODKA 2WLZA 2RNNA 4O2TA 3FXYA 4QZVB 3JYMA 3IKGA 3O5FA 3AROA 1NMWA 1HXVA 2YBUA 1KT0A 1WB0A 2MLXA 2XPAA 5DIUA 3WH0A 1KHCA 1GOIA 3O5GA 4QT3A 3RGCA 1H9FA 4Z2GA 1M5YA 2PBCA 2ESCA 3QOKA 1D7HA 2KFWA 1PBKA 1J4HA 2LD7A 3O5LA 2LGOA 4IQCA 1FFQA 1JNDA 3UF8A 3ARVA 4ODRA 1JNTA 2KFVA 4DZ2A 2DT1A 3KAHA 4W9PA 4MPKA 3O5RA 1Q6IA 2LJ4A 1W1TA 2VCDA 2F2DA 3AQUA 2WLYA 3AS3A 1F8AB 2AOSA 1ZB5A 1FKFA 2DK4A 3ARRA 4DWSB 2F21A 3OA5A 4JFIA 5BXJA 3KAFA 2DPEA 4P8VA 4LAWA 3ARYA 2PN0A 4HBEA 1ZBWA 4W9OA 3WKZA 3IKDA 3NRKA 3UQBA 4WK9A 2KVEA 2WQGA 3IK8A 1SYTA 4XAKA 4HARA 1EIBA 4KR0B 1E9LA 3GPKA 3PRDA 2LC3A 1QPLA 1RD6A 3RM9A 1H9EA 2KVUA 4N19A 2W51A 1E7DA 3ARQA 3CHEA 1NSGA 1JNSA 3UI6A 4TX0A 3AS0A 4MAVA 1HKIA 1FKRA 1FKGA 2A3AA 3FY1A 1NWSA 3ARWA 4DZ3A 4DRMA 3UQAA 2ODGC 1FKLA 1ZS9A 3O5OA 4G2PA 1HKKA 3ALGA 2IUZA 1LL4A 1HJVA 3CHCA 5I98A 4HBOA 3WQVA 2ZQSA 4DRJA 2A3EA 4J4NA 3RM8A 4NSBA 1NH6A 1LQ0A 3QKJA 3LUOA 1ZBVA 2OLHA 2B5UB 2DT3A 3WL1A 1W1YA 2PI6A 1B6CA 1C9HA 1TCOC 2ZR5A 4URIA 2A3BA 1JEQA 1T11A 2K8IA 2KR7A 2VN1A 2WK2A 4LAVA 4ODPA 2DSWA 5HW6A 1YNSA 2A8VA 4ML4A 2IF4A 4MSPA 1Y02A 1Q6UA 4FAPA 2UZ5A 1Q6HA 1YATA 3RMEA 1PINA 2PPOA 4Z2HA 4DRQA 2G80A 2N87A 2G8ZA 1E44A 3KADA 2KO7A 3NI6A 4DRKA 4TYOA 4L72B 1A63A 1EN7A 4JFMA 2RUCA 3O5PA 3GU0A 4MNMA 3TDBA 1L1PA 4ODMA 2ZR6A 2D9FA 2O9OA 3CHDA 4BITA 2HJQA 3I6CA 4ODQA 4PTMA 3KACA 5HWCA 4ZPVR 4MGVA 4P8UA 5J6EA 4BF8A 4DROA 5GQBA 1OWQA 4JFLA 1H0GA 4LAYA 2RURA 3CHFA 1JJRA 4QIBA 3B9DA 2XP4A 4DH0A 3ARUA 3B9AA 3KZ7A 4IPXA 4ZS6A 2WM0A 1V66A 1E6ZA 1FKKA 3JYJA 5DITA 2P4VA 4S3JA 3BMBA 3G6MA 3H9RB 1NWRA 2DSVA 5HTGA 3WD4A 1FKTA 4IQ2A 1QPFA 3PRBA 1U79A 1F40A 3MDYB 1GRJA 2ZR4A 1J4RA 5HW7A 1UR8A 1ROTA 4TW8A 4U84A 2Q5AA 5GPGA 2KW9A 2LPVA 2PV3A 3O5IA 4W9QA 3CGNA 2KVDA 1JVWA 2DSZA 2AWGA 3WIJA 1O6IA 1J4IA 1D2KA 5B8IC 1HJXA 1KT1A 1FD9A 1W26A 1ZK6A 2O92A 2XP5A 1N1AA 4L3NA 4ZPTR 2M08A 4C02B 4TNSA 1LG2A 1K9TA 4FN2A 2JVWA 1W9VA 2EULA 1BKFA 1GPFA 4ODKA 2FDMA 1YW5A 1ZCNA 4DRIA 4P8WA 1UR9A 2ZQUA 1HJWA 2XP7A 3IHZA 4DWSD 5DF0A 1W9UA 5HUAA 2ZQTA 3PR9A 4IT6A 2QF8A 4UDMA 4S3KA 1E15A 2KGJA 3EY6A 1W9PA 4TW7A 4JYSA 3CGMA 2PPNA 3RM4A 1LJYA 3UI5A 4WKHA 1FFRA 4AY1A 2ODCI 1XHGA 5HT1A 2LKNA 2PV1A 3PA7A 1A8VA 4ZPWR 2RQSA 1FKHA 2MF9A 1SR0A 2L2SA 4MNLA 3ALFA 5DEZA 1FKSA 4J4OA 2ETNA 4R5EA 1VF8A
chains in the Genus database with same CATH topology
3VAWA 4DWSC 3O5EA 3B7XA 4DRPA 1FAPA 1H0IA 4NNRA 2FKEA 5HW8A 1NMVA 3TC5A 1ROUA 4JFKA 4ODOA 4Z2IA 1E6PA 1A7XA 3PRAA 4GIVA 1XRVA 3O5JA 3UI4A 2F4EA 1FKDA 5GPRA 1LL7A 2XP6A 4MNJA 3CH9A 1D7JA 1ZBCA 1J6YA 1FKBA 1LL6A 5D75A 4TW6A 4Z2JA 1W1PA 1FKIA 3ARPA 1E6RA 2RUDA 2XP9A 2QNCA 3O5DA 4QT2A 1Q1CA 3OOBA 1X6LA 1TFVA 4MTVA 1FJDA 5DO2A 1W1VA 5HWBA 1GKUB 4WIWA 2DT2A 2RUQA 4DRNA 2JZVA 2KI3A 2YBTA 3ARXA 1QZ2A 3FAPA 1D7IA 3O5QA 1D6OA 2M1IA 1E7LA 2PPPA 1WNOA 3AS1A 4LAXA 2B31A 2ITKA 3KCEA 1WAWA 4DT4A 4MNKA 2KE0A 2FAPA 3TCZA 4R0XA 2QNFA 1LG1A 1P5QA 4GGQA 5JH8A 4WKFA 4ODLA 1JNEA 1EDQA 1ZBKA 4DIPA 4U85A 3RFWA 3WQWA 3W4RA 1NWTA 2DG3A 3G6LA 1ZU8A 1E6NA 4P8XA 2G41A 1A62A 3AS2A 3WD1A 4DRHA 1HKJA 2Y78A 3KAIA 4WKAA 1OGBA 5HBFA 1EYMA 2MLZA 2DSUA 3L0OA 3O5KA 1BL4A 3WL0A 1R9HA 3NTPA 1FKJA 3WD2A 3KABA 2DG4A 4WJXA 2XP8A 3B9EA 3KAGA 3B8SA 2MPHA 2MNTA 1EQ3A 1GJJA 2OFNA 3O5MA 2M2AA 3BXWA 4NZCA 2ZQVA 3ARSA 1NWUA 3ARTA 4JFJA 1GL9B 1EHNA 4U86A 4G50A 2XP3A 2RSEA 4ODNA 4Q22A 4Z2KA 1KFWA 3UQIA 1X6NA 2DG9A 1IX5A 2XPBA 2PV2A 1Y0OA 3WD0A 4KQZA 3WD3A 3ARZA 4Q7NA 2DT0A 5HKGA 5DIVA 4DWSA 4Z2LA 2A3CA 1JEIA 4IT4A 1OGGA 2MLYA 1HKMA 3JXVA 1GUVA 1CTNA 4LGXA 1ZL1A 3CZ8A 4W5UA 1ITXA 4ITZA 3ODKA 2WLZA 4O2TA 3FXYA 4QZVB 3JYMA 3IKGA 3O5FA 3AROA 1NMWA 1HXVA 2YBUA 1KT0A 1WB0A 2MLXA 2XPAA 5DIUA 3WH0A 1GOIA 3O5GA 4QT3A 3RGCA 1H9FA 4Z2GA 1M5YA 2PBCA 2ESCA 3QOKA 1D7HA 2KFWA 1PBKA 1J4HA 2LD7A 3O5LA 2LGOA 4IQCA 1FFQA 1JNDA 3UF8A 3ARVA 4ODRA 1JNTA 2KFVA 4DZ2A 2DT1A 3KAHA 4W9PA 4MPKA 3O5RA 1Q6IA 2LJ4A 1W1TA 2VCDA 2F2DA 3AQUA 2WLYA 3AS3A 1F8AB 2AOSA 1ZB5A 1FKFA 2DK4A 3ARRA 4DWSB 2F21A 3OA5A 4JFIA 5BXJA 3KAFA 2DPEA 4P8VA 4LAWA 3ARYA 4HBEA 1ZBWA 4W9OA 3WKZA 3IKDA 3NRKA 3UQBA 4WK9A 3IK8A 1SYTA 4XAKA 4HARA 1EIBA 4KR0B 1E9LA 3GPKA 3PRDA 2LC3A 1QPLA 1RD6A 3RM9A 1H9EA 4N19A 2W51A 1E7DA 3ARQA 3CHEA 1NSGA 1JNSA 3UI6A 4TX0A 3AS0A 4MAVA 1HKIA 1FKRA 1FKGA 2A3AA 3FY1A 1NWSA 3ARWA 4DZ3A 4DRMA 3UQAA 2ODGC 1FKLA 1ZS9A 3O5OA 4G2PA 1HKKA 3ALGA 2IUZA 1LL4A 1HJVA 3CHCA 5I98A 4HBOA 3WQVA 2ZQSA 4DRJA 2A3EA 4J4NA 3RM8A 4NSBA 1NH6A 1LQ0A 3LUOA 1ZBVA 2OLHA 2DT3A 3WL1A 1W1YA 2PI6A 1B6CA 1C9HA 1TCOC 2ZR5A 4URIA 2A3BA 1T11A 2KR7A 2K8IA 2VN1A 2WK2A 4LAVA 4ODPA 2DSWA 5HW6A 1YNSA 2A8VA 4ML4A 2IF4A 4MSPA 1Y02A 1Q6UA 4FAPA 2UZ5A 1Q6HA 1YATA 3RMEA 1PINA 2PPOA 4Z2HA 4DRQA 2G80A 2N87A 2G8ZA 3KADA 2KO7A 3NI6A 4DRKA 4TYOA 4L72B 1A63A 1EN7A 4JFMA 2RUCA 3O5PA 1L1PA 4MNMA 3TDBA 4ODMA 2ZR6A 2D9FA 2O9OA 3CHDA 2HJQA 3I6CA 4ODQA 4PTMA 3KACA 5HWCA 4ZPVR 4MGVA 4P8UA 5J6EA 4BF8A 4DROA 5GQBA 1OWQA 4JFLA 1H0GA 4LAYA 2RURA 3CHFA 4QIBA 3B9DA 2XP4A 4DH0A 3ARUA 3B9AA 3KZ7A 4IPXA 4ZS6A 2WM0A 1E6ZA 1FKKA 3JYJA 5DITA 4S3JA 3G6MA 3H9RB 1NWRA 2DSVA 5HTGA 3WD4A 1FKTA 4IQ2A 1QPFA 3PRBA 1U79A 1F40A 3MDYB 2ZR4A 1J4RA 5HW7A 1UR8A 1ROTA 4TW8A 4U84A 2Q5AA 5GPGA 2LPVA 2PV3A 3O5IA 4W9QA 3CGNA 1JVWA 2DSZA 2AWGA 3WIJA 1O6IA 1J4IA 1D2KA 5B8IC 1HJXA 1KT1A 1FD9A 1W26A 1ZK6A 2O92A 2XP5A 1N1AA 4L3NA 4ZPTR 2M08A 4C02B 4TNSA 1LG2A 1K9TA 4FN2A 1W9VA 1BKFA 1GPFA 4ODKA 2FDMA 1YW5A 1ZCNA 4DRIA 4P8WA 1UR9A 2ZQUA 1HJWA 2XP7A 3IHZA 4DWSD 5DF0A 1W9UA 5HUAA 2ZQTA 3PR9A 4IT6A 2QF8A 4S3KA 1E15A 2KGJA 3EY6A 1W9PA 4TW7A 4JYSA 3CGMA 2PPNA 3RM4A 1LJYA 3UI5A 4WKHA 1FFRA 4AY1A 2ODCI 1XHGA 5HT1A 2LKNA 2PV1A 3PA7A 1A8VA 4ZPWR 2RQSA 1FKHA 2MF9A 1SR0A 2L2SA 4MNLA 3ALFA 5DEZA 1FKSA 4J4OA 4R5EA 1VF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIB A;  2M2A A;  4W9O A;  2XP4 A;  3O5E A;  3VAW A;  3B7X A;  4DH0 A;  3IKD A;  3NRK A;  3UQB A;  2ZQV A;  3IK8 A;  3KZ7 A;  4IPX A;  4DRP A;  4JFJ A;  3GPK A;  1FAP A;  4U86 A;  1FKK A;  4NNR A;  2FKE A;  3PRD A;  5HW8 A;  1NMV A;  2LC3 A;  1QPL A;  3JYJ A;  4G50 A;  3TC5 A;  1ROU A;  2XP3 A;  2RSE A;  4JFK A;  4ODN A;  4ODO A;  5DIT A;  3H9R B;  1A7X A;  3UQI A;  2DG9 A;  2XPB A;  5HTG A;  4GIV A;  2PV2 A;  3O5J A;  1Y0O A;  3UI4 A;  1FKT A;  4IQ2 A;  4N19 A;  2F4E A;  1FKD A;  1NSG A;  1JNS A;  1QPF A;  3PRB A;  2XP6 A;  3UI6 A;  4TX0 A;  1J6Y A;  1D7J A;  1U79 A;  5HKG A;  1F40 A;  3MDY B;  5DIV A;  1FKB A;  2ZR4 A;  5D75 A;  4TW6 A;  1FKR A;  1FKG A;  1J4R A;  1FKI A;  5HW7 A;  1ROT A;  2MLY A;  2RUD A;  4TW8 A;  4U84 A;  3JXV A;  4DRM A;  4DZ3 A;  3UQA A;  2Q5A A;  2XP9 A;  5GPG A;  3O5D A;  4QT2 A;  1Q1C A;  1FKL A;  3OOB A;  2LPV A;  2PV3 A;  3O5O A;  3O5I A;  4W9Q A;  3CGN A;  1FJD A;  4G2P A;  1JVW A;  5HWB A;  4ITZ A;  3ODK A;  2AWG A;  4O2T A;  1J4I A;  2RUQ A;  4DRN A;  2JZV A;  2KI3 A;  3JYM A;  5B8I C;  5I98 A;  3IKG A;  1KT1 A;  1FD9 A;  1ZK6 A;  1W26 A;  1QZ2 A;  2XP5 A;  1N1A A;  1D7I A;  2ZQS A;  3FAP A;  1D6O A;  1NMW A;  2M08 A;  2M1I A;  3O5Q A;  3O5F A;  4TNS A;  4C02 B;  4DRJ A;  1HXV A;  5HWC A;  4FN2 A;  2PPP A;  4J4N A;  4LAX A;  2ITK A;  1KT0 A;  3KCE A;  3LUO A;  4DT4 A;  2KE0 A;  2MLX A;  1BKF A;  2FAP A;  4ODK A;  2XPA A;  5DIU A;  3TCZ A;  1YW5 A;  3WH0 A;  1ZCN A;  4DRI A;  4R0X A;  4QT3 A;  3O5G A;  1B6C A;  1C9H A;  1TCO C;  2ZQU A;  3RGC A;  1P5Q A;  2XP7 A;  1M5Y A;  2ZR5 A;  3IHZ A;  4GGQ A;  2PBC A;  5HUA A;  4ODL A;  1T11 A;  2KR7 A;  2K8I A;  2VN1 A;  2ZQT A;  4LAV A;  4ODP A;  4DIP A;  5HW6 A;  4U85 A;  3RFW A;  1D7H A;  2KFW A;  1PBK A;  1J4H A;  2IF4 A;  4MSP A;  3O5L A;  1Q6U A;  4ODQ A;  4FAP A;  2UZ5 A;  1Q6H A;  1YAT A;  2DG3 A;  2LGO A;  4IQC A;  3UF8 A;  4ODR A;  1JNT A;  2KGJ A;  3EY6 A;  1PIN A;  2PPO A;  2KFV A;  4TW7 A;  4JYS A;  4DRQ A;  3CGM A;  2N87 A;  2PPN A;  3UI5 A;  4DZ2 A;  3KAH A;  3KAD A;  2KO7 A;  4DRH A;  3NI6 A;  4DRK A;  4TYO A;  4W9P A;  5HT1 A;  2Y78 A;  2LKN A;  3KAI A;  4JFM A;  3O5R A;  1Q6I A;  2LJ4 A;  2RUC A;  3O5P A;  1L1P A;  3TDB A;  2PV1 A;  1EYM A;  2MLZ A;  2VCD A;  2F2D A;  3PA7 A;  4ODM A;  2ZR6 A;  1F8A B;  2D9F A;  3O5K A;  1BL4 A;  1FKF A;  1R9H A;  3I6C A;  3NTP A;  2RQS A;  1FKJ A;  3KAC A;  2F21 A;  3KAB A;  1FKH A;  4JFI A;  2MF9 A;  4MGV A;  5BXJ A;  2DG4 A;  2L2S A;  4BF8 A;  3KAF A;  4DRO A;  5J6E A;  4LAW A;  4JFL A;  4LAY A;  1FKS A;  2XP8 A;  3KAG A;  4J4O A;  2RUR A;  2MPH A;  2MNT A;  1EQ3 A;  2OFN A;  3O5M A; 
#chains in the Genus database with same CATH topology
 3VAW A;  4DWS C;  3O5E A;  3B7X A;  4DRP A;  1FAP A;  1H0I A;  4NNR A;  2FKE A;  5HW8 A;  1NMV A;  3TC5 A;  1ROU A;  4JFK A;  4ODO A;  1ZBH A;  4Z2I A;  1E6P A;  1A7X A;  3PRA A;  4GIV A;  1XRV A;  3O5J A;  1H1J S;  3UI4 A;  2F4E A;  1FKD A;  5GPR A;  1LL7 A;  2XP6 A;  3FLG A;  4MNJ A;  3CH9 A;  1D7J A;  1ZBC A;  1J6Y A;  4UZW A;  1FKB A;  1LL6 A;  5D75 A;  4TW6 A;  4Z2J A;  1W1P A;  1FKI A;  3ARP A;  1E6R A;  2RUD A;  2XP9 A;  2QNC A;  3O5D A;  4QT2 A;  1Q1C A;  3OOB A;  1X6L A;  1TFV A;  3LLR A;  4MTV A;  1FJD A;  5DO2 A;  1W1V A;  5HWB A;  1GKU B;  4WIW A;  2DT2 A;  2RUQ A;  4DRN A;  2JZV A;  2KI3 A;  2YBT A;  3ARX A;  1QZ2 A;  1D7I A;  3FAP A;  3O5Q A;  1D6O A;  2M1I A;  1E7L A;  2PPP A;  1WNO A;  3AS1 A;  4LAX A;  2B31 A;  2ITK A;  3KCE A;  1WAW A;  4DT4 A;  4MNK A;  2KE0 A;  2FAP A;  3TCZ A;  4R0X A;  2QNF A;  1LG1 A;  1P5Q A;  4GGQ A;  5JH8 A;  1JCH B;  4WKF A;  4ODL A;  1JNE A;  1EDQ A;  1ZBK A;  4DIP A;  4U85 A;  3RFW A;  5CIU A;  3WQW A;  3W4R A;  1NWT A;  2DG3 A;  3G6L A;  1ZU8 A;  1E6N A;  4P8X A;  2G41 A;  1A62 A;  3AS2 A;  3WD1 A;  4DRH A;  1HKJ A;  2Y78 A;  3KAI A;  4WKA A;  1OGB A;  5HBF A;  1EYM A;  2MLZ A;  2DSU A;  3L0O A;  3O5K A;  1BL4 A;  3WL0 A;  3EIP A;  1R9H A;  3NTP A;  1FKJ A;  3WD2 A;  3KAB A;  2DG4 A;  2RNO A;  4WJX A;  2XP8 A;  3B9E A;  3KAG A;  3B8S A;  2MPH A;  2MNT A;  1EQ3 A;  1GJJ A;  2OFN A;  3O5M A;  2M2A A;  3BXW A;  4NZC A;  2ZQV A;  3ARS A;  1NWU A;  3ART A;  4JFJ A;  1GL9 B;  1EHN A;  4U86 A;  4G50 A;  2XP3 A;  2RSE A;  4ODN A;  4Q22 A;  4Z2K A;  1KFW A;  3UQI A;  1X6N A;  2DG9 A;  1IX5 A;  2XPB A;  2PV2 A;  1Y0O A;  3WD0 A;  4KQZ A;  3WD3 A;  3ARZ A;  4Q7N A;  2DT0 A;  5HKG A;  5DIV A;  4DWS A;  4Z2L A;  2A3C A;  1JEI A;  4IT4 A;  1OGG A;  2F23 A;  1HKM A;  2MLY A;  3JXV A;  1GUV A;  1CTN A;  4LGX A;  1ZL1 A;  3CZ8 A;  3GTY X;  4W5U A;  1ITX A;  4ITZ A;  3ODK A;  2WLZ A;  2RNN A;  4O2T A;  3FXY A;  4QZV B;  3JYM A;  3IKG A;  3O5F A;  3ARO A;  1NMW A;  1HXV A;  2YBU A;  1KT0 A;  1WB0 A;  2MLX A;  2XPA A;  5DIU A;  3WH0 A;  1KHC A;  1GOI A;  3O5G A;  4QT3 A;  3RGC A;  1H9F A;  4Z2G A;  1M5Y A;  2PBC A;  2ESC A;  3QOK A;  1D7H A;  2KFW A;  1PBK A;  1J4H A;  2LD7 A;  3O5L A;  2LGO A;  4IQC A;  1FFQ A;  1JND A;  3UF8 A;  3ARV A;  4ODR A;  1JNT A;  2KFV A;  4DZ2 A;  2DT1 A;  3KAH A;  4W9P A;  4MPK A;  3O5R A;  1Q6I A;  2LJ4 A;  1W1T A;  2VCD A;  2F2D A;  3AQU A;  2WLY A;  3AS3 A;  1F8A B;  2AOS A;  1ZB5 A;  1FKF A;  2DK4 A;  3ARR A;  4DWS B;  2F21 A;  3OA5 A;  4JFI A;  5BXJ A;  3KAF A;  2DPE A;  4P8V A;  4LAW A;  3ARY A;  2PN0 A;  4HBE A;  1ZBW A;  4W9O A;  3WKZ A;  3IKD A;  3NRK A;  3UQB A;  4WK9 A;  2KVE A;  2WQG A;  3IK8 A;  1SYT A;  4XAK A;  4HAR A;  1EIB A;  4KR0 B;  1E9L A;  3GPK A;  3PRD A;  2LC3 A;  1QPL A;  1RD6 A;  3RM9 A;  1H9E A;  2KVU A;  4N19 A;  2W51 A;  1E7D A;  3ARQ A;  3CHE A;  1NSG A;  1JNS A;  3UI6 A;  4TX0 A;  3AS0 A;  4MAV A;  1HKI A;  1FKR A;  1FKG A;  2A3A A;  3FY1 A;  1NWS A;  3ARW A;  4DZ3 A;  4DRM A;  3UQA A;  2ODG C;  1FKL A;  1ZS9 A;  3O5O A;  4G2P A;  1HKK A;  3ALG A;  2IUZ A;  1LL4 A;  1HJV A;  3CHC A;  5I98 A;  4HBO A;  3WQV A;  2ZQS A;  4DRJ A;  2A3E A;  4J4N A;  3RM8 A;  4NSB A;  1NH6 A;  1LQ0 A;  3QKJ A;  3LUO A;  1ZBV A;  2OLH A;  2B5U B;  2DT3 A;  3WL1 A;  1W1Y A;  2PI6 A;  1B6C A;  1C9H A;  1TCO C;  2ZR5 A;  4URI A;  2A3B A;  1JEQ A;  1T11 A;  2K8I A;  2KR7 A;  2VN1 A;  2WK2 A;  4LAV A;  4ODP A;  2DSW A;  5HW6 A;  1YNS A;  2A8V A;  4ML4 A;  2IF4 A;  4MSP A;  1Y02 A;  1Q6U A;  4FAP A;  2UZ5 A;  1Q6H A;  1YAT A;  3RME A;  1PIN A;  2PPO A;  4Z2H A;  4DRQ A;  2G80 A;  2N87 A;  2G8Z A;  1E44 A;  3KAD A;  2KO7 A;  3NI6 A;  4DRK A;  4TYO A;  4L72 B;  1A63 A;  1EN7 A;  4JFM A;  2RUC A;  3O5P A;  3GU0 A;  4MNM A;  3TDB A;  1L1P A;  4ODM A;  2ZR6 A;  2D9F A;  2O9O A;  3CHD A;  4BIT A;  2HJQ A;  3I6C A;  4ODQ A;  4PTM A;  3KAC A;  5HWC A;  4ZPV R;  4MGV A;  4P8U A;  5J6E A;  4BF8 A;  4DRO A;  5GQB A;  1OWQ A;  4JFL A;  1H0G A;  4LAY A;  2RUR A;  3CHF A;  1JJR A;  4QIB A;  3B9D A;  2XP4 A;  4DH0 A;  3ARU A;  3B9A A;  3KZ7 A;  4IPX A;  4ZS6 A;  2WM0 A;  1V66 A;  1E6Z A;  1FKK A;  3JYJ A;  5DIT A;  2P4V A;  4S3J A;  3BMB A;  3G6M A;  3H9R B;  1NWR A;  2DSV A;  5HTG A;  3WD4 A;  1FKT A;  4IQ2 A;  1QPF A;  3PRB A;  1U79 A;  1F40 A;  3MDY B;  1GRJ A;  2ZR4 A;  1J4R A;  5HW7 A;  1UR8 A;  1ROT A;  4TW8 A;  4U84 A;  2Q5A A;  5GPG A;  2KW9 A;  2LPV A;  2PV3 A;  3O5I A;  4W9Q A;  3CGN A;  2KVD A;  1JVW A;  2DSZ A;  2AWG A;  3WIJ A;  1O6I A;  1J4I A;  1D2K A;  5B8I C;  1HJX A;  1KT1 A;  1FD9 A;  1W26 A;  1ZK6 A;  2O92 A;  2XP5 A;  1N1A A;  4L3N A;  4ZPT R;  2M08 A;  4C02 B;  4TNS A;  1LG2 A;  1K9T A;  4FN2 A;  2JVW A;  1W9V A;  2EUL A;  1BKF A;  1GPF A;  4ODK A;  2FDM A;  1YW5 A;  1ZCN A;  4DRI A;  4P8W A;  1UR9 A;  2ZQU A;  1HJW A;  2XP7 A;  3IHZ A;  4DWS D;  5DF0 A;  1W9U A;  5HUA A;  2ZQT A;  3PR9 A;  4IT6 A;  2QF8 A;  4UDM A;  4S3K A;  1E15 A;  2KGJ A;  3EY6 A;  1W9P A;  4TW7 A;  4JYS A;  3CGM A;  2PPN A;  3RM4 A;  1LJY A;  3UI5 A;  4WKH A;  1FFR A;  4AY1 A;  2ODC I;  1XHG A;  5HT1 A;  2LKN A;  2PV1 A;  3PA7 A;  1A8V A;  4ZPW R;  2RQS A;  1FKH A;  2MF9 A;  1SR0 A;  2L2S A;  4MNL A;  3ALF A;  5DEZ A;  1FKS A;  4J4O A;  2ETN A;  4R5E A;  1VF8 A; 
#chains in the Genus database with same CATH homology
 3VAW A;  4DWS C;  3O5E A;  3B7X A;  4DRP A;  1FAP A;  1H0I A;  4NNR A;  2FKE A;  5HW8 A;  1NMV A;  3TC5 A;  1ROU A;  4JFK A;  4ODO A;  4Z2I A;  1E6P A;  1A7X A;  3PRA A;  4GIV A;  1XRV A;  3O5J A;  3UI4 A;  2F4E A;  1FKD A;  5GPR A;  1LL7 A;  2XP6 A;  4MNJ A;  3CH9 A;  1D7J A;  1ZBC A;  1J6Y A;  1FKB A;  1LL6 A;  5D75 A;  4TW6 A;  4Z2J A;  1W1P A;  1FKI A;  3ARP A;  1E6R A;  2RUD A;  2XP9 A;  2QNC A;  3O5D A;  4QT2 A;  1Q1C A;  3OOB A;  1X6L A;  1TFV A;  4MTV A;  1FJD A;  5DO2 A;  1W1V A;  5HWB A;  1GKU B;  4WIW A;  2DT2 A;  2RUQ A;  4DRN A;  2JZV A;  2KI3 A;  2YBT A;  3ARX A;  1QZ2 A;  3FAP A;  1D7I A;  3O5Q A;  1D6O A;  2M1I A;  1E7L A;  2PPP A;  1WNO A;  3AS1 A;  4LAX A;  2B31 A;  2ITK A;  3KCE A;  1WAW A;  4DT4 A;  4MNK A;  2KE0 A;  2FAP A;  3TCZ A;  4R0X A;  2QNF A;  1LG1 A;  1P5Q A;  4GGQ A;  5JH8 A;  4WKF A;  4ODL A;  1JNE A;  1EDQ A;  1ZBK A;  4DIP A;  4U85 A;  3RFW A;  3WQW A;  3W4R A;  1NWT A;  2DG3 A;  3G6L A;  1ZU8 A;  1E6N A;  4P8X A;  2G41 A;  1A62 A;  3AS2 A;  3WD1 A;  4DRH A;  1HKJ A;  2Y78 A;  3KAI A;  4WKA A;  1OGB A;  5HBF A;  1EYM A;  2MLZ A;  2DSU A;  3L0O A;  3O5K A;  1BL4 A;  3WL0 A;  1R9H A;  3NTP A;  1FKJ A;  3WD2 A;  3KAB A;  2DG4 A;  4WJX A;  2XP8 A;  3B9E A;  3KAG A;  3B8S A;  2MPH A;  2MNT A;  1EQ3 A;  1GJJ A;  2OFN A;  3O5M A;  2M2A A;  3BXW A;  4NZC A;  2ZQV A;  3ARS A;  1NWU A;  3ART A;  4JFJ A;  1GL9 B;  1EHN A;  4U86 A;  4G50 A;  2XP3 A;  2RSE A;  4ODN A;  4Q22 A;  4Z2K A;  1KFW A;  3UQI A;  1X6N A;  2DG9 A;  1IX5 A;  2XPB A;  2PV2 A;  1Y0O A;  3WD0 A;  4KQZ A;  3WD3 A;  3ARZ A;  4Q7N A;  2DT0 A;  5HKG A;  5DIV A;  4DWS A;  4Z2L A;  2A3C A;  1JEI A;  4IT4 A;  1OGG A;  2MLY A;  1HKM A;  3JXV A;  1GUV A;  1CTN A;  4LGX A;  1ZL1 A;  3CZ8 A;  4W5U A;  1ITX A;  4ITZ A;  3ODK A;  2WLZ A;  4O2T A;  3FXY A;  4QZV B;  3JYM A;  3IKG A;  3O5F A;  3ARO A;  1NMW A;  1HXV A;  2YBU A;  1KT0 A;  1WB0 A;  2MLX A;  2XPA A;  5DIU A;  3WH0 A;  1GOI A;  3O5G A;  4QT3 A;  3RGC A;  1H9F A;  4Z2G A;  1M5Y A;  2PBC A;  2ESC A;  3QOK A;  1D7H A;  2KFW A;  1PBK A;  1J4H A;  2LD7 A;  3O5L A;  2LGO A;  4IQC A;  1FFQ A;  1JND A;  3UF8 A;  3ARV A;  4ODR A;  1JNT A;  2KFV A;  4DZ2 A;  2DT1 A;  3KAH A;  4W9P A;  4MPK A;  3O5R A;  1Q6I A;  2LJ4 A;  1W1T A;  2VCD A;  2F2D A;  3AQU A;  2WLY A;  3AS3 A;  1F8A B;  2AOS A;  1ZB5 A;  1FKF A;  2DK4 A;  3ARR A;  4DWS B;  2F21 A;  3OA5 A;  4JFI A;  5BXJ A;  3KAF A;  2DPE A;  4P8V A;  4LAW A;  3ARY A;  4HBE A;  1ZBW A;  4W9O A;  3WKZ A;  3IKD A;  3NRK A;  3UQB A;  4WK9 A;  3IK8 A;  1SYT A;  4XAK A;  4HAR A;  1EIB A;  4KR0 B;  1E9L A;  3GPK A;  3PRD A;  2LC3 A;  1QPL A;  1RD6 A;  3RM9 A;  1H9E A;  4N19 A;  2W51 A;  1E7D A;  3ARQ A;  3CHE A;  1NSG A;  1JNS A;  3UI6 A;  4TX0 A;  3AS0 A;  4MAV A;  1HKI A;  1FKR A;  1FKG A;  2A3A A;  3FY1 A;  1NWS A;  3ARW A;  4DZ3 A;  4DRM A;  3UQA A;  2ODG C;  1FKL A;  1ZS9 A;  3O5O A;  4G2P A;  1HKK A;  3ALG A;  2IUZ A;  1LL4 A;  1HJV A;  3CHC A;  5I98 A;  4HBO A;  3WQV A;  2ZQS A;  4DRJ A;  2A3E A;  4J4N A;  3RM8 A;  4NSB A;  1NH6 A;  1LQ0 A;  3LUO A;  1ZBV A;  2OLH A;  2DT3 A;  3WL1 A;  1W1Y A;  2PI6 A;  1B6C A;  1C9H A;  1TCO C;  2ZR5 A;  4URI A;  2A3B A;  1T11 A;  2KR7 A;  2K8I A;  2VN1 A;  2WK2 A;  4LAV A;  4ODP A;  2DSW A;  5HW6 A;  1YNS A;  2A8V A;  4ML4 A;  2IF4 A;  4MSP A;  1Y02 A;  1Q6U A;  4FAP A;  2UZ5 A;  1Q6H A;  1YAT A;  3RME A;  1PIN A;  2PPO A;  4Z2H A;  4DRQ A;  2G80 A;  2N87 A;  2G8Z A;  3KAD A;  2KO7 A;  3NI6 A;  4DRK A;  4TYO A;  4L72 B;  1A63 A;  1EN7 A;  4JFM A;  2RUC A;  3O5P A;  1L1P A;  4MNM A;  3TDB A;  4ODM A;  2ZR6 A;  2D9F A;  2O9O A;  3CHD A;  2HJQ A;  3I6C A;  4ODQ A;  4PTM A;  3KAC A;  5HWC A;  4ZPV R;  4MGV A;  4P8U A;  5J6E A;  4BF8 A;  4DRO A;  5GQB A;  1OWQ A;  4JFL A;  1H0G A;  4LAY A;  2RUR A;  3CHF A;  4QIB A;  3B9D A;  2XP4 A;  4DH0 A;  3ARU A;  3B9A A;  3KZ7 A;  4IPX A;  4ZS6 A;  2WM0 A;  1E6Z A;  1FKK A;  3JYJ A;  5DIT A;  4S3J A;  3G6M A;  3H9R B;  1NWR A;  2DSV A;  5HTG A;  3WD4 A;  1FKT A;  4IQ2 A;  1QPF A;  3PRB A;  1U79 A;  1F40 A;  3MDY B;  2ZR4 A;  1J4R A;  5HW7 A;  1UR8 A;  1ROT A;  4TW8 A;  4U84 A;  2Q5A A;  5GPG A;  2LPV A;  2PV3 A;  3O5I A;  4W9Q A;  3CGN A;  1JVW A;  2DSZ A;  2AWG A;  3WIJ A;  1O6I A;  1J4I A;  1D2K A;  5B8I C;  1HJX A;  1KT1 A;  1FD9 A;  1W26 A;  1ZK6 A;  2O92 A;  2XP5 A;  1N1A A;  4L3N A;  4ZPT R;  2M08 A;  4C02 B;  4TNS A;  1LG2 A;  1K9T A;  4FN2 A;  1W9V A;  1BKF A;  1GPF A;  4ODK A;  2FDM A;  1YW5 A;  1ZCN A;  4DRI A;  4P8W A;  1UR9 A;  2ZQU A;  1HJW A;  2XP7 A;  3IHZ A;  4DWS D;  5DF0 A;  1W9U A;  5HUA A;  2ZQT A;  3PR9 A;  4IT6 A;  2QF8 A;  4S3K A;  1E15 A;  2KGJ A;  3EY6 A;  1W9P A;  4TW7 A;  4JYS A;  3CGM A;  2PPN A;  3RM4 A;  1LJY A;  3UI5 A;  4WKH A;  1FFR A;  4AY1 A;  2ODC I;  1XHG A;  5HT1 A;  2LKN A;  2PV1 A;  3PA7 A;  1A8V A;  4ZPW R;  2RQS A;  1FKH A;  2MF9 A;  1SR0 A;  2L2S A;  4MNL A;  3ALF A;  5DEZ A;  1FKS A;  4J4O A;  4R5E A;  1VF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...