2MPHA

Solution structure of human fk506 binding protein 25
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
224
structure length
224
Chain Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of human FK506 binding Protein 25
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP3
total genus 30
structure length 224
sequence length 224
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
A PF18410 BTHB Basic tilted helix bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.80 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 2mphA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2mphA02
1PINA 3O5KA 2ZR6A 4LAYA 4TX0A 4DRMA 5HUAA 4TW8A 3NTPA 3KCEA 1NMVA 4ODKA 5HW7A 4QT3A 5DIUA 3O5IA 4JFKA 1J4HA 1J4IA 5B8IC 5DITA 1J6YA 5HW6A 4ODNA 3IKGA 1FKFA 2OFNA 2LJ4A 2JZVA 3JYMA 4JYSA 2N87A 4ODMA 5J6EA 3FAPA 2M1IA 2KO7A 1FKDA 2LGOA 4J4OA 2Q5AA 4W9PA 1FKLA 3OOBA 5HWCA 2RQSA 1FKKA 3KADA 4U85A 5D75A 3TCZA 2KE0A 4ODPA 2DG3A 4FAPA 4G2PA 2XP6A 4JFIA 4O2TA 2ZQVA 3KZ7A 1JNTA 3VAWA 2PV2A 1Q1CA 3PA7A 3NRKA 4IQ2A 5HKGA 3RFWA 4U86A 2L2SA 1U79A 1QZ2A 2KFVA 2F4EA 2ITKA 3TDBA 5HWBA 4G50A 1FKJA 1ZK6A 3H9RB 4GGQA 4R0XA 1Q6IA 4DRKA 2MNTA 4DIPA 2Y78A 1FKHA 2F21A 2RURA 2AWGA 1P5QA 3PRDA 4DRHA 5I98A 5HT1A 4TW6A 3UI5A 3WH0A 2M2AA 4JFMA 4JFLA 2D9FA 3GPKA 2UZ5A 3B7XA 3RGCA 2PPOA 4ITZA 2RUCA 2PPNA 3IHZA 3UQBA 1R9HA 2LKNA 3CGNA 1W26A 1D7IA 4J4NA 4DH0A 4DROA 2MLZA 1BL4A 3ODKA 1D6OA 1QPFA 1YATA 2XPBA 2ZR4A 3O5RA 4LAVA 2LPVA 3KAFA 3KAGA 1FKBA 1FJDA 1QPLA 2LC3A 2ZQSA 2DG4A 2MPHA 2XP8A 3O5LA 4BF8A 2DG9A 3KAHA 1C9HA 1FKGA 3O5QA 4ODOA 4MGVA 2XP3A 4FN2A 4DRPA 5GPGA 2VN1A 1JVWA 2ZR5A 3I6CA 3JYJA 3NI6A 4C02B 3UI4A 4DRJA 1T11A 4N19A 1ROUA 2RUQA 1Q6HA 2KR7A 1FKRA 2MLXA 2IF4A 3JXVA 2ZQTA 4IQCA 3TC5A 3O5GA 3O5MA 4DRIA 1TCOC 1ZCNA 4QIBA 1FD9A 1YW5A 4DZ2A 3LUOA 2XPAA 4MSPA 2XP5A 3PRBA 2M08A 4LAXA 2MF9A 1FKTA 1EYMA 3O5EA 4U84A 5DIVA 3O5FA 2K8IA 1Q6UA 2FAPA 1M5YA 1FKIA 1FAPA 2PPPA 2PV1A 2RSEA 2PBCA 1NSGA 4GIVA 4DT4A 3UQAA 2F2DA 4IPXA 1JNSA 1F8AB 3MDYB 3UF8A 3O5OA 4JFJA 3KAIA 2RUDA 3IKDA 4DZ3A 1F40A 1BKFA 4ODRA 5HTGA 1NMWA 1Y0OA 2XP4A 5HW8A 4W9QA 1EQ3A 2KI3A 1J4RA 3O5JA 4LAWA 1D7JA 1KT1A 2XP9A 2VCDA 4TYOA 1B6CA 4TNSA 2ZQUA 4DRQA 1D7HA 1A7XA 4ODQA 3UQIA 2PV3A 4ODLA 1PBKA 4W9OA 1L1PA 3IK8A 2XP7A 4NNRA 3O5PA 4TW7A 2MLYA 2KGJA 1HXVA 1FKSA 2KFWA 3EY6A 3KABA 3CGMA 1ROTA 4DRNA 3O5DA 4QT2A 5BXJA 1N1AA 1KT0A 3UI6A 3KACA 2FKEA
chains in the Genus database with same CATH superfamily
1LL7A 3O5KA 4LAYA 1A62A 4QT3A 4NSBA 3AQUA 1J4HA 1J4IA 4WKFA 3ARXA 4JYSA 4W5UA 2RNOA 3FXYA 2LD7A 4DWSC 5HWCA 1FKKA 3G6LA 3KADA 2KE0A 1W9PA 4ODPA 1TFVA 4G2PA 2DPEA 3FY1A 4JFIA 3KZ7A 3VAWA 4IQ2A 1Q1CA 4ZPTR 4U86A 3RFWA 2L2SA 3WD0A 3GU0A 1QZ2A 1ZBVA 2OLHA 2KFVA 3ARVA 1HKJA 3ARRA 1FKJA 1EN7A 1Q6IA 2MNTA 1FKHA 2F21A 2RURA 4IT6A 2A3AA 4JFMA 4QZVB 3GPKA 1JCHB 1X6LA 3WQWA 2PPOA 3UQBA 1D7IA 3CHDA 4J4NA 2MLZA 3ODKA 1D6OA 1QPFA 1HKMA 4UDMA 3KAFA 1OWQA 1FJDA 3ARZA 4Z2LA 2ZQSA 3WD4A 1D2KA 4Q7NA 4KQZA 4BF8A 2DG9A 4ODOA 4MGVA 5GPGA 3CHEA 2VN1A 4P8UA 1H1JS 1LG2A 1T11A 4Z2HA 1ROUA 4MNKA 1E9LA 1Q6HA 3PR9A 4ML4A 4DZ2A 2W51A 3WD2A 4LAXA 1GL9B 2YBTA 4DWSA 3O5EA 3O5FA 2K8IA 2PPPA 1FKIA 1FAPA 4DT4A 4MNMA 3UQAA 1OGBA 3UF8A 3O5OA 2O92A 1BKFA 3B9AA 1NMWA 1Y0OA 2XP4A 1CTNA 2KI3A 1J4RA 2EULA 4LAWA 1KT1A 1H0GA 2VCDA 3ARQA 4TNSA 1FFRA 1D7HA 1A7XA 2B5UB 3CHFA 2PV3A 3CH9A 1E44A 2QF8A 1PBKA 4W9OA 5JH8A 2XP7A 3LLRA 3RM9A 4NZCA 2KGJA 1WAWA 3EY6A 3KABA 1ROTA 4Z2KA 3OA5A 4URIA 3WIJA 1K9TA 4TW8A 3NTPA 3KCEA 3L0OA 1JEIA 1GRJA 1V66A 5DIUA 5HW6A 4ODNA 3IKGA 4ODMA 1W9UA 2N87A 1VF8A 2PN0A 2KW9A 2RNNA 2KO7A 4J4OA 4AY1A 4W9PA 3OOBA 4U85A 4LGXA 3B9EA 1UR9A 2XP6A 1WNOA 3FLGA 1W1VA 2ZQVA 5HBFA 1LL4A 5HKGA 4MNLA 1E6RA 1NH6A 2DT1A 1E15A 2ITKA 4G50A 3WQVA 1ITXA 3PRDA 5I98A 2DT2A 5HT1A 3WL1A 3UI5A 2M2AA 2O9OA 1O6IA 2D9FA 1XHGA 4S3JA 3AS3A 3B7XA 2RUCA 4IT4A 1W26A 1HKKA 2A3CA 1JEQA 2XPBA 4Z2JA 3WKZA 2LPVA 1ZU8A 3KAGA 1FKBA 3PRAA 3ARWA 3QOKA 2LC3A 3O5LA 1EIBA 2G41A 4DRPA 2XP3A 4WIWA 2WLZA 2ZR5A 3JYJA 4P8XA 1LQ0A 4L3NA 4C02B 1XRVA 4DRJA 2RUQA 3ARYA 3TC5A 3O5MA 4DRIA 1TCOC 3ARSA 1W9VA 5DF0A 4MSPA 1W1TA 4DWSD 2M08A 1FKTA 3ALFA 5DIVA 1JNDA 1OGGA 1M5YA 2RSEA 4MPKA 1H0IA 1JNSA 2KVEA 1NWTA 3MDYB 1EDQA 2RUDA 3IKDA 1F40A 5HTGA 4PTMA 4WJXA 1H9EA 2XP9A 1B6CA 4XAKA 1YNSA 4P8VA 1HKIA 2ODCI 4ODLA 1RD6A 3AS0A 2KVUA 2QNFA 3O5PA 1FKSA 1E7LA 4HBEA 2B31A 3ARPA 2FKEA 1PINA 3AROA 4DRMA 3B8SA 4ZS6A 3WL0A 1E6PA 1J6YA 1LG1A 1FKFA 2OFNA 3JYMA 2JZVA 5J6EA 3QKJA 2A3BA 3FAPA 1X6NA 1FKDA 2Q5AA 4WKAA 1FKLA 2RQSA 3TCZA 5D75A 2DG3A 4Q22A 1HJXA 4O2TA 2WLYA 1JNTA 2PV2A 3PA7A 5DEZA 1NWUA 3RM4A 5CIUA 1U79A 3EIPA 4MAVA 2F4EA 3TDBA 1NWRA 2DSZA 4GGQA 2QNCA 2DK4A 2Y78A 1P5QA 1ZB5A 3RM8A 1SR0A 1A63A 3G6MA 3WH0A 4JFLA 2ESCA 4HARA 4ITZA 3IHZA 2PPNA 2LKNA 3GTYX 1YATA 2JVWA 3O5RA 3WD3A 3W4RA 1A8VA 2ETNA 2PI6A 2MPHA 2XP8A 2HJQA 3KAHA 4L72B 1C9HA 1FKGA 4FN2A 3I6CA 3UI4A 2IF4A 3JXVA 1ZCNA 1FD9A 2XP5A 1GPFA 2WM0A 3RMEA 3ALGA 4U84A 1ZBKA 2ZR6A 1Q6UA 4GIVA 3RGCA 3WD1A 1NSGA 2F23A 1KFWA 2F2DA 1E6ZA 4ODRA 5HW8A 1EQ3A 2AOSA 3O5JA 5DO2A 1D7JA 1W1YA 4TYOA 2ZQUA 2G80A 4ODQA 1EHNA 1WB0A 2DT0A 4HBOA 4KR0B 1L1PA 4TW7A 2MLYA 4DRNA 1NWSA 5BXJA 1KHCA 1N1AA 1ZL1A 4MNJA 3UI6A 4ZPWR 3AS1A 3KACA 4TX0A 5HUAA 2ODGC 1HJVA 1GUVA 1NMVA 4ODKA 5HW7A 3O5IA 4JFKA 5B8IC 1ZS9A 5DITA 1LJYA 2DT3A 2LJ4A 4WK9A 2M1IA 2LGOA 3BMBA 2P4VA 4FAPA 1SYTA 2WQGA 3NRKA 1E7DA 4Z2IA 1GOIA 2FDMA 5HWBA 5GQBA 4R0XA 1ZK6A 3H9RB 4DRKA 1FFQA 4DIPA 2KVDA 1UR8A 4P8WA 2AWGA 4DRHA 3AS2A 4MTVA 4TW6A 1GKUB 4R5EA 3BXWA 1LL6A 2UZ5A 1ZBCA 1R9HA 4DH0A 1JJRA 3CGNA 4DROA 1BL4A 3B9DA 2ZR4A 4WKHA 1IX5A 4LAVA 4BITA 1QPLA 1HJWA 4S3KA 2DG4A 1E6NA 3O5QA 1JVWA 3NI6A 1H9FA 2DSUA 1ZBWA 4N19A 3ARUA 4ZPVR 2KR7A 1FKRA 2MLXA 2ZQTA 4IQCA 3O5GA 5GPRA 2A3EA 1Y02A 2YBUA 4QIBA 4Z2GA 1YW5A 3LUOA 2XPAA 3PRBA 2MF9A 4UZWA 1EYMA 2FAPA 1JNEA 2PV1A 2IUZA 2PBCA 4IPXA 1F8AB 2DSWA 2G8ZA 4JFJA 3KAIA 4DZ3A 2WK2A 4W9QA 3ARTA 2A8VA 3CZ8A 4DRQA 3UQIA 4DWSB 1GJJA 1ZBHA 2DSVA 3IK8A 4NNRA 1HXVA 1W1PA 2KFWA 3CGMA 3O5DA 4QT2A 1KT0A 3CHCA
chains in the Genus database with same CATH topology
1LL7A 3O5KA 4LAYA 1A62A 4QT3A 4NSBA 3AQUA 1J4HA 1J4IA 4WKFA 3ARXA 4JYSA 4W5UA 3FXYA 2LD7A 4DWSC 5HWCA 1FKKA 3G6LA 3KADA 2KE0A 1W9PA 4ODPA 1TFVA 4G2PA 2DPEA 3FY1A 4JFIA 3KZ7A 3VAWA 4IQ2A 1Q1CA 4ZPTR 4U86A 3RFWA 2L2SA 3WD0A 1QZ2A 1ZBVA 2OLHA 2KFVA 3ARVA 1HKJA 3ARRA 1FKJA 1EN7A 1Q6IA 2MNTA 1FKHA 2F21A 2RURA 4IT6A 2A3AA 4JFMA 4QZVB 3GPKA 1X6LA 3WQWA 2PPOA 3UQBA 1D7IA 3CHDA 4J4NA 3ODKA 2MLZA 1D6OA 1QPFA 1HKMA 3KAFA 1OWQA 1FJDA 3ARZA 4Z2LA 2ZQSA 3WD4A 1D2KA 4Q7NA 4KQZA 4BF8A 2DG9A 4ODOA 4MGVA 5GPGA 3CHEA 2VN1A 4P8UA 1LG2A 1T11A 4Z2HA 1ROUA 4MNKA 1E9LA 1Q6HA 3PR9A 4ML4A 4DZ2A 2W51A 3WD2A 4LAXA 1GL9B 2YBTA 4DWSA 3O5EA 3O5FA 2K8IA 2PPPA 1FKIA 1FAPA 4DT4A 4MNMA 3UQAA 1OGBA 3UF8A 3O5OA 2O92A 1BKFA 3B9AA 1NMWA 1Y0OA 2XP4A 1CTNA 2KI3A 1J4RA 4LAWA 1KT1A 1H0GA 2VCDA 3ARQA 4TNSA 1FFRA 1D7HA 1A7XA 3CHFA 2PV3A 3CH9A 2QF8A 1PBKA 4W9OA 5JH8A 2XP7A 3RM9A 4NZCA 2KGJA 1WAWA 3EY6A 3KABA 1ROTA 4Z2KA 3OA5A 4URIA 3WIJA 1K9TA 4TW8A 3NTPA 3KCEA 3L0OA 1JEIA 5DIUA 5HW6A 4ODNA 3IKGA 4ODMA 1W9UA 2N87A 1VF8A 2KO7A 4J4OA 4AY1A 4W9PA 3OOBA 4U85A 4LGXA 3B9EA 1UR9A 2XP6A 1WNOA 1W1VA 2ZQVA 5HBFA 1LL4A 5HKGA 4MNLA 1E6RA 1NH6A 2DT1A 1E15A 2ITKA 4G50A 3WQVA 1ITXA 3PRDA 5I98A 2DT2A 5HT1A 3WL1A 3UI5A 2M2AA 2O9OA 1O6IA 2D9FA 1XHGA 4S3JA 3AS3A 3B7XA 2RUCA 4IT4A 1W26A 1HKKA 2A3CA 2XPBA 4Z2JA 3WKZA 2LPVA 1ZU8A 3KAGA 1FKBA 3PRAA 3ARWA 3QOKA 2LC3A 3O5LA 1EIBA 2G41A 4DRPA 2XP3A 4WIWA 2WLZA 2ZR5A 3JYJA 4P8XA 1LQ0A 4L3NA 4C02B 1XRVA 4DRJA 2RUQA 3ARYA 3TC5A 3O5MA 4DRIA 1TCOC 3ARSA 1W9VA 5DF0A 4MSPA 1W1TA 4DWSD 2M08A 1FKTA 3ALFA 5DIVA 1JNDA 1OGGA 1M5YA 2RSEA 4MPKA 1H0IA 1JNSA 1NWTA 3MDYB 1EDQA 2RUDA 3IKDA 1F40A 5HTGA 4PTMA 4WJXA 1H9EA 2XP9A 1B6CA 4XAKA 1YNSA 4P8VA 1HKIA 2ODCI 4ODLA 1RD6A 3AS0A 2QNFA 3O5PA 1FKSA 1E7LA 4HBEA 2B31A 3ARPA 2FKEA 1PINA 3AROA 4DRMA 3B8SA 4ZS6A 3WL0A 1E6PA 1J6YA 1LG1A 1FKFA 2OFNA 3JYMA 2JZVA 5J6EA 2A3BA 3FAPA 1X6NA 1FKDA 2Q5AA 4WKAA 1FKLA 2RQSA 3TCZA 5D75A 2DG3A 4Q22A 1HJXA 4O2TA 2WLYA 1JNTA 2PV2A 3PA7A 5DEZA 1NWUA 3RM4A 1U79A 4MAVA 2F4EA 3TDBA 1NWRA 2DSZA 4GGQA 2QNCA 2DK4A 2Y78A 1P5QA 1ZB5A 3RM8A 1SR0A 1A63A 3G6MA 3WH0A 4JFLA 2ESCA 4HARA 4ITZA 3IHZA 2PPNA 2LKNA 1YATA 3O5RA 3WD3A 3W4RA 1A8VA 2PI6A 2MPHA 2XP8A 2HJQA 3KAHA 4L72B 1C9HA 1FKGA 4FN2A 3I6CA 3UI4A 2IF4A 3JXVA 1ZCNA 1FD9A 2XP5A 1GPFA 2WM0A 3RMEA 3ALGA 4U84A 1ZBKA 2ZR6A 1Q6UA 4GIVA 3RGCA 3WD1A 1NSGA 1KFWA 2F2DA 1E6ZA 4ODRA 5HW8A 1EQ3A 2AOSA 3O5JA 5DO2A 1D7JA 1W1YA 4TYOA 2ZQUA 2G80A 4ODQA 1EHNA 1WB0A 2DT0A 4HBOA 4KR0B 1L1PA 4TW7A 2MLYA 4DRNA 1NWSA 5BXJA 1N1AA 1ZL1A 4MNJA 3UI6A 4ZPWR 3KACA 3AS1A 4TX0A 5HUAA 2ODGC 1HJVA 1GUVA 1NMVA 4ODKA 5HW7A 3O5IA 4JFKA 5B8IC 1ZS9A 5DITA 1LJYA 2DT3A 2LJ4A 4WK9A 2M1IA 2LGOA 4FAPA 1SYTA 3NRKA 1E7DA 4Z2IA 1GOIA 2FDMA 5HWBA 5GQBA 4R0XA 1ZK6A 3H9RB 4DRKA 1FFQA 4DIPA 1UR8A 4P8WA 2AWGA 4DRHA 3AS2A 4MTVA 4TW6A 1GKUB 4R5EA 3BXWA 1LL6A 2UZ5A 1ZBCA 1R9HA 4DH0A 3CGNA 4DROA 1BL4A 3B9DA 2ZR4A 4WKHA 1IX5A 4LAVA 1QPLA 1HJWA 4S3KA 2DG4A 1E6NA 3O5QA 1JVWA 3NI6A 1H9FA 2DSUA 1ZBWA 4N19A 3ARUA 4ZPVR 2KR7A 1FKRA 2MLXA 2ZQTA 4IQCA 3O5GA 5GPRA 2A3EA 1Y02A 2YBUA 4QIBA 4Z2GA 1YW5A 3LUOA 2XPAA 3PRBA 2MF9A 1EYMA 2FAPA 1JNEA 2PV1A 2IUZA 2PBCA 4IPXA 1F8AB 2DSWA 2G8ZA 4JFJA 3KAIA 4DZ3A 2WK2A 4W9QA 3ARTA 2A8VA 3CZ8A 4DRQA 3UQIA 4DWSB 1GJJA 2DSVA 3IK8A 4NNRA 1HXVA 1W1PA 2KFWA 3CGMA 3O5DA 4QT2A 1KT0A 3CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PIN A;  3O5K A;  2ZR6 A;  4LAY A;  4TX0 A;  4DRM A;  5HUA A;  4TW8 A;  3NTP A;  3KCE A;  1NMV A;  4ODK A;  5HW7 A;  4QT3 A;  5DIU A;  3O5I A;  4JFK A;  1J4H A;  1J4I A;  5B8I C;  5DIT A;  1J6Y A;  5HW6 A;  4ODN A;  3IKG A;  1FKF A;  2OFN A;  2LJ4 A;  2JZV A;  3JYM A;  4JYS A;  2N87 A;  4ODM A;  5J6E A;  3FAP A;  2M1I A;  2KO7 A;  1FKD A;  2LGO A;  4J4O A;  2Q5A A;  4W9P A;  1FKL A;  3OOB A;  5HWC A;  2RQS A;  1FKK A;  3KAD A;  4U85 A;  5D75 A;  3TCZ A;  2KE0 A;  4ODP A;  2DG3 A;  4FAP A;  4G2P A;  2XP6 A;  4JFI A;  4O2T A;  2ZQV A;  3KZ7 A;  1JNT A;  3VAW A;  2PV2 A;  1Q1C A;  3PA7 A;  3NRK A;  4IQ2 A;  5HKG A;  3RFW A;  4U86 A;  2L2S A;  1U79 A;  1QZ2 A;  2KFV A;  2F4E A;  2ITK A;  3TDB A;  5HWB A;  4G50 A;  1FKJ A;  1ZK6 A;  3H9R B;  4GGQ A;  4R0X A;  1Q6I A;  4DRK A;  2MNT A;  4DIP A;  2Y78 A;  1FKH A;  2F21 A;  2RUR A;  2AWG A;  1P5Q A;  3PRD A;  4DRH A;  5I98 A;  5HT1 A;  4TW6 A;  3UI5 A;  3WH0 A;  2M2A A;  4JFM A;  4JFL A;  2D9F A;  3GPK A;  2UZ5 A;  3B7X A;  3RGC A;  2PPO A;  4ITZ A;  2RUC A;  2PPN A;  3IHZ A;  3UQB A;  1R9H A;  2LKN A;  3CGN A;  1W26 A;  1D7I A;  4J4N A;  4DH0 A;  4DRO A;  2MLZ A;  1BL4 A;  3ODK A;  1D6O A;  1QPF A;  1YAT A;  2XPB A;  2ZR4 A;  3O5R A;  4LAV A;  2LPV A;  3KAF A;  3KAG A;  1FKB A;  1FJD A;  1QPL A;  2LC3 A;  2ZQS A;  2DG4 A;  2MPH A;  2XP8 A;  3O5L A;  4BF8 A;  2DG9 A;  3KAH A;  1C9H A;  1FKG A;  3O5Q A;  4ODO A;  4MGV A;  2XP3 A;  4FN2 A;  4DRP A;  5GPG A;  2VN1 A;  1JVW A;  2ZR5 A;  3I6C A;  3JYJ A;  3NI6 A;  4C02 B;  3UI4 A;  4DRJ A;  1T11 A;  4N19 A;  1ROU A;  2RUQ A;  1Q6H A;  2KR7 A;  1FKR A;  2MLX A;  2IF4 A;  3JXV A;  2ZQT A;  4IQC A;  3TC5 A;  3O5G A;  3O5M A;  4DRI A;  1TCO C;  1ZCN A;  4QIB A;  1FD9 A;  1YW5 A;  4DZ2 A;  3LUO A;  2XPA A;  4MSP A;  2XP5 A;  3PRB A;  2M08 A;  4LAX A;  2MF9 A;  1FKT A;  1EYM A;  3O5E A;  4U84 A;  5DIV A;  3O5F A;  2K8I A;  1Q6U A;  2FAP A;  1M5Y A;  1FKI A;  1FAP A;  2PPP A;  2PV1 A;  2RSE A;  2PBC A;  1NSG A;  4GIV A;  4DT4 A;  3UQA A;  2F2D A;  4IPX A;  1JNS A;  1F8A B;  3MDY B;  3UF8 A;  3O5O A;  4JFJ A;  3KAI A;  2RUD A;  3IKD A;  4DZ3 A;  1F40 A;  1BKF A;  4ODR A;  5HTG A;  1NMW A;  1Y0O A;  2XP4 A;  5HW8 A;  4W9Q A;  1EQ3 A;  2KI3 A;  1J4R A;  3O5J A;  4LAW A;  1D7J A;  1KT1 A;  2XP9 A;  2VCD A;  4TYO A;  1B6C A;  4TNS A;  2ZQU A;  4DRQ A;  1D7H A;  1A7X A;  4ODQ A;  3UQI A;  2PV3 A;  4ODL A;  1PBK A;  4W9O A;  1L1P A;  3IK8 A;  2XP7 A;  4NNR A;  3O5P A;  4TW7 A;  2MLY A;  2KGJ A;  1HXV A;  1FKS A;  2KFW A;  3EY6 A;  3KAB A;  3CGM A;  1ROT A;  4DRN A;  3O5D A;  4QT2 A;  5BXJ A;  1N1A A;  1KT0 A;  3UI6 A;  3KAC A;  2FKE A; 
#chains in the Genus database with same CATH topology
 1LL7 A;  3O5K A;  4LAY A;  1A62 A;  4QT3 A;  4NSB A;  3AQU A;  1J4H A;  1J4I A;  4WKF A;  3ARX A;  4JYS A;  4W5U A;  2RNO A;  3FXY A;  2LD7 A;  4DWS C;  5HWC A;  1FKK A;  3G6L A;  3KAD A;  2KE0 A;  1W9P A;  4ODP A;  1TFV A;  4G2P A;  2DPE A;  3FY1 A;  4JFI A;  3KZ7 A;  3VAW A;  4IQ2 A;  1Q1C A;  4ZPT R;  4U86 A;  3RFW A;  2L2S A;  3WD0 A;  3GU0 A;  1QZ2 A;  1ZBV A;  2OLH A;  2KFV A;  3ARV A;  1HKJ A;  3ARR A;  1FKJ A;  1EN7 A;  1Q6I A;  2MNT A;  1FKH A;  2F21 A;  2RUR A;  4IT6 A;  2A3A A;  4JFM A;  4QZV B;  3GPK A;  1JCH B;  1X6L A;  3WQW A;  2PPO A;  3UQB A;  1D7I A;  3CHD A;  4J4N A;  2MLZ A;  3ODK A;  1D6O A;  1QPF A;  1HKM A;  4UDM A;  3KAF A;  1OWQ A;  1FJD A;  3ARZ A;  4Z2L A;  2ZQS A;  3WD4 A;  1D2K A;  4Q7N A;  4KQZ A;  4BF8 A;  2DG9 A;  4ODO A;  4MGV A;  5GPG A;  3CHE A;  2VN1 A;  4P8U A;  1H1J S;  1LG2 A;  1T11 A;  4Z2H A;  1ROU A;  4MNK A;  1E9L A;  1Q6H A;  3PR9 A;  4ML4 A;  4DZ2 A;  2W51 A;  3WD2 A;  4LAX A;  1GL9 B;  2YBT A;  4DWS A;  3O5E A;  3O5F A;  2K8I A;  2PPP A;  1FKI A;  1FAP A;  4DT4 A;  4MNM A;  3UQA A;  1OGB A;  3UF8 A;  3O5O A;  2O92 A;  1BKF A;  3B9A A;  1NMW A;  1Y0O A;  2XP4 A;  1CTN A;  2KI3 A;  1J4R A;  2EUL A;  4LAW A;  1KT1 A;  1H0G A;  2VCD A;  3ARQ A;  4TNS A;  1FFR A;  1D7H A;  1A7X A;  2B5U B;  3CHF A;  2PV3 A;  3CH9 A;  1E44 A;  2QF8 A;  1PBK A;  4W9O A;  5JH8 A;  2XP7 A;  3LLR A;  3RM9 A;  4NZC A;  2KGJ A;  1WAW A;  3EY6 A;  3KAB A;  1ROT A;  4Z2K A;  3OA5 A;  4URI A;  3WIJ A;  1K9T A;  4TW8 A;  3NTP A;  3KCE A;  3L0O A;  1JEI A;  1GRJ A;  1V66 A;  5DIU A;  5HW6 A;  4ODN A;  3IKG A;  4ODM A;  1W9U A;  2N87 A;  1VF8 A;  2PN0 A;  2KW9 A;  2RNN A;  2KO7 A;  4J4O A;  4AY1 A;  4W9P A;  3OOB A;  4U85 A;  4LGX A;  3B9E A;  1UR9 A;  2XP6 A;  1WNO A;  3FLG A;  1W1V A;  2ZQV A;  5HBF A;  1LL4 A;  5HKG A;  4MNL A;  1E6R A;  1NH6 A;  2DT1 A;  1E15 A;  2ITK A;  4G50 A;  3WQV A;  1ITX A;  3PRD A;  5I98 A;  2DT2 A;  5HT1 A;  3WL1 A;  3UI5 A;  2M2A A;  2O9O A;  1O6I A;  2D9F A;  1XHG A;  4S3J A;  3AS3 A;  3B7X A;  2RUC A;  4IT4 A;  1W26 A;  1HKK A;  2A3C A;  1JEQ A;  2XPB A;  4Z2J A;  3WKZ A;  2LPV A;  1ZU8 A;  3KAG A;  1FKB A;  3PRA A;  3ARW A;  3QOK A;  2LC3 A;  3O5L A;  1EIB A;  2G41 A;  4DRP A;  2XP3 A;  4WIW A;  2WLZ A;  2ZR5 A;  3JYJ A;  4P8X A;  1LQ0 A;  4L3N A;  4C02 B;  1XRV A;  4DRJ A;  2RUQ A;  3ARY A;  3TC5 A;  3O5M A;  4DRI A;  1TCO C;  3ARS A;  1W9V A;  5DF0 A;  4MSP A;  1W1T A;  4DWS D;  2M08 A;  1FKT A;  3ALF A;  5DIV A;  1JND A;  1OGG A;  1M5Y A;  2RSE A;  4MPK A;  1H0I A;  1JNS A;  2KVE A;  1NWT A;  3MDY B;  1EDQ A;  2RUD A;  3IKD A;  1F40 A;  5HTG A;  4PTM A;  4WJX A;  1H9E A;  2XP9 A;  1B6C A;  4XAK A;  1YNS A;  4P8V A;  1HKI A;  2ODC I;  4ODL A;  1RD6 A;  3AS0 A;  2KVU A;  2QNF A;  3O5P A;  1FKS A;  1E7L A;  4HBE A;  2B31 A;  3ARP A;  2FKE A;  1PIN A;  3ARO A;  4DRM A;  3B8S A;  4ZS6 A;  3WL0 A;  1E6P A;  1J6Y A;  1LG1 A;  1FKF A;  2OFN A;  3JYM A;  2JZV A;  5J6E A;  3QKJ A;  2A3B A;  3FAP A;  1X6N A;  1FKD A;  2Q5A A;  4WKA A;  1FKL A;  2RQS A;  3TCZ A;  5D75 A;  2DG3 A;  4Q22 A;  1HJX A;  4O2T A;  2WLY A;  1JNT A;  2PV2 A;  3PA7 A;  5DEZ A;  1NWU A;  3RM4 A;  5CIU A;  1U79 A;  3EIP A;  4MAV A;  2F4E A;  3TDB A;  1NWR A;  2DSZ A;  4GGQ A;  2QNC A;  2DK4 A;  2Y78 A;  1P5Q A;  1ZB5 A;  3RM8 A;  1SR0 A;  1A63 A;  3G6M A;  3WH0 A;  4JFL A;  2ESC A;  4HAR A;  4ITZ A;  3IHZ A;  2PPN A;  2LKN A;  3GTY X;  1YAT A;  2JVW A;  3O5R A;  3WD3 A;  3W4R A;  1A8V A;  2ETN A;  2PI6 A;  2MPH A;  2XP8 A;  2HJQ A;  3KAH A;  4L72 B;  1C9H A;  1FKG A;  4FN2 A;  3I6C A;  3UI4 A;  2IF4 A;  3JXV A;  1ZCN A;  1FD9 A;  2XP5 A;  1GPF A;  2WM0 A;  3RME A;  3ALG A;  4U84 A;  1ZBK A;  2ZR6 A;  1Q6U A;  4GIV A;  3RGC A;  3WD1 A;  1NSG A;  2F23 A;  1KFW A;  2F2D A;  1E6Z A;  4ODR A;  5HW8 A;  1EQ3 A;  2AOS A;  3O5J A;  5DO2 A;  1D7J A;  1W1Y A;  4TYO A;  2ZQU A;  2G80 A;  4ODQ A;  1EHN A;  1WB0 A;  2DT0 A;  4HBO A;  4KR0 B;  1L1P A;  4TW7 A;  2MLY A;  4DRN A;  1NWS A;  5BXJ A;  1KHC A;  1N1A A;  1ZL1 A;  4MNJ A;  3UI6 A;  4ZPW R;  3AS1 A;  3KAC A;  4TX0 A;  5HUA A;  2ODG C;  1HJV A;  1GUV A;  1NMV A;  4ODK A;  5HW7 A;  3O5I A;  4JFK A;  5B8I C;  1ZS9 A;  5DIT A;  1LJY A;  2DT3 A;  2LJ4 A;  4WK9 A;  2M1I A;  2LGO A;  3BMB A;  2P4V A;  4FAP A;  1SYT A;  2WQG A;  3NRK A;  1E7D A;  4Z2I A;  1GOI A;  2FDM A;  5HWB A;  5GQB A;  4R0X A;  1ZK6 A;  3H9R B;  4DRK A;  1FFQ A;  4DIP A;  2KVD A;  1UR8 A;  4P8W A;  2AWG A;  4DRH A;  3AS2 A;  4MTV A;  4TW6 A;  1GKU B;  4R5E A;  3BXW A;  1LL6 A;  2UZ5 A;  1ZBC A;  1R9H A;  4DH0 A;  1JJR A;  3CGN A;  4DRO A;  1BL4 A;  3B9D A;  2ZR4 A;  4WKH A;  1IX5 A;  4LAV A;  4BIT A;  1QPL A;  1HJW A;  4S3K A;  2DG4 A;  1E6N A;  3O5Q A;  1JVW A;  3NI6 A;  1H9F A;  2DSU A;  1ZBW A;  4N19 A;  3ARU A;  4ZPV R;  2KR7 A;  1FKR A;  2MLX A;  2ZQT A;  4IQC A;  3O5G A;  5GPR A;  2A3E A;  1Y02 A;  2YBU A;  4QIB A;  4Z2G A;  1YW5 A;  3LUO A;  2XPA A;  3PRB A;  2MF9 A;  4UZW A;  1EYM A;  2FAP A;  1JNE A;  2PV1 A;  2IUZ A;  2PBC A;  4IPX A;  1F8A B;  2DSW A;  2G8Z A;  4JFJ A;  3KAI A;  4DZ3 A;  2WK2 A;  4W9Q A;  3ART A;  2A8V A;  3CZ8 A;  4DRQ A;  3UQI A;  4DWS B;  1GJJ A;  1ZBH A;  2DSV A;  3IK8 A;  4NNR A;  1HXV A;  1W1P A;  2KFW A;  3CGM A;  3O5D A;  4QT2 A;  1KT0 A;  3CHC A; 
#chains in the Genus database with same CATH homology
 1LL7 A;  3O5K A;  4LAY A;  1A62 A;  4QT3 A;  4NSB A;  3AQU A;  1J4H A;  1J4I A;  4WKF A;  3ARX A;  4JYS A;  4W5U A;  3FXY A;  2LD7 A;  4DWS C;  5HWC A;  1FKK A;  3G6L A;  3KAD A;  2KE0 A;  1W9P A;  4ODP A;  1TFV A;  4G2P A;  2DPE A;  3FY1 A;  4JFI A;  3KZ7 A;  3VAW A;  4IQ2 A;  1Q1C A;  4ZPT R;  4U86 A;  3RFW A;  2L2S A;  3WD0 A;  1QZ2 A;  1ZBV A;  2OLH A;  2KFV A;  3ARV A;  1HKJ A;  3ARR A;  1FKJ A;  1EN7 A;  1Q6I A;  2MNT A;  1FKH A;  2F21 A;  2RUR A;  4IT6 A;  2A3A A;  4JFM A;  4QZV B;  3GPK A;  1X6L A;  3WQW A;  2PPO A;  3UQB A;  1D7I A;  3CHD A;  4J4N A;  3ODK A;  2MLZ A;  1D6O A;  1QPF A;  1HKM A;  3KAF A;  1OWQ A;  1FJD A;  3ARZ A;  4Z2L A;  2ZQS A;  3WD4 A;  1D2K A;  4Q7N A;  4KQZ A;  4BF8 A;  2DG9 A;  4ODO A;  4MGV A;  5GPG A;  3CHE A;  2VN1 A;  4P8U A;  1LG2 A;  1T11 A;  4Z2H A;  1ROU A;  4MNK A;  1E9L A;  1Q6H A;  3PR9 A;  4ML4 A;  4DZ2 A;  2W51 A;  3WD2 A;  4LAX A;  1GL9 B;  2YBT A;  4DWS A;  3O5E A;  3O5F A;  2K8I A;  2PPP A;  1FKI A;  1FAP A;  4DT4 A;  4MNM A;  3UQA A;  1OGB A;  3UF8 A;  3O5O A;  2O92 A;  1BKF A;  3B9A A;  1NMW A;  1Y0O A;  2XP4 A;  1CTN A;  2KI3 A;  1J4R A;  4LAW A;  1KT1 A;  1H0G A;  2VCD A;  3ARQ A;  4TNS A;  1FFR A;  1D7H A;  1A7X A;  3CHF A;  2PV3 A;  3CH9 A;  2QF8 A;  1PBK A;  4W9O A;  5JH8 A;  2XP7 A;  3RM9 A;  4NZC A;  2KGJ A;  1WAW A;  3EY6 A;  3KAB A;  1ROT A;  4Z2K A;  3OA5 A;  4URI A;  3WIJ A;  1K9T A;  4TW8 A;  3NTP A;  3KCE A;  3L0O A;  1JEI A;  5DIU A;  5HW6 A;  4ODN A;  3IKG A;  4ODM A;  1W9U A;  2N87 A;  1VF8 A;  2KO7 A;  4J4O A;  4AY1 A;  4W9P A;  3OOB A;  4U85 A;  4LGX A;  3B9E A;  1UR9 A;  2XP6 A;  1WNO A;  1W1V A;  2ZQV A;  5HBF A;  1LL4 A;  5HKG A;  4MNL A;  1E6R A;  1NH6 A;  2DT1 A;  1E15 A;  2ITK A;  4G50 A;  3WQV A;  1ITX A;  3PRD A;  5I98 A;  2DT2 A;  5HT1 A;  3WL1 A;  3UI5 A;  2M2A A;  2O9O A;  1O6I A;  2D9F A;  1XHG A;  4S3J A;  3AS3 A;  3B7X A;  2RUC A;  4IT4 A;  1W26 A;  1HKK A;  2A3C A;  2XPB A;  4Z2J A;  3WKZ A;  2LPV A;  1ZU8 A;  3KAG A;  1FKB A;  3PRA A;  3ARW A;  3QOK A;  2LC3 A;  3O5L A;  1EIB A;  2G41 A;  4DRP A;  2XP3 A;  4WIW A;  2WLZ A;  2ZR5 A;  3JYJ A;  4P8X A;  1LQ0 A;  4L3N A;  4C02 B;  1XRV A;  4DRJ A;  2RUQ A;  3ARY A;  3TC5 A;  3O5M A;  4DRI A;  1TCO C;  3ARS A;  1W9V A;  5DF0 A;  4MSP A;  1W1T A;  4DWS D;  2M08 A;  1FKT A;  3ALF A;  5DIV A;  1JND A;  1OGG A;  1M5Y A;  2RSE A;  4MPK A;  1H0I A;  1JNS A;  1NWT A;  3MDY B;  1EDQ A;  2RUD A;  3IKD A;  1F40 A;  5HTG A;  4PTM A;  4WJX A;  1H9E A;  2XP9 A;  1B6C A;  4XAK A;  1YNS A;  4P8V A;  1HKI A;  2ODC I;  4ODL A;  1RD6 A;  3AS0 A;  2QNF A;  3O5P A;  1FKS A;  1E7L A;  4HBE A;  2B31 A;  3ARP A;  2FKE A;  1PIN A;  3ARO A;  4DRM A;  3B8S A;  4ZS6 A;  3WL0 A;  1E6P A;  1J6Y A;  1LG1 A;  1FKF A;  2OFN A;  3JYM A;  2JZV A;  5J6E A;  2A3B A;  3FAP A;  1X6N A;  1FKD A;  2Q5A A;  4WKA A;  1FKL A;  2RQS A;  3TCZ A;  5D75 A;  2DG3 A;  4Q22 A;  1HJX A;  4O2T A;  2WLY A;  1JNT A;  2PV2 A;  3PA7 A;  5DEZ A;  1NWU A;  3RM4 A;  1U79 A;  4MAV A;  2F4E A;  3TDB A;  1NWR A;  2DSZ A;  4GGQ A;  2QNC A;  2DK4 A;  2Y78 A;  1P5Q A;  1ZB5 A;  3RM8 A;  1SR0 A;  1A63 A;  3G6M A;  3WH0 A;  4JFL A;  2ESC A;  4HAR A;  4ITZ A;  3IHZ A;  2PPN A;  2LKN A;  1YAT A;  3O5R A;  3WD3 A;  3W4R A;  1A8V A;  2PI6 A;  2MPH A;  2XP8 A;  2HJQ A;  3KAH A;  4L72 B;  1C9H A;  1FKG A;  4FN2 A;  3I6C A;  3UI4 A;  2IF4 A;  3JXV A;  1ZCN A;  1FD9 A;  2XP5 A;  1GPF A;  2WM0 A;  3RME A;  3ALG A;  4U84 A;  1ZBK A;  2ZR6 A;  1Q6U A;  4GIV A;  3RGC A;  3WD1 A;  1NSG A;  1KFW A;  2F2D A;  1E6Z A;  4ODR A;  5HW8 A;  1EQ3 A;  2AOS A;  3O5J A;  5DO2 A;  1D7J A;  1W1Y A;  4TYO A;  2ZQU A;  2G80 A;  4ODQ A;  1EHN A;  1WB0 A;  2DT0 A;  4HBO A;  4KR0 B;  1L1P A;  4TW7 A;  2MLY A;  4DRN A;  1NWS A;  5BXJ A;  1N1A A;  1ZL1 A;  4MNJ A;  3UI6 A;  4ZPW R;  3KAC A;  3AS1 A;  4TX0 A;  5HUA A;  2ODG C;  1HJV A;  1GUV A;  1NMV A;  4ODK A;  5HW7 A;  3O5I A;  4JFK A;  5B8I C;  1ZS9 A;  5DIT A;  1LJY A;  2DT3 A;  2LJ4 A;  4WK9 A;  2M1I A;  2LGO A;  4FAP A;  1SYT A;  3NRK A;  1E7D A;  4Z2I A;  1GOI A;  2FDM A;  5HWB A;  5GQB A;  4R0X A;  1ZK6 A;  3H9R B;  4DRK A;  1FFQ A;  4DIP A;  1UR8 A;  4P8W A;  2AWG A;  4DRH A;  3AS2 A;  4MTV A;  4TW6 A;  1GKU B;  4R5E A;  3BXW A;  1LL6 A;  2UZ5 A;  1ZBC A;  1R9H A;  4DH0 A;  3CGN A;  4DRO A;  1BL4 A;  3B9D A;  2ZR4 A;  4WKH A;  1IX5 A;  4LAV A;  1QPL A;  1HJW A;  4S3K A;  2DG4 A;  1E6N A;  3O5Q A;  1JVW A;  3NI6 A;  1H9F A;  2DSU A;  1ZBW A;  4N19 A;  3ARU A;  4ZPV R;  2KR7 A;  1FKR A;  2MLX A;  2ZQT A;  4IQC A;  3O5G A;  5GPR A;  2A3E A;  1Y02 A;  2YBU A;  4QIB A;  4Z2G A;  1YW5 A;  3LUO A;  2XPA A;  3PRB A;  2MF9 A;  1EYM A;  2FAP A;  1JNE A;  2PV1 A;  2IUZ A;  2PBC A;  4IPX A;  1F8A B;  2DSW A;  2G8Z A;  4JFJ A;  3KAI A;  4DZ3 A;  2WK2 A;  4W9Q A;  3ART A;  2A8V A;  3CZ8 A;  4DRQ A;  3UQI A;  4DWS B;  1GJJ A;  2DSV A;  3IK8 A;  4NNR A;  1HXV A;  1W1P A;  2KFW A;  3CGM A;  3O5D A;  4QT2 A;  1KT0 A;  3CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...