2MQ0A

Nmr structure of the c3 domain of human cardiac myosin binding protein-c
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of the C3 Domain of Cardiac Myosin Binding Protein C and Its Hypertrophic Cardiomyopathy-Related R502W Mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
molecule keywords Myosin-binding protein C, cardiac-type
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mq0A00
1KCRH 2GSGA 4PRBA 4NQCA 4H20L 2UUDK 2Z8SA 5J13B 4Y4FB 2DQCL 2R0LL 3KGRA 1IZKA 2Z93A 4GXVH 1Y6MR 4FTVD 3KYMA 3LKQA 4POUB 3QXDB 2H26B 4QOKB 4TYUA 5KSVB 3QWQB 1MIML 1AGBA 1UGNA 2DKSA 3GB7A 4MQXD 2VKWA 4I8DA 1LO2L 3P0YL 5D72H 5CGMA 4M7LT 5D7IA 4LMQI 1ZV5A 1CGXA 4C56D 4EI6B 2DLFH 5I73C 4J3VA 2BMKB 4IRSA 1HINL 1NGYA 3QEGH 3AUVA 3QFJA 1H3PL 1RQ5A 2CDFB 5GRJH 1OARL 3D39E 4G8EB 1AXTH 2B2XH 1BX2A 2EXYD 2KKQA 3O3EB 1R5VA 4H20H 4A2LA 1QRNA 2Z31D 4HLJA 3SJVB 2EIDA 1I7TB 1K8IB 5IP4A 3ZKMC 3WMSA 2X4NA 4EI5D 3AXLB 1P69B 4NOFA 5D9SB 5FUCE 4CN6A 1Z0NA 5D2NA 3K4DA 1OARH 2OP4L 2ATKB 2DQHH 5DFVD 1CLZH 1WV7T 3B5TA 1FVCB 3CH8A 1EXUA 4WI5A 4RGOL 4RA0C 3DMMA 5DC4B 5JPMA 5KS9A 5I8KL 5DJDB 2A6KB 3MR9B 4JREC 4YDKL 2AEQH 2Y7QA 2I26N 1U8JA 3VXNA 4MMXC 4IMKA 5TDNA 6FABH 2IPKA 3CLFL 1OM3L 1UENA 5EA0L 4B5EA 1C08B 2R0LH 1Z5LB 3HRPA 1BIIA 4FQ2H 1HSAB 1RZKH 3QNYB 2ZUTA 3KJ4C 3OWEA 5H35A 2FD6L 3HNTL 4ZFZB 4OGAD 5HGAB 1LO0L 2Y4SA 4KDTC 3RUGE 3L3OA 1BVZA 1YEEL 3TBVA 2X4UB 1I9JL 4LQFH 4WGWB 3PWNB 3SQBA 5D8JH 1GGYA 1PY4A 3NFSH 5KZCB 2PYFB 2DWDB 5F1NA 1U8KA 4YWGL 3S5LA 5MP6L 4YX2L 2DMKA 4MMZC 1OGAB 4UDTB 5LGHH 1FZOB 1PQZB 3LD8B 1KB5H 2CD0A 3F7QA 3TT1H 2XWBA 1BBDL 3C5JB 2HJFB 3VH8A 4HIJA 3LVEA 1I4FB 2XV6B 3L3OB 5GRYA 1F3JA 3DUSA 3MRGB 4QRTB 2D4DA 2FWOB 3GKWL 2FD6H 1RJYB 1J0KA 1UXSA 5D7JB 4U0QB 3IDNA 4KJPD 4FFVC 4UT9L 4L4TE 4DGVH 3QXDA 4MJIA 1QBBA 2DIAA 4AK1A 3RFZC 1E4XL 3ZT5A 3BMWA 3TIEA 1IL1B 4Y19A 3RY6A 1OSZB 4N5EC 1WT5A 4GKSB 2VSDA 2VDLL 5A2KH 4NUGL 2D0GA 3ARWA 4CDHA 1D6VL 4LSTH 4XWGL 5C8JB 1QNZL 1B2WH 3Q5TA 1G6RB 4CVUA 1S9XB 4PREA 2H32A 2AJYL 2NXZB 1U8MA 1I7RB 4K3EL 4PV8B 5FYLE 1KACB 5IOPB 1YY8B 4Q58C 5FUCC 3UYRH 4KROB 3TT3H 1OF2A 2M26A 4ENED 1L4IA 4F7MA 1CFTA 3VFPB 2VDOH 2BRQA 2H3NA 2CH8A 3QEQD 5C0FA 4FHBD 1EGJH 2Y36L 4J4PC 1RAMA 4E9LA 5DQJA 3RVUD 4JVWA 2DYPD 5BVPL 1BPVA 2P7TB 3BGFB 4P2QB 2X4RA 1R6VA 4OGYH 1QPPA 4KKLD 5ENWA 4XP9H 1HH9B 5I1CH 3ROLA 3RIFF 4A2MA 4JKWA 1AD0A 3HAEG 1G7LB 3QUZC 1Q94B 3IU3A 5E2VL 1RZJH 3CVIL 5CIPA 1K5NB 4KAQL 1FNEA 1OP3K 5BO1L 4X7EC 3K8KA 3T0BA 3RL2B 5I1JL 4TQEH 3OX8A 2F58L 5IESH 4LGSB 1L0XA 2JCCB 4JFDE 1WK0A 4EBQL 3GSWB 5DUMH 3BZ4B 1VEMA 4UT7H 1H3XA 3KG5A 4UT6H 5E1AB 4HT1H 4N0UA 3EGSA 1Q9OA 3D69A 4HEPG 5DJ6A 4HIXH 3ARTA 4FFZH 3CFIC 5DEGA 3WKML 4TULH 4KDVA 4E41B 1U42A 5D96C 5EN2A 1KLFA 4U7KA 5GGSY 2AERT 5C0CD 3RY5A 2W0PA 4Y16B 3CFKA 3ULVH 5E4IA 5IESL 5F71A 2JELH 1URLA 1T1XB 3REWA 5I73B 4OLEA 2BOBB 1QD0A 4X6FB 4YR6B 4JO3L 5E03A 3EOTH 2Y25A 1CFNA 4M5ZH 4S0SD 4BJLA 1OD7A 1CLOL 3V2AR 2Z91B 4PY7A 2XPGB 1YC7A 5ILTH 5EO0B 1M7XA 5HDBE 1FLRL 3MO1A 3H3PH 12E8H 1AR2A 3DTXB 4HV8A 5ADPL 1MCWW 1C12B 4Z18A 4EUPG 1JZ2A 4LEOB 5B38A 3D3VE 2IFFL 3KPLA 1AY1L 3G5XA 2DJUA 3CXDH 1JGLH 1N8ZB 3PV7A 4RMTA 1FORH 3LEYH 5IFAL 1OAZL 4LCWB 4YHMH 2Z93B 3TO4C 3UTTD 1Y6KR 3MBXL 1KYOK 3HUJA 1PG7L 5E7FA 4YDVB 2C9AA 4S1QH 4YPGA 1X9QA 3QDAA 5I1IL 3FO2A 5LGJA 1A6UL 5E5RB 5IEHA 3IDMA 3PHOA 3QT2A 4BFIB 3TNNB 5KVMC 4QRQB 2F5BL 3RVWC 2VABB 2QQNH 1ONQA 1XR8B 3SDYH 2FX8H 2OZ4A 2ARJA 1MF2H 2EE9A 5AUMB 2IH3B 3QEHB 2BSTB 1J10A 2A77H 3RAJL 2YEZB 4M7LH 4RSVA 3RDTB 3O4OB 5FKAB 5DDHB 5EH1A 4EUPB 3OR7B 2VDML 3X14B 4TSBH 4FN0A 1KTLA 4XP4H 3F12B 3V7AE 4JY5L 5E6IB 1JFQH 1N5AB 2W9DH 4HBQA 5F1OB 5IUSA 3U2SA 4MNQE 2C1PB 4M03A 4CVXB 1JF5A 1KBGH 2K7PA 2YXMA 1D9KB 3L6FB 3MLXH 5C08A 3X14A 4LLQB 2ADGB 3MGOA 3NH7L 1Q9LA 3NIFE 3W39A 3VFNA 3U1SL 5KANI 1UJ3C 1DQQA 2EDNA 4LCUB 2HT4D 4RAUB 4S1QL 4JFZH 4LCCA 1Q38A 5CWSA 5ESQB 3FFDB 3JSSA 5DJCB 1R3IL 4OLXL 1CCZA 4OCYL 3OKLA 3EGSB 3GMOB 2BY3A 1VDGA 3OAZK 2DAVA 4Y2DC 4JRXA 2GTWB 1NCWH 1Q9LB 3WFDL 5JOPD 4KPHL 4PJBA 5DVMA 3TN0A 4GS7C 4JKPL 4JDTH 12E8L 3QDGA 5ABDE 2QQLH 2DJ4A 3KPSB 5D7IF 2UWEA 5KVEH 4M62H 4NO0A 4U6YA 1V3JA 3MCLH 5JIKA 3RTQD 5IHZA 2DQGL 2E9BA 2IG2L 3CFDA 1NMBL 3VRLF 2ZOLB 2FGWL 1GGIH 5D6DC 2HJFA 3VH8B 3CMOH 4ZUUB 4PG2A 1X5JA 3O8XD 3G5XB 5B4MC 5CBEB 3PWVA 3NCYS 5FK9A 3PQYE 4L4VA 4NN5C 5DJYA 5GS2D 3MV8A 3DUUA 3WLBB 5D7JD 4QXGL 3X11A 1YYMH 5HHOD 2J6EH 1IKNC 2I60L 2GJ6B 1OTUD 1BJ1H 3QWOA 1JNHB 3M17A 1TJHH 2H2SD 2AJVH 1GRWA 2YRZA 3BKYH 4R7DA 4YIQA 3GMMA 4TSCH 4YDIH 3FT4A 5AG8A 2NY5C 4K23H 2FEEI 1PD6A 2DLGA 1AKJB 3KJ6H 1J1XH 1RK0B 3JV6B 5L88H 4LVNB 3D25A 4M5YH 5KOMC 1D5IH 4K3JH 3W0WB 5HYSA 1ND0A 3I84A 1QVOA 3IAGC 4IDJH 1OW0A 2AABH 4CMMB 3QJFB 1AGCA 2H32B 4C55A 3DIFA 4OI9A 1IFHH 1MJ8H 4Y5XB 5C0AE 2E8ZA 5K9QI 1DANU 4A6YB 1BQLH 2CJUL 4UNTA 4X4YA 1OP3H 1UZ6F 4AEFA 1QACA 3VWKD 2WP3O 3DX9A 2VQUA 4K9EH 5F3HA 4XNQA 1EDQA 4F33B 3ZSTA 2FZ3A 3FFCD 5DQJB 4WW2A 5GRVK 1KT2A 4F7PA 1JWUB 3O2DL 4BZYA 3OR6A 5DF0A 1CLYL 1FCCA 1CGVA 1BLNA 3DMMD 3T2QA 2DLEA 3MLVH 3RJQB 2VDOL 2BDNL 1J1OL 3QIUB 4KHXH 3O3EA 4P2QA 3V6ZB 3ZL4H 2JJVA 3QCTH 4DFHA 4L9LC 3EYSH 4HUKB 4J1UA 4BZ1L 4LIQE 4G7YL 3QDJD 2VLMD 1W72A 3IDJA 4F8QA 5EO9A 4B0MM 3RZCC 1YJDH 1G7PA 1I8LC 1LDPL 2QHRH 43C9A 3TF7C 1BP3B 2YZ1A 1HYRC 3PL6A 2UWEE 4NWUH 3QQ9D 3MACL 5ADOL 1CT8B 4RFOL 1M71B 4ERSL 3V5DB 1PJ9A 1RK1A 1A9BB 2XA8L 2BVPB 3LQMA 1KXTB 1FNLA 1VADB 2VDQH 3UJIL 1MSPA 2QSTA 3DX7B 3IT8D 1CFTB 5F7WC 5IB4B 1JRHH 3QCVL 1VGEH 5EWIL 1B4RA 1VFMA 5F44A 1T04B 2GJZA 4RISH 2BVUA 1BBJB 1D5BB 3SDDC 5D2NE 3BUYB 1I9IH 4Y5YB 5GZOD 3V79C 2EECA 4NBXB 2C3VA 4DWHA 5IBLD 3VE0B 4NDMB 3IJYA 5BMFL 2JB6A 4LKCA 2EXWC 1C16A 4R96B 1TMCB 2V7HB 4UDUA 3P73A 4WHTA 1FDLL 1ED3A 4LDOB 4ZS6D 1FE8L 5BQ7B 4WW2F 3VMPA 1A2YB 4UBDD 5F88A 3AMLA 5DJXA 2FL5B 1X5GA 3TZVB 4LVNC 4P2OB 4LCWE 5FM4A 1NGQH 35C8H 2A9NH 2FSEA 1P7QA 2CDGB 4G9FB 4YWGH 3ZDZE 1KENL 3IDYC 4JQXC 4WCYL 3LRSB 4BZ2H 2P8LA 2ED8A 2WIIA 4UIMA 1OGTB 4PLJD 3FB6A 3MRGA 1NUFA 4PLKC 5KTEL 4U1LB 3ULSA 1REIA 1A2YA 2B0SL 2H32H 4HGWA 1CF8H 2E6QA 4U1KB 4MA1C 3KPPB 5DQDH 3SDCC 2CSPA 4H1LG 4X8JB 4U3XA 4PJEA 3DHJA 1EJOH 3MC0A 4MSWB 3EOAA 3S4SA 5IMLB 1FFQA 2R0WL 3EFDH 2C5DC 1ZT4A 4LOUC 3FQTA 1I3GH 3WNNA 3STLB 4KVCL 1N6QL 2BC4A 4UU9A 4P59L 4OI7A 4G7YH 1BZQK 4MAYD 3G6JB 2VWEC 3NOIA 3T2NL 5F7YC 4K94L 2QR0B 3VGBA 1QQDA 4BYHA 5DLML 5A16B 4F15C 3UPCA 2X9WA 5DVOA 5HHVH 1NCBH 1CFVL 1MFNA 1LO5B 4PG2C 4X6CF 4Y16D 4NN7B 2P24B 4ZYKB 1YQ2A 1GL4B 3N1PC 3HLAB 3FQXB 3BKJH 5JHDE 1CU4L 3NABH 4CADA 4MNGA 1NGWB 4G9DA 1KJVA 3U4BL 5DHVH 4J4PD 4NKDA 1CXEA 1OAQH 1FN4A 2X4NB 4RFNB 4OLZL 3VW3H 1CDIA 3GSUB 3KNBB 3C6SB 4XNMB 4HIEA 2VLRD 2Y6SC 5E70A 2F74B 5F9DC 1JGVL 3NAAL 5D5MB 3HAEB 4F7TA 2VL5A 3CFBA 3IFPB 4O51A 5FHBH 3C8HA 5EDXA 1KEML 1WZLA 1YMMD 3DBXA 4M8VA 5ICYB 3FFCB 3IDGA 5MEND 2ARJQ 1PG7X 4KWUA 4Q97A 3KJ6L 2QV2A 2FCBA 2C4XA 2E9IA 3IXTA 2A6JA 3TH2T 5L2KA 2UWEB 4HXAL 2O5XL 3BUYA 3O4OC 3BMVA 4OFYA 3C6LC 1OT2A 1OOAA 2C3VB 1Z5LA 3PGCA 2I60H 1CE1H 4M7KL 5J57B 5FYKL 2Q20A 1WSST 5ITBH 3FT3A 5JXAL 2AI0H 5CMAA 4LP4A 4OV5B 3P30H 1J8HD 3DSFH 4L8DA 2A83A 2ERJB 4WUKH 5DA0B 4KMTH 3QUYD 2J8UB 2Z9TA 4GRWE 43CAA 3HNSH 4CMMA 1NBZA 4HF5H 3S34L 1GPOH 2F54A 5CJBA 4XHJC 5E8EA 1NMBH 1KELL 4XVUC 5GGRA 2J4WL 2W65B 2X41A 2AQ2A 4OIBA 1RD6A 1Q9WA 4LHUA 4U0RC 5ANME 1QSEB 2BFVL 3MX0A 1Q72H 3ULSB 5F8QC 1KFAH 4CDGC 4Y1AE 1RIUL 5I74B 4BSWB 2NYYD 1SBSL 3M17B 3VFMB 3LDBB 4MDJB 3C09B 4LLVB 2QSCL 1GGCH 1SJEA 4G80B 1LHZA 1OSPL 5MI0C 2X4SA 3MLTB 2WBKA 1YPZE 2F5AL 5BV7L 4Z5RA 4BH7B 5JW5A 5E08H 5HHNA 3K81A 4IRJA 1RHHA 4W6XB 5MERB 1DBKL 2CKBL 2YRLA 3UJTL 4U1NB 4UILL 4DN4L 5F9OH 4M6OH 1MJUL 1KNOB 3K4ZA 3OKMA 1MH5B 2G75A 4OD1L 4ZODA 2ZUUA 3DXAE 2D0HA 4WEUD 3VH8G 4LSUL 3LQAL 3CH1A 4FTVA 4NKQB 3D3VA 3U0PB 1QSFD 3S88L 5HGGS 4X83A 5KN5B 4DOHE 4IMKC 1EEUA 1MIEL 4YHZL 4I3SL 1JV5A 1F02I 2AW2A 2R0KH 3PQYB 4ONGH 3TPUB 5HVWA 1S5HB 4LLDA 2Q86B 3MUY1 4PJ7B 1AQDA 3QH3A 3VWJD 3RX7A 2XN9D 3BP4A 5CIPH 1A7OH 4E42B 4GKZA 3RVVC 4M00A 4D94A 1VFBA 2YEZA 3WXVH 5GS1B 1ZT7B 1CBVH 3HAEH 3UTTE 4L4TB 3N9GH 1U3HD 3KPTA 2V9QA 4QXTA 4UV7L 2WBJC 1YNTB 1BOGB 1HDMA 4Z78A 3L9RB 4JO2H 4XXDB 4S1SH 4YUEL 3WFHB 1HHGA 1U6AH 2WBWB 3PGDA 3IETA 5HYQA 4KKBC 4WGVB 1UCBL 2R2HB 1A5FH 1U8HB 2C26A 4PTTA 2EYTA 3QDGE 3MOQA 4H26A 4JFDA 3WS3B 1X5FA 1UYWL 2G5BB 1WVZA 2I9LB 3MLYL 3MRBB 3K0WA 5FV1L 4GRMA 3GZKA 3IXTB 1CDYA 1MWAB 5C08E 5I9QC 1UM4H 2WWKT 1X3DA 2NX5E 4JQIH 1LK3H 3WL9B 5A2JH 3EYUH 3GSNA 1N2RB 3ZLQC 5KVFH 4MNQA 2W59A 5JHDD 4MAYA 1LP9F 1BFVH 1FVDB 2JK5A 3HUJF 2CUHA 3VXUB 3WO4C 1M05B 4PRDB 2HFTA 3H3PL 5ADPH 3IFPA 1DL7L 2C3GA 4PJBB 3TN0B 4YPJA 4XC1H 1BQSA 1MFDL 4XAKD 3P4NA 4AENB 2ZNWA 1X4XA 5FYLL 5CJXA 3PHQB 2HT2D 1QSEA 3QI9A 1MFCL 3UTTB 4WFGD 3VWKA 1PYWA 2B4CL 5CUSL 5MI0B 3GMRA 3B9KD 1KCSH 3THMH 5FO8B 1X6LA 2HRPL 3EDJA 4FQIL 2I9TB 5GGRY 4N0RA 1GPOL 4LRNL 3SKNB 1IGIL 5C0JB 3ULUL 2YA1A 3RWDB 1HHHB 2VB5A 4R0LC 2W07A 1A3LL 1MCKA 2VLKA 1E6JH 3KDMA 1ODAA 2Z91A 4PY7B 4PJAA 5IVXB 4HC1A 1KN2L 1DLFL 3RNQB 3H9YA 1II4E 5AD0A 1HKFA 3C2AL 1QO3A 4YR6A 4OLWL 1OAUH 2C4FU 4TQEL 4XRCA 4BK5A 5ERWA 3RI5F 4NQXA 1FAIH 3SKNA 2ZKHH 2P48B 4MSWA 5JQ6L 1Q9WB 3ZE1F 1XZ0A 3BPOC 3KPOB 1YC8A 4G5ZH 4LCYA 5HVHB 5EU6A 2YD4A 5C3LD 1OWRM 2JIXD 4LNVA 2NXZC 4OCRL 3HG1E 3MLTA 4LL9A 3PQYA 4AEHH 3VXPA 2OM5A 2PTVA 1A1NA 1X5XA 4NKMB 1GOFA 1IBGL 1AFVL 5IEHB 1QKZH 3NCJH 5KW9H 1KF9B 3SDDD 5IB5B 1B88A 3HZKA 4FQXA 5GS0H 3W0WE 1CFSA 4NFDA 4PFEA 3QIBA 3ULUE 1WEJL 4ZNEE 4PGBB 2GI7A 4OGZA 5B3JF 5JDSB 1XIWD 4UTAL 4WHCA 5IVXF 1A1MA 1EO8H 5J7CC 3ARGC 2VN7A 2CIKB 3MLSH 2DLIA 2XXCB 4BQ9A 5L2KE 4OCMC 4GMSL 1LO4L 1MLBA 1ORSB 1WEJH 2V5YA 2XNAA 5J13C 2E8YA 4CRPA 4MJ5A 4HIEB 3R1GL 4R9HA 2XACC 4HS3B 3VI3E 3A6CH 2OR9H 5E00B 4Z8FH 3HC3H 3SE9L 3UAJC 1KEGL 5IT2H 1RURH 3GSXA 3IDIA 3FFCE 1MAKA 2DWDA 3V5DA 3OZ9L 5DEGB 2X89D 4LLYB 4JR9H 1HH9A 3E6HB 4G8GB 1V7MH 3TV3H 5D2LF 5JHDA 3HPLA 3UDWA 3BAEL 4CVZB 1AHWC 1RUPL 4HZLB 1AO7B 3G5ZA 2HWZL 2ESVA 1D5BA 5DZNA 3QO0B 4GMTL 5T1LD 4DJMA 2ID5A 3BSZL 3KWWB 4P3DB 4LLMB 4PGZA 3HNSL 2BNRD 3BWAB 4FQ1L 3OAYH 3SO5A 4PRNB 1ED3B 1FBIH 4ODVL 5SWSD 3OKEA 3W81A 1V05A 4L3ED 4ZD3L 1B0RA 3KPLB 4U33A 5DJ6B 1CICB 5JLZA 1RHHB 1D5XB 2HYMA 1UH3A 3S96B 3ALPA 4DKAA 5BS0B 5E9DE 3QUYB 2E27L 3N1QC 1IGIH 4KDTA 1YN6A 3CDGB 1H3GA 5C0AA 5F9JA 1UKQA 1ZE3C 1OP5H 4Q74A 1RZKL 4K55A 2GK0A 4MDJA 3KYAA 3SBWC 1UWXK 1FIGL 2VC2L 3NCEB 3OHXA 2F8OA 3FMGH 4JFOA 1CL7I 4PD4J 1OM3H 1MHPH 1NEZG 1RULH 2NY2B 4KY1L 3RZWA 4I0KA 4YE4L 1XIWB 3VRIB 2R23A 5EU5A 5K9OB 5E95B 1MI5A 3QUMH 5DD6A 5ECJE 2VLJA 1T1WB 4U1KA 3RDTD 3U30B 2Z8VC 3T4AB 2R4RL 5SWZA 5CGTA 4KMLB 1I9RH 1VSCA 2DM3A 4Q6IB 3VXOB 3VW3L 3TH4T 4MXVE 1CLZL 5DRXA 3JUYA 1BFVL 4LCIL 1V8HA 2ILLA 4HC1L 1S8DA 1VHPA 1RJLA 5L8JB 3V5HA 3C5SA 4X4YB 4WI7A 5T1LB 3VWKC 4Y4FC 2E9JA 2D4FA 3UYPA 1KCUL 1T6VN 3Q3GA 2YS4A 1J1OH 5DLMH 3TN0C 3VFOA 1XFPA 3MLVL 4PJBE 4G8EA 2B2XL 1N64L 3CFJA 3EO1B 4WTZG 4HWNA 1TNNA 1FV1B 2AK4A 5F7DB 3D48R 4AL8L 3O2DH 2VNCA 1L7IH 1KCVH 4MJ5B 1TTGA 3DO7A 1RU9L 4MA7H 3RUGB 1I1RA 4N0UE 3VWJC 3ME0A 4OGXH 3VGFA 1A4JA 5ISZD 1EJ6A 4I2XB 5D2NB 5JIPA 1AGBB 1EVUA 2DJSA 1WTGT 3QXAB 2A73B 4GO6B 4I5BB 1ZLVK 4RA3A 3MCKB 2LTQC 2HRLA 4R90H 4OZFH 5DUPL 5I71B 4XTRC 2LABA 1RZGA 3EYQD 4G8FA 3MRKA 3WNMA 1P84J 2X4TA 4P2RE 2G9HA 3FB7B 3SDXB 4DVRL 2CQVA 1D5IL 1V3LA 1H0DA 3PWJA 3VXQB 1BECA 3DX7A 4JFEA 4L9DA 4MXWH 1SMAA 5I18H 1WISA 3VFNB 4HKZA 4Z76B 5HY9B 4ZOAA 3TNMB 1KB5A 4HFUH 4Z7QE 4Y5VC 5JXEA 2DQUL 4BKLB 1OW0C 3LKOB 3LQZB 3RVWD 1MNUL 2W9EH 4UIMB 2K7QA 1XGYH 4CN1A 1FE8H 1FLTX 2ORBL 4TPRL 4WFEE 1J1PH 4JFFE 1UWEH 4NQCB 4I0PB 4Z7UE 1EHAA 1XF5B 2EDWA 2YD5A 5DC0A 2V2XB 2FH6A 2PW2A 2WW8A 2XY1A 3P73B 5EO1A 4OF8A 5D7LD 2X1WL 4Y5VA 1B3JA 5HGHA 2GK0B 4F3FB 2QSCH 3D0LA 5TQ0L 4KVNL 1C16B 2IQ9H 5I1GH 3SOBH 3WNKA 2DKMA 5IW6A 5F97E 2JIXB 3MUGB 3NPSB 4IOFD 4JQVA 2D31A 4DVRH 4NUJA 3QA3B 3X17A 3MRQA 1DE4B 1TJIH 1JGUH 7CGTA 5FAAA 5GSVA 1WBXA 4XPGH 3QJFA 2FSEB 3IFOA 1VGKA 4G9FA 3RGVA 3T0ED 3FO2B 3P4MB 1XT5A 3FO1A 2OLDA 1YPZA 4WUKL 3CSYB 1ORQA 3O9WC 4K8RC 3GBMH 4DTGH 4L3EE 3PG2A 4OFVA 3O0RH 3ZKSD 4P9MH 5I1KL 2ATKA 4LAQH 2N56A 4XCCL 5H94B 3MO1B 4HV8B 1RUAL 1DBJH 4M43H 1GOHA 2PO6D 3KDMB 2FBJH 3UZQA 2X9YA 2O61B 3HMXA 1YDPA 3VG9B 2HLFC 3QIUA 5DTFA 1J8HB 1IKFH 1M6OB 5TFSH 2VSCA 4PJDA 3R0MA 1Z9OA 2CUIA 4FZEL 3G6DL 4DKEL 2KBGA 4P9HC 4KUZL 1F4HA 2YR3A 4S1DC 1GVIA 2VISB 1MLBB 3PF2A 1FHGA 1HHJA 2HG5A 5KVGH 4P4KB 1U3HC 5J56B 2MHAA 4NJAL 1JYWA 3BXNB 5TDPB 5TDOB 1A7BA 3QUKB 2V5MA 4F2MB 5D4QA 3HI5L 1GC1H 4PJAF 3UPRB 1G7JB 4L8SA 2OI9B 3H42L 5GSRB 4YFEA 1WGOA 5F70A 1F6AA 1FNGA 1RULL 4ZS7H 3VMNA 1OQOA 2ITDA 2GY5A 1INDL 4NWTL 3T0WA 3V6ZA 2PTTA 1Z2KA 4Z95H 5A2IH 2YPLA 5LWYH 5HYJB 1F4YL 4JKKA 4JFYB 3OAZH 3TO4B 3EJJX 4JM2A 2DMCA 3MBXH 2XN9E 2AEPL 1I1FB 4XP5L 4GRMB 5FM5O 5L0QC 3TBSA 1OAZH 3LRGA 3C9NB 1DQDL 1YJDC 1KJ3L 2AK1H 3S5LG 4M1GH 5GGTH 4X99B 5I6XC 3I02B 1S3KL 1UM6L 2J1KA 3C08H 1BHGA 3HS0B 3UMTA 2HTLD 4KI5F 3JXAA 5C08B 3WIFB 1XR9B 2Y07L 4Q6IC 2XFXB 5SWQA 3UO1L 1V3MA 4JY4B 1PKOA 3ZKXB 4TSAL 5EIIA 1UC6A 4XPGL 5I8CB 3S6CA 4F80A 2G2RA 5BV7C 1RUKH 1E4KA 1U3JA 4XT1C 2Y6SD 1QRKA 2EIZA 3SDXF 4S2SA 3RPIB 2XKUA 3BD3A 4P4KD 1INQB 5FO8A 2HH0L 3ARGD 3LY6A 4KQ3L 2CDEA 2ZCHL 5T3ZL 4OBRA 1QUNA 3FT4B 4XPTL 5GJTL 4XMPH 5IW1B 4HS8H 1NMCC 4K7PX 4PTUA 2YD9A 1FSKC 2BJML 3F58H 4PJGB 4OCYH 1Q9OB 4S1RH 3RWDA 5E8DL 3KPSA 5IF0A 1E4WH 2ICES 1DQLL 4LHUB 2CR3A 2KQMA 1WWAX 3OB8A 4WENB 5JOFA 4MB5A 5GRZA 1CFQB 1DFBL 5HYEA 1AGDB 1JGEB 2QQKL 3WHXB 4LSSH 4QWWC 3I2CH 4X7CC 2IAMA 3MV7A 3QJHB 5EC1B 4KK9D 4OD2A 4XPFH 4YDVA 3T4YA 5K9JL 5ACZB 3RGVD 4MJIE 3DGGB 3OV6A 4FABH 3G08A 4FQPA 5KSBF 4ZOBA 2XWJA 4FXKA 5ITFB 4IM8A 5LKNA 2IANB 2CMRH 3P9MA 1JFQL 3TM6A 5DSCA 3PGDB 1T83A 1AR1C 1HCFX 1QLRA 5I1AA 4G6JH 3B43A 3LS5H 4PV8A 4PLNC 5B39G 3MV9E 1FGVH 3KHOA 3QPXH 2D9CA 4O2FB 5IIEA 1QKZL 2IQAB 2XA8H 3IAPA 3RTQC 5BOPA 3GRWL 4I13B 4P2QD 5IT2L 3GBNH 4D9RD 3IKCA 1I1AB 2UZIL 1LD9A 3HC3L 2AAVA 1KULA 2Z31A 3HC0A 3CCHB 3LV3B 1EHNA 1NBVH 2OTWA 3SCMB 4ZXBA 3F6LA 3ARFB 4WU7B 3FOLA 2AXGA 4E41E 5CCKH 4R7NB 1FPTH 1MCPH 3L5WA 3CU7A 3Q6FA 5FECA 4JHAL 3BPCB 1FNHA 3BZFB 3I3EA 2ITDB 1ZHNB 4PY8I 3RA7L 1HEZB 1JHKH 1JHLH 1A7PH 3LQAH 4GG8A 5DJ0B 3LAFA 4DGYL 5GISH 4EXPX 1MPAL 1OAUL 4XZUB 5HGHB 4QXUH 4JVUA 1ZEAH 2D9QB 3PGCB 5F7FA 1ZK9A 3IU4L 3T09A 4ESKA 3BQUC 1P4IL 3L1OH 3VDAA 3KLDA 3TVMD 1R3KA 5FGCB 4AIZA 5EU3B 2BSED 5F3BA 5IQ9A 3SQOL 2K1MA 1VFAB 3CVHL 5KS9E 3MJ7B 2NY3B 1S5IL 1JWMA 2FECL 4MVBD 3IDGB 1I75A 4PRDA 4F9LC 1JMXA 1UJ3B 2DN7A 3DBXB 4NM4H 2VXTL 3MBEA 3CSBA 1I8LA 1IRAY 5JQHC 5F9AC 3HZVB 1ZA3A 2EE3A 1BGXH 3PL6C 2C3WA 2J4WH 5C0NC 4WO4C 3RNKA 3VFSA 3ZTJH 5T1DL 1KXVC 1CZ8L 5D2NC 3AREC 5HVGB 3P3YA 4K23L 2H6PA 3X3FL 1OT1A 1JZ3A 4ZAKC 1XF5A 1FVEA 1I8KB 3DMMC 4ZDHB 3BIAX 4KRLB 3LEXB 2PW2B 1FL6B 4ZTOL 3INUH 3U4EA 1A0QH 1R3LB 4HT1L 4GS7B 2Q3AA 3IU4H 4RAHA 3TFKD 2VAAB 2HKFH 3LN5A 3INUL 4L8SC 4OT1H 1F90L 2AEPH 4M6AA 4NO2B 3JWDL 3WIIL 4ALAH 4G3YL 1D5XA 3S96A 4B7LA 1CGYA 3SHSA 5C0CB 4Z7OE 3QQ3A 3KPSD 5GRWA 2NW2A 4UU9B 3TVMB 1XGUB 3MSPA 4UQ3B 1T1WA 4MGXA 4U6XA 5ESVB 4O2EB 1R5VB 4FNLL 5IHBA 4OCSH 4N8VA 3I6GA 5IVOA 4I0PD 1Z3GH 4MJIB 2DKUA 1OAYH 1VEOA 1MCQA 5FYKE 2KH2B 1QYGL 2D7NA 5F6IC 5KVDH 5K9KB 4JM4L 4YHKH 4YGAB 1A7OL 5GS2H 4XI5C 4RWHA 3ARFD 4YC2C 1S9XA 1A6AA 4PJCE 4GBXD 4OZFA 1JGDB 4H0GA 3GSUA 4MAUH 2Y5EA 2QADD 4WJ5A 5K93A 2CXKA 4M43L 2VWEE 2VR4A 3L3DB 4NYLB 4RGND 1OF2B 2PTUA 3IDIB 1EUTA 5IGXL 3ARSA 3KPRE 5D7KD 1BFTA 2Q7YA 4GQPH 2VJXA 3DI2B 2Q6WA 5JORA 4QRUB 1GZPA 1SYVB 3OL2A 5DGQA 2CIKA 2FJHA 5DFWH 1A21A 5JPNA 2EDLA 5KW9L 5TF0A 1E4WL 4ZFZA 1P5UA 1ITCA 1XGRA 4YH6A 4JO4L 4S1RL 2N1KA 2MOVA 5K33A 4GAGH 5DS8A 3OF6D 5IB4A 1DN0B 2UY6A 3MUZ1 4FOMA 4KV5F 4LSPL 4OUUB 2P4AB 4JFQB 4HMCA 4AEHL 1MAJA 3NACH 4OV5A 4HCRA 5KTEH 2ZG1A 4RGNE 1ZLSH 1JTPA 4JJ5B 1FIEA 3L3KB 3EAKA 2F5BH 1S7WB 3DMMB 2M2DA 4FQHA 5FCSH 4U1IA 2AXJA 2DQJH 4KFZC 4WWID 3QDJE 3P0GB 1QR1A 5JMRA 3RWFA 3WFZA 1N0XH 4TSAH 3WUWA 2P8PB 3G9VA 4DW2L 1YN6B 1GCFA 2ZCKL 4LLYA 1YMME 4W4OA 4QRTA 4DUXA 3GFUA 1FFOB 3B4NA 3EOYG 3QPQC 1U8PB 3D0VA 2YWYA 2AS5M 4M1GL 1JGLL 4XB8A 4GLRH 4XP6H 3PWLB 5FF6B 5FYKH 3ZTJG 2OI9C 1Q1JH 3I85A 4LGPB 3VRIA 3BGMB 4PR5B 3VXMA 1MFEL 4IDLA 1FZJB 5GZNC 1MI5B 5DD6B 1U8KB 1GAFL 5FYKU 5C08D 1NGXB 1OGAA 1RVFL 5J3HD 4JGMA 1KG0B 2X4UA 2XTJD 3FB8B 4QTHA 1CZ8H 4C57C 1LE9A 1J5OL 5DO2C 4IRJD 3GEWB 5DMJB 4WV1C 2ADJA 2XZAH 2BFVH 3H3KA 3DX9B 2NY6D 3DVFA 5AZ2H 2JJTC 3RWHB 3ECBA 4GAYA 1B0RB 4LPTA 2P46B 3DUSB 5DHVB 2AEQL 4TUKL 2LFGA 4FQLH 4WNQA 5J6GB 5I6XB 5M94B 4F7PB 5I0DA 5J1SC 3NAAH 5C0CE 1K3ZA 1MCFA 4O2EA 2XA3A 5HYSB 3HNVL 4PP2B 3FRUB 4K2UL 3ES6B 3LCYA 1QVOB 1MCOH 5F72S 2EIZB 2VE6A 4FZEH 3QRGL 3CZJA 5J89A 4L3EB 3LB6C 2GY7B 1WC7B 2HVKB 3IJSA 3S7GA 2FLBT 4NN6C 4P0DA 5DRXB 1NCBL 3ZL4L 4S0TD 1R24B 3O9WB 3X13B 4AEIH 1U8NA 5E8OB 3VD9A 2GITA 4GKNB 4Q9QH 3QEUB 4ETQA 2ERJC 2FLRT 1A7QL 1FZKB 1RIHL 5E2VH 1LO3H 2C1OA 3WN5B 3I6GB 5JW4Q 1H8OA 2EDHA 4WHDA 1FZMB 1NC2B 1KEMH 1T1ZB 2PUQT 4XBPA 3U0TA 1JUFB 4UOW0 5D1XC 5HYSG 1ULVA 2A6KA 4PTTB 4RBPK 5D7IB 5C0AD 4Y1AD 3SE8L 5L2JA 2MQ3A 4K8RL 1IFHL 2V5TA 4EDWL 1T22A 4FXKB 1MRCL 4G42A 2DMBA 1GC1C 2OJEB 4CJ0A 5I19H 1WITA 5IM7B 1NL0L 5E8NA 2IBGA 5TFSL 1AH1A 2FH8A 3I9GH 3LH2L 1I7UB 1VFAA 1OCWH 3QYCA 5JDSA 4P2CG 3QNXB 1M4KA 5DK0B 2XZZA 3N06B 4HUVB 1FP5A 4RFNC 5C0IA 3W5MA 4MZ2A 4ZXBB 3SCMA 2ESVB 3W39B 4X0KB 3PDOB 1TETL 4LCCB 2XNAB 4JREB 3QI9B 3H9SB 2NNAB 1J1PL 3BOVA 1XCQA 2FJGA 2R8SH 5D1ZC 4DVBA 3S98A 4P2RB 4LNRB 1I3GL 2AXFB 3AB0B 1IAII 2K9UA 1ZHLB 1WZ1H 3IXAB 4XP1L 4I3RL 4LPUA 3F5WA 4WDIB 4HFUL 3GHEH 5DJAB 2R56L 3T0AA 2VLKD 1CF8L 5FO9A 4MNQB 5C0EB 1KJ2A 4NBZB 5D1QC 4Z7WF 2RGSA 2Z92B 5FB8B 3BH8A 4HCRL 2WINB 3QUZB 4FRWA 4AIOA 1KLUB 4NFBA 1QLEL 2QKIB 3T1FA 5EWIH 1YNKL 5GRXG 5C0ND 6CGTA 3NACL 2ZNXA 2XQYG 1S9VA 3IXAA 4J3TA 3GJEA 3SE3A 4AENA 1B0GA 4KKBD 1YQVH 3IJHB 4IRZL 1HQRB 2OR7A 4JQXA 4NP4H 1TQCB 4OLYH 5CBAA 5J6HA 2X89A 3PHOB 4BFIA 1VEPA 3MJ9L 4Y4HB 4KTDL 3ZTNL 3CX2A 1F3DH 2JIXA 3MUGA 5MP6H 2MNUA 5E4EC 2NTFB 5HXMA 3E2HC 4PJ5E 2CRYA 5EU6D 4M61B 3IFNH 1D5ZB 2G75B 4OZIB 3C87A 4PG9A 1MI5D 4AMKL 2APXA 4U1HB 3RQ3A 5BOZG 1JNJA 5E2UH 3SE3C 3UC0L 1HQRA 5CBAB 4GKNA 4H88H 4KDWA 5E5MB 4XCYA 4LSDA 1W0VA 4UAOC 1N8ZA 4TVPH 2W0LA 1INDH 4NWTH 4B50A 4G80A 2XQYK 3CC5B 1RZIA 2APVA 4KHTL 5F21B 2X1XR 5IV2B 4H5SA 5EOTA 4X7TA 3QQNA 4IBLT 3C8KB 2XYCA 1K8DA 5KVDL 4JVPA 4R90L 4NHCH 2DYPA 2A6JB 2R4RH 2NY5L 1VFBB 5GS1A 3MGOB 3MA9H 2EE6A 3R4DA 4L3CA 4LPCA 5I8EA 1J88A 3O41B 1LDPH 4FNLH 2DTML 3GMNB 4WEMB 2AABL 5IHUH 4EUPA 4KHTH 1QEWB 2H2SC 4YHNB 1NSNH 1CL7L 3FCTB 3N0PB 4U2YA 5F9WB 1PLGL 1LNUA 1E27A 2CGRH 4M5YL 1U0QA 3VCLB 4DCQA 1N5AA 3HS0A 3RBSA 5I1IH 2F74A 4LFHG 4D0BB 2JCCA 4ZFFA 5GS1C 1EAPB 4G3YH 1A6TB 1OP5K 2E27H 5HVHC 4AEIL 3ZDXE 1OY3B 5I1KH 1IQDA 3BDBA 4OZIF 4OLWH 2NY0B 1IT9H 4NO0B 1A1OB 4PGEB 1AGFA 5IMKA 2FECI 3TA3C 3L3HA 5B8CC 2RJMA 5HHQB 3D69B 2CJUH 4LNRA 4I0PA 1FGNL 4TRPL 5L6YL 4JB9H 1G7LA 2YUXA 2VZSA 2BVQB 3QFDB 4G6KL 4XCFL 3THML 1H9VA 4K7PH 3EOTL 4I48B 4PGDA 3VMOA 4WI9A 2EZ0C 4PJHE 4JZJA 3TV3L 1K5NA 1IARB 1X5YA 1YEIH 3DWTA 4KVNH 3OPZH 4QRRA 1CFNB 1DN0A 2IALA 2X5PA 4OUUA 4OFKA 5FM5M 5GGRB 4R6UA 1F4WL 3ARZA 3BQUA 3STBA 3RHWF 4YXHL 3RWHA 4ZNEA 1JVKA 5DURB 3WD5H 3L1OL 5EBLB 3H2WA 4M3JA 2ADJB 5ELIA 4WI3A 1W2KT 5JW5B 5DMIL 2ORBH 1UACL 5I2IB 3WSQL 1CK0H 4E0RA 2ZCKH 3L5XL 4ODXB 3RIFK 3X3GL 3ET9F 1FYTA 1U8LA 3STZA 4RQQA 3MLXL 3OKMB 1IM9D 4HH9B 4QWWD 5D96B 5DWUL 4GSDL 3NFNA 2XI9A 1DE4A 5CD3B 5KVEL 4PYGA 5IOPA 1NAMB 4NUJB 1K2DB 4R4BA 1NL0H 1VGKB 3LZFH 3CDCA 3KHQA 1DDHA 3WJLA 3QNZA 2Y1VA 5CLTA 4W4NA 4Z7VE 5C07D 1CGUA 5CEYB 3T0EB 4FQXC 3MODL 5ADOH 1TZIA 2Y06H 3U7YH 4GRWB 3FZUD 1F6FB 4Y4FD 4U1JB 4LIQH 3VXRB 3T2PA 2EDQA 3JWDC 3OKKB 2ZSWA 3GHBL 3RVUC 3LPFA 4WW1B 4UV4H 1FNAA 5DFTA 2DWEA 1X7QA 1RK1B 2NR6D 4BQ8A 2JJUA 5ENWB 1UZ8A 1CE6B 1U92B 1PG7H 4OZHB 4NC2B 4WY7H 4X4MA 1SYSB 3OG6B 1I8MA 1KCUH 2DLHA 5CEXB 2XRAH 1H3TA 3JWOL 4LLUB 3IDXH 1T3FB 3QG6B 3MRRA 1BZ7A 4JGUA 4MNGB 1HIML 1XGPB 5JIHA 4LCIH 3KS0H 1WCQA 1S9WB 1HXYB 1NFDB 3EYQC 5CEZL 4AIXA 5C0IB 5HPOA 1CN4A 3D3VD 4R8WL 3AM8C 1I1AD 2H6PB 2V7HA 4G8GD 4UDUB 3V0AC 3ZYIA 5GS0C 5ICYA 3JTSA 3NTCL 1RZJC 4JE4B 4BM7A 1L0YA 2HRPH 1MCSA 1U41A 3IJYB 1NCCL 5EOCJ 1NFDE 5TE4L 4K9EC 3SCMD 2BVTA 1KPVA 2OTPA 4ZFOA 4U6VH 4JO1L 4KK6C 1MRDL 3OG4B 4MAYC 4LK4A 4XPBH 1OTSD 2P8LB 4K3DH 3ARXA 3U6RB 3LQAC 4HZLA 4GJTB 4APQD 2BNQA 4NNPL 1MCCA 3GMQB 1GAFH 1G9EA 1I3RB 2NX5D 4EVNA 4RGNC 4YJZL 1L7TH 1ZA6B 4TVPD 4CGTA 2NW2B 4X6DE 2MKWA 3RX5A 5TF1L 5EU6B 1SVCP 4M7KH 4HAFA 5FUZH 3V0WL 2E9WA 4K71C 1YEGH 3ZYJA 1IEBA 4H8WC 2O5XH 5JNYB 1UYWH 4RQQB 4EDXA 4DW2H 2FO1A 4AT6A 1TZHA 4XVTL 2EDEA 2FX7L 3O6KL 3ARDB 1A6VL 4KKLC 1C5DA 2IG2H 3WLWD 1I3UA 3AY4A 1UWXH 3EJYC 3UCRA 3STLA 4PJDE 4PRIA 3TWCL 4MNQD 1A4KB 4RZCB 3P11H 5A43C 4U6VL 2P8MA 4NT6A 4PJ8C 3EDFA 4PGCB 4HGKC 1DQML 4HQQH 3R06B 5EUKB 1NAMA 3ALWA 1SY6L 4OGYL 3MCG1 3FRUA 3BIKB 3SKOB 5C0CA 2HN7A 5EOCL 1BREA 2AJXL 5I30L 2FZ3B 3KPQA 3B9DA 1TZIB 4ODBD 4M6MH 1W0VB 3NCFB 4YLQT 1LO4H 4NKMA 4N8VB 1FAKT 5FEBA 3T0XA 4WY7L 3NH7H 1FJ1A 4F7EA 5IGXH 2EDTA 1ND0B 1A6WL 3IRPX 1PEWA 2YBRA 4U6HA 1RZJL 1X7QB 1KBGL 4R4BB 3MRNB 4D0CB 1PX3A 1SJHA 3QDMA 1CFSB 3S35H 2NY0C 1IGCL 1AQKH 5DZOA 4LKXB 4QHMB 4O2FA 4I4WB 4D9QD 1JGDA 1CD1B 5FUOH 1BD2D 1NAMH 3QZWA 2FHFA 4XP9L 4LIQL 4NO3A 1MRFL 1NCDL 4UILH 1T3FA 1QFOA 1L6ZA 2DOCA 4RMRA 4CVZA 3OJMB 1J0YA 1MREL 3GRWH 1E27B 2H8PB 4LQ1A 2N7BA 5ICXB 1JF1A 3QIUC 1RHFA 2OSLB 2IADB 5I76B 2V7NA 3PV6A 5FHAH 3GMOA 4XWOD 3BGFC 4MD5B 1NMAH 3S37X 5IMKB 1BLNB 4G5ZL 1SJXA 4JFQA 4MA1B 2A6IA 1NGPL 2ICEA 4YNYA 3QFJD 1WAAF 5EC2B 3GI9L 1DQJB 4LKCB 1KPRB 4V2BA 4L5FH 3RWCA 2ZCLH 4K3EH 5FYJD 1ZVSA 1T4KB 5FYJH 2A1WH 3IVKB 1AC0A 4Q9BA 1IGFH 3O8XA 5IMOB 2XKNB 2HP4A 3QUXA 3CUPB 3MGAA 1J12A 2IF7A 3DV4A 5D8JL 3RIAK 5T33H 3MLZL 1RUQH 4DEPC 5D7LA 2HT2C 3KLHC 3PHQA 4LRNH 4W81A 3I6KB 5FB8A 1CLOH 1KCKA 3EO9H 4J3XA 3JWOC 2FIKA 2ZUVA 1WTLA 3KPRA 1ZA3B 4U1JA 1X5KA 2P47B 2VDNH 3RP1A 5HGDA 2YA2A 3OJDB 4P46C 1D3CA 4WFHE 5IWLC 3T3PF 1UWGH 4E0RB 5DXWA 4XNUL 2Q8AL 4CU8A 5HYIA 4ZAKD 3GJEB 5L2KD 4Q0XL 3CLEH 2XTJB 2IANA 3D85D 4ZDHA 4N8CL 4NZRH 4WTWA 3U9PH 3G08B 2VYRE 3QEQB 1ZGLP 4R97C 1RY7B 1T0NA 1NGYB 2GJ6E 5LG1A 3MBED 2FX9L 5HDOA 5DUML 3O4LE 4GT7A 4NNYB 1MHHA 4LHQB 3W11D 2DF3A 4YK4C 3HNTH 4D9LL 1U8IA 3LPWA 1P1ZB 5A3ID 4MCZA 4OD3L 1WFOA 4MJ6A 2P42B 4WFHD 2X05A 4LSRL 4R26L 3RWJA 1UCTA 5ALCL 2OQJB 4OF3A 5E5MA 4NPYA 2OJEA 1HHGB 2V17H 3OXSB 4ZS7L 1KIQA 4XVJL 3AS2A 2DLFL 3ILPB 4NO5A 2RR3A 1HILB 4JN2A 4NNYA 4JANB 5EBWB 3MRHB 3O3DB 2WZPD 3T8XB 2UYLB 2ITCB 1AJ7L 4BUGA 1HOCB 1L6XA 1GZQA 5DO2D 3RVXC 4GW1B 3KPNB 1BQLL 3SKMB 3NIDF 3GSRA 1A6ZB 2CKBB 5EORL 2YD3A 3GSVA 4M02A 5JR1L 3GBNL 5DDHA 2ZG2A 2X4PA 4EOWH 1YECH 5FGBC 1ZGLA 2VXVH 4CNIA 1K4CA 2MJWA 4R2GD 2GW5A 3UX9B 4OD3H 5D7JC 2ADIA 4BSVB 4MAYB 2B1AH 4TNWF 3CDYA 5IROC 5JW4R 4N9OB 2BNQE 2OTUA 2VC2H 1AGEA 3CXHJ 2ZUQC 2I07B 1T89C 1CG9A 3FQRA 5HVFB 1JJUA 1AXTL 4X6DB 2ZZUT 2ICWB 2UVFA 3HMWL 1HCVA 4P3CH 4XH2A 5F8RC 1A1OA 2ZJSL 2FNBA 3REWB 4NZJA 1RUMH 3ARPA 3LOWA 1EK3A 1ETZA 3CLEL 3FQNB 3ILQD 4YDJB 3WIFA 1GJIA 3TA3D 4K71B 4QHKI 3UJTH 5GQBA 4KZDL 4FQ1H 5D7LB 3EFDL 3VA6A 3QIBC 3T3PE 4IRZH 4NP4L 4ELMB 1IGJA 2EH8H 1W0WB 1QBLL 3X12A 1U91B 1JGUL 2BNQD 1S7SB 2MQCA 3MREB 1FC2D 1S7WA 1YEHL 2NXYC 5C9JA 2D03L 3VXTA 3FB8A 1RIUH 5E7BA 3U79A 1FVDA 4ZSOE 1J0JA 1G9NH 4NQCD 1K6QL 4DKDC 1ZVSB 1DQQB 1T1XA 5L2KB 1KJ2B 4BFGA 3DURB 2HT3D 4KTEL 3EW3B 2LU4A 3MV9A 2GQHA 3OQ3B 3GI8H 4HIIB 4MS8C 4LEXH 5IF0B 2OR8A 2FB4L 3O3BA 4PRID 2AQ1A 4OZHE 4IRJB 4XPAH 1W72H 4PLOB 4PJCA 3C08L 3KYOB 3AROA 4U7MA 3BPNB 5DD1L 2IMNA 3MROA 5BZWB 3T3MF 4DFIA 4N0FA 1RZ8B 2PYED 3RY4A 1JL8A 2XTJC 4HIJB 2V2WA 1CE1L 4WFFD 1WAAE 4I4WA 3G5VA 3WNPA 2DIBA 3UJJL 1TDQA 5IQ7L 3KR3H 3PNWA 1YPZB 1QLFA 3ZE2F 3RDTA 3AS1A 4PGCA 1AHWA 2A74B 2IAND 1ORQB 2P49B 1JNLL 1YEHH 5I18L 4GKOA 1MCNA 1IAIL 3DETD 4NN6B 1BVLA 1DBML 5C71A 4LVEA 3NA9L 4RFEB 4BH7A 3QCVH 4AM0B 5DHVA 4Z7NE 3TPUA 1SJEB 3HA0A 1TQBB 3HI5H 2R2EA 3UJIH 2VABA 1QBMH 2WUBL 2X4RB 5IBUB 4PS4H 2JB5L 2R15A 1FH5H 1M7DA 1YEJL 2IGFL 4D0CA 1OAQL 3VGGA 4JM2B 1ZGLM 3OKDA 5IR1A 4KUZH 2VE6B 5CP7A 3A6OA 2OP4H 3QDMD 4P5MA 4LMQE 3HTLX 5C0GB 5FO7A 1BD2B 5B39A 4YHOH 4QT5A 4ZG1A 1NUGA 2E7MA 1MQKL 1U93B 1J05B 4NC1E 1TVDA 2GSIA 2HFGL 2JKXA 5D1QA 3QG7H 5T5NF 5TDPA 5LAXA 5MHSE 4MCYB 3FQWB 4WUUA 5DD0H 4DN3L 3C8DA 4ZO6A 3HRZA 4OCXL 3MRRB 4KKCD 1W72B 3IDJB 4ZPVB 3SDCD 2X1OA 4RGMC 5JIIA 4KJPC 3CXDL 3RL1A 1H5BA 4O4YL 3LIZH 1JPTL 1IJ9A 3L3DA 4NYLA 5F1KC 1I85A 3CFKB 5J1AB 3BWAA 3QISA 1MIMH 4JRXE 3M1BB 1RZGB 1F11B 1OHQA 4NKOB 4C4KT 4ZQKB 3REVB 4XVJH 2EXWD 1NGZA 1TJGL 1ZHBA 3MA7B 5ESAB 4EEEA 4HKBB 4P2YA 3O81A 4NRYB 2J8UA 4GXUM 1TITA 4ZPVA 1T2XA 4FQXD 5C3TA 2EDFA 4NQSB 1TPXB 3HN3A 2JELL 3FL7A 4JPKH 2CRIA 2R69H 2X4OB 4JKPH 2CO6B 3LEVH 1SY6A 3HMXH 8CGTA 3Q1SL 1C7TA 3DARA 4FXGB 5T3XH 1KG0A 4ZPTA 1IILE 3OX8B 3MOBH 1WICA 5GGSB 3SDAC 3G6JE 2HT3C 1WF5A 1R3IH 4OLXH 4JFHE 5ETUA 4NOBA 3LEXA 2X9XA 2RAMA 4M1CC 1U95B 2EH7L 1DTUA 3Q1SH 1JWSB 5DA4A 3BKCH 5F1NB 2Q8AH 2NQCA 1SHMA 1ERNA 25C8H 2H9GA 4FG6C 5D1XD 1L0QA 1WFNA 1HH6B 4P5KA 5D6DA 4JFPA 5EUOF 3KXFE 3WUZA 5KJRH 3HCVB 1JNHA 1NBQA 1U3YA 2C3XA 1WC7A 4XC3H 1C5DB 4POYA 4HK3J 1T2QL 2AQ3A 3EIFA 4EN3A 3LKQB 5EUKA 1JK8A 3BGMA 3TJHC 5JTWA 5I1CL 2B5IB 5T1KD 4JR9L 4O4YH 2Q7NA 4KPHH 3HI1B 1WBYA 5T3ZD 4FFWD 5D71L 1HIMH 4OKVA 3IFOB 3RGVB 2Q8BL 4G9FE 3GUTB 5BVJA 3MROB 2CRZA 1ZOXA 4Z8FL 1CE6A 1QFWL 1U92A 2MCPH 4Y4HD 1HI6B 1NEZB 1LWRA 4TUJA 3B9AA 3PXJA 4MQXC 3G6JA 1YJDL 3VFWA 3MV8D 3RVTD 3EZ8A 4MWFA 2D0FA 4BQCA 5GHWL 5HJ3B 3HI1A 3QIBB 2E7BA 1U93A 4HDIA 2BRRL 4M4RA 4JFFD 4AIZB 4QT5B 4QHUA 1P9MA 3MRKB 4YBQC 4F57L 4O58H 2AXGB 3WKNA 4LCCC 3VD7A 3VRJA 3JTSB 3D85B 3OGOE 5I15L 3VFWB 4E5XB 4OM0L 9CGTA 3RRQA 4NCC2 1QSEE 3E3QE 4Y5YC 1DP0A 4MWFB 5JPNB 3PXHA 3VXPB 5DJ0A 2H2PD 3ARDD 5FV2A 3B3IB 4GAFB 3RUGA 1QFHA 4GG8B 2AV1A 2B4CC 4G8GA 3VI4E 2EYSA 2IPKB 5F7EH 1Z3GL 1R3HA 4UT9H 4D3CH 5L7XH 5C0GA 1SYSA 3RDTC 4YDJA 4MXQC 4QNPE 4PLJC 5CSZA 5FXCH 1QEWA 1FL6A 3ARBD 1QRNB 4NN5B 4NO0D 1QG3A 1RMFH 1X4ZA 5BQ7A 3V52L 3C6LA 3MRDB 4MB3A 3BKCL 2GJJA 4W4OC 2P44B 2V2WB 1C7SA 4JDVB 4PJFF 1Q0YH 4M8QA 1H8SA 5JNYA 3FOMA 1ZANH 2DQEH 4OTXH 5HGAA 4YXLH 1I8IB 4M1DL 2MTPA 3X11B 1IKNA 5MENB 4OT1L 2FBOJ 3I02A 4K7PY 2X6MA 4I3GA 3G6JF 5HHQA 1EH9A 5ITBL 5D1XB 2A38A 3K3QA 4A6YL 4YHYC 1AGFB 4J4PA 3FB5A 5HHPB 1AI1L 5A40E 2WQ8A 3BP6B 3CFCL 5D5ME 1G9NL 2B20A 1S78C 4JZOA 2NZIA 4AH2A 5ILTL 4PGDB 3F7VB 2H2PC 3GIVB 3NA4A 1I1YB 3MYJA 3FQUB 1AO7A 3G5ZB 3ALXA 1P7HL 4NO2A 3QZWG 5IG7B 4NZDA 1U2HA 3GO1H 3MNWB 5IW1A 3CFCH 5CD3A 4N0CC 3UZEA 4YO0A 2CDEB 3V4UH 1H5BC 5I8KH 4FFVD 5TF1H 4G8IA 1WZMA 2HJLB 1MHCA 3SE4C 1RI8A 2R2BA 2VXQL 4OZIE 4DN3H 1XGUA 5D1ZB 3U4BH 2UUDH 3T1FB 1H3WM 4JEGB 3OR6B 4XNYL 3WNLA 5CJQL 3Q6GH 2QADB 1LK3L 3L3GA 2DYPB 4JRYB 5I8OL 2ICCA 4QRPD 2XWTA 1YA5A 2F54D 1T21A 1YNLL 1LP9B 1CGSL 1EX0A 3AB0C 3GMNA 2EDJA 4WW1A 5J12B 1A3QA 4GAJH 1KC5L 3WIHH 3PUCA 1CVRA 5JR1H 3V0VA 3LKNB 1DEEB 3V8OA 3ZHLA 3VDCA 1BD2A 2VLKE 2CIIA 4AY0A 4GQ9H 2BSSA 1JZ7A 4UV7H 2WUBH 4U1NA 3SKMA 5EBWA 1QSFB 4Z0BH 5CP7B 1GGTA 3TJEL 1HOCA 3CK0L 4MJID 2EDBA 4G9FD 5CEYA 3T0EA 3IDXL 4RAUA 1G7IB 3A0OA 3FO0L 5FOBB 5EIVA 5IFJA 4XVUD 4LSRH 1KCLA 5CEZE 4XXDA 1WBZB 3BZFA 5ALBH 2DQTL 3QQ9C 5CWSB 5E9DD 2EDRA 4JRXB 3Q6FB 4LRIC 5E2UL 5FECB 4XBEH 3QUKA 4F2MA 2ICWI 4HG4K 3DX8B 2KZWA 4YHZH 3WFEH 5E94B 3RKDC 2EC8A 4PBVC 1G7HB 4KQ4H 1HHJB 5EZOH 3MRCA 2OBGA 4PJIB 4RRPA 4WI4A 1P2CB 2HFFB 3ISWA 3QH3B 3T3ME 4O2CA 2YKLH 2NX5B 1FAIL 2A6IB 5F7KC 1JUFA 4QLRA 4Y2OA 4PLKD 3TO2B 3PV6B 3HG1D 4OZGE 5C0DA 1A9EA 1JPFB 5IFAH 4YX2H 1KJ2L 2GUOB 3OKOB 1G6RH 4DN4H 4KTEH 2XN9A 1V7NL 2IFFH 5CGYD 3VA2C 3OJDA 2XKNA 1BIHA 4GFTB 1FO0B 2VDNL 3BX7C 3QUXB 4PBWD 4RBPH 1UB5B 4HUXB 4RGNB 2OZ4L 4X9BA 4H1LA 5C0EA 4NZTL 5EZJB 4P48A 2Y23A 4Z7WE 5F9WC 5DK0A 2G5BA 5C9JB 3E1F1 1CFQA 3MNWA 3QHFL 2F54B 3P4MA 4JPVH 4Z7VA 3HZYB 3PIQA 3N1GC 5C9KA 3ULVL 1P6AB 1XCQB 5EB9A 4KRPB 2VLKB 3B6SB 4RFOH 3U0PA 1MCHA 1W72L 4YHIB 5BS0E 1U8OA 4ONFH 3WD5L 5IW3A 1PKQB 5C0RL 3HUJB 3QAZC 1OQXA 1D5ZA 4ZUSA 5T3XL 4R0LB 4KJWC 4JRYA 5KSAC 1F45A 1F4XH 1I1AC 3EYSL 4OM1H 3MBEC 4Y19E 4HUWA 1NMAL 2BP3A 4CL7A 2VZ1A 1T0PB 1F58H 1JRHI 1LGVA 1KLUA 4U49A 1E4XI 4NNXB 2AK4D 5FA4B 4J8RA 3HG1A 4D8PB 4MHHI 1AO7E 4N8VG 2O61A 5JOFB 3V0VB 1WCBB 2GITB 3C5SB 1HYSD 4EIGB 3QHTC 5GSVB 4MJ6B 4X7DC 4ZMAT 3MRQB 4R4ND 1HHKB 1JHTA 3OKNB 4S1SL 4YUEH 3BPOB 4YDKH 3LS4H 2FATH 3FQTB 4HKXB 3U9UA 4NQVA 3U46B 1KLGB 2MFNA 4JAMA 4X4XA 2GFBA 5EOQH 5I75B 4G6AD 1IT9L 1K8DB 2D7PA 3T8XA 4JZNA 3G5YA 4N9GA 5HYFA 4WFED 2L7JA 4GW1A 1XMWA 1D7FA 2PR4L 2W60B 1KIQB 4ZS6C 1P7KB 5CFHA 1HHIB 2IADA 2HKHL 4JN2B 2C4FT 4K3JL 2QR0A 5D7LE 4OJFL 5DJ2A 4QOKD 3HZMA 1F2QA 4AG4L 5GIRA 5HHVL 5D1XA 2ZUYA 4YBQD 3L7EA 1G9MH 4Z6AT 3GMPB 4PPTA 5IM7A 4QXTB 4P5TB 4XNYH 2P5ED 4N0YL 1RZ7H 2AJVL 2XG5A 4CADB 5JHLL 2EIBA 4P46A 1A3RL 3FQUA 3RL2A 4D9QE 2BY0A 1NBZB 1SY6H 2IFGA 4KVCH 1P5VA 2EICA 3VD3A 2I9LA 3REVA 4OIIH 1SEBA 1XCTB 1ZTXL 2EKJA 5IJKC 5DVLA 1IC5L 1MFAL 2FGWH 2R1XB 2CDFA 3SCMC 2R4SL 4GXVL 4WU5B 2UZYB 2YD6A 5F89B 4L4VD 2I5YL 4P2OA 1KFAL 2IWGA 4NQDB 3WJJA 2M8XA 2YUWA 3NZHH 2FIKB 1KXQE 1QOKA 5KSUB 5EU7E 4ODTL 4IIQB 3WFDH 4GW5A 4F3FA 5HDQH 2ATPB 3OAYK 3P9WB 3L95A 3QULB 3D39A 1F5WA 1CTNA 1OGAD 5C0RH 2DDQL 4ENEC 4NT6B 1I1CA 5D1ZD 4KMTL 2NYYC 4HMDA 1XH3B 1NAKH 4LSVL 2GSGB 4NDMA 2G60L 5CMAB 1P4BL 2RBLA 3EFFB 3BI9X 3GI9H 3DROB 4JRWA 4MD4A 3VU2A 4HKJA 1NGPH 5KN5A 1IGYA 2IAMD 3MV7D 3R8BB 1LVEA 1Y18B 4FXLA 1LO0H 3BEWA 4R97B 3CDGA 1MJJB 5D7SH 2DQTH 3VFVB 2J3SA 5F7MC 5GGUB 4NKIH 5HHXL 1A22B 3ZDYE 3KJ4B 4LLWA 3MOAL 5IROA 4MHHG 4UI2A 5EA0H 5J6GA 2W0KA 4KV5E 4C56A 1YY9D 5CEZH 4F7EB 2WQRA 4PRNA 3S37L 2AGJL 4BQ6A 3QUMB 3CZFA 1V7NH 3C6LD 1Y18A 3CU1A 4FTVE 1FL5A 3PGFL 4Z5RB 1DUZB 2CK0H 4C59B 2AEWA 3PP4H 5I2IA 3MV11 1NMCB 3QZWB 3FTGB 1NJ9B 4JCMA 2HTLC 1YMMA 4MS8D 1NGWA 4G9DB 1LEIA 3V9FA 4KQ4L 2BRRH 2YUZA 1DLHB 1KT2B 1L7IL 3GHBH 8FABA 4JLRA 3G04B 3BPLC 4MD0B 4HIHB 3D39D 5DT1H 3F7YB 3MNVB 1N64H 4ZAKB 4QY8A 5E24E 3LDBC 3HZKB 4FQXB 4LASH 3VFRB 1WFUA 1QFWH 1HHKA 5JW4N 4UIKL 1BVKA 3FO0H 1MRCH 5F7HA 5JOPE 4Y5XA 2ZP0T 4XHQA 4AJ0A 2W0FA 2X44D 2V5SA 1BQUA 3P77B 4P59H 4NJ9L 2GKIA 3TJEH 4HD9A 1A1MB 1NCDH 2GEEA 5C07B 2YA0A 3V6OA 3AXLA 1NANH 1A9BA 5JOEA 2V17L 2D7QA 2EDDA 1DBAL 2Q7YB 2XZCH 3VFOB 4R2GB 1JPST 3NIGE 4NQED 5ETUB 3EO1A 1AD9A 2X70A 4G6AC 1X4YA 2D7OA 3QUYC 1YNLH 4UDTA 5TJWK 1C1EH 3TPKA 5IB1B 3E3QC 1MHPL 5AEAA 4ODHH 3WSQH 1QFWI 4NQDA 4RMQA 2VLLB 1E6OH 3TA3A 1IEAA 3V0WH 2VDRH 5E6YA 5B8CA 4I48A 3FQRB 4M6ML 5EO9B 5E99H 4KU1A 1NGXA 4A6YH 5ID0B 2BVQA 1ACYH 2APWA 4WIQA 1TJHL 4JHWL 2JK5B 1NFIA 5DMKB 1PFCA 1B4JH 5EIQA 1N6VA 1D6EB 1KYOJ 3P9LA 1T2JA 2LV4A 2ZSVB 1S7XA 4X98B 4QEGA 5T1DH 1G1YA 3KPRD 5D7KE 4CKVX 4XNUH 2VLJB 5DHYA 5FYJE 3PWUB 4KUCF 1BD2E 3LN4B 4RAVA 4LCWD 3RPKA 5D93C 3L5JA 2R29L 3G6AB 4CUCA 3CVIH 1H8NA 3C60A 4JB9L 1RZFL 4YQXH 4N0CD 5C0AB 2J2ZA 4U31A 5KS9F 2H26A 1LEKA 5MEQB 2IAMB 3MV7B 1HHIA 1F13A 2W9LA 3V4VL 5CP3H 3EO0A 4X9HA 2PN5A 4X8JA 4PJ5A 5IBTL 2Q76B 3QDHA 4X4ZA 3GSNL 5DZLA 1DJSA 3WIHA 4OM0H 1YN7B 2A2QT 3CMGA 3UPAA 2B1HH 2CXGA 4PRIE 3U36B 1IEHA 4V1DA 1AQDB 3AFLA 4M61A 4Z7UB 4TN9A 3MRHA 3O3DA 4NNPH 4X7SL 4NQCE 3DNKA 1M7DB 1FC1A 3QFJB 5IIEB 3DV6A 3TEUA 4CVXA 5K59E 3KXFA 5I1DA 2JJSC 3R1GH 1D9KA 5F93C 3Q0HA 1ZSDB 3ARGA 1IVLA 5FCUL 2DM7A 3GGWA 1FPTL 1MCPL 3ESUF 4JO1H 3ZE0E 4KHXL 5CAYB 4P4RA 1NBVL 4KK5C 5TE4H 1HDMB 4Z78B 3SGKA 1MCRA 3PP4L 1JWUA 3V95A 4XWGH 1AGEB 1MREH 1BF8A 2PNDA 4PB0H 5DJZB 3WCYA 3WLWC 3GSXB 5FKAA 4JY5H 1ZT1A 4HS6B 3RHWK 4Z7VF 1JNNL 3ARRA 1I7ZB 3MRMB 1MRFH 3S8WA 5KSAB 1J18A 5E8PA 5DJ8B 4DZ8A 4QGTA 3MNZB 3NPZB 5IFJB 3OGCB 3RWIB 3QCUH 5IVNA 4NRXB 4XBGA 2IC2A 4P2RA 5E2JA 4CBPA 3P0VL 3IDMB 3ZE0F 4CW1B 2JLLA 3GIZH 1FG9C 4PGBA 3V8CA 2FEDD 4UV4L 3L9RA 1VFUA 4XXCC 2NY6C 5FCUH 3O6FD 3L5XH 2QQKH 2BVPA 4APQB 4CMHB 3QXWA 5FO9B 3I75B 1PYWB 3VXTB 5HSFA 3QNXA 1AE6L 4GOSA 2GIYA 2EO9A 3GI8L 5IEKA 3HC4H 4K3HA 4ZO9A 1G9MC 3C5ZC 2GUOA 3OKOA 2VDRL 2NNAA 1C5CH 5AWNL 3DVIA 4RAVB 1PSKL 3MRLA 2DI8A 1UH2A 1HHHA 3SDXE 4X0KA 1OTTC 3CMOL 5E4EB 4PJHF 4YBLB 5MEPA 2HJLA 4FQ2L 3MXVH 4OB5L 2WMPA 1BWMA 4L3AA 4QF1A 1QBLH 4MA8L 1OTUC 2R29H 3K2MC 3GHEL 2J5LB 2HFEB 5B3NA 5CUSH 5EN2B 5A2LH 3UTTA 3VWKB 5ERWB 5HGDB 3ULVF 1IAIM 2EIEA 4HHAB 2EH7H 1A3RH 1L7TL 2HJKB 4FFZL 4ZTOH 4XCYB 5E5UB 4P5TC 3IJSB 3HE6D 3FJTA 1AE6H 4K07A 1RZ7L 2LAGB 2IAMC 4M6NL 3CH1B 3V6FB 5ID1B 3O3UN 1TTFA 4M93C 2OL3L 4JFZL 3TGXA 1FFRA 3I6KA 5E2WH 3QIBD 3IFLL 4C83B 4L4TD 1AIFB 3D2UB 3C8KA 4JPKL 1GHFL 4ODHL 3BIKA 4MLIA 3RX8A 3H6JA 3DXAD 4JGJA 3ILQC 5DD3L 4JFXB 5LXGL 5C07A 2YMXH 4V1DE 4NN7C 1IC7H 4JKLA 3DI3B 5F7NC 2F9BT 3OKYA 4HBCH 1LEKB 3QI9C 3WO3B 3MA9L 1TJGH 5H94A 5EZIH 3JBG7 4K3GA 3SQOH 1T5WA 2Z31C 1NFKA 3RY6C 5J8OA 1TZGH 3O2VL 5TE6H 3BW9B 4Z7UA 2ICEB 4YNYB 3P2TA 5GS3A 3FN0H 4YZFE 1FYTD 3UBXA 1CBVL 3WDHA 4ZYKA 2ZPKL 4R4FH 4UIKH 4Y19D 4HWBH 1I1FA 4JN1H 3KYKH 2F53D 4PRHB 1T6WA 2DQFB 1RZIB 1CGWA 2VR9A 3QEUA 4MYWB 1CD9B 4O58L 5D5MA 3WS6A 3TNMA 5HI4D 1JV5B 4NPYB 2L4OA 4F7TB 1CL7H 3W9EA 2ESVD 1JYNA 3C6LB 3S3SA 1N0LA 3GBML 3H9SA 3OAUH 1MLCB 4H8WH 4Y4KB 2AJYH 3D1MC 4XPAL 3MRPA 2X70B 5T5FL 1MEXH 3MODH 1Q9KB 4PJEF 1QFUL 1BEYL 4PJ7F 2O5YL 3B9KA 5D71H 4QTIH 2YD1A 3VFUB 4MZ3A 1FFOA 2YPLE 4LVHB 5DMKA 2CLVB 5GS0D 3NZHL 5E08L 4F9PC 5C6PB 1T2QH 3HPJA 4XAKE 1MCJA 1ZS8B 1JE6A 2DTSA 3N1MC 1LQSR 3UTSB 1UVQB 4JO3H 3ARBB 2Z92A 1GGBL 4V1DB 4UOJA 3EBAA 5DRNB 4PV9B 3FOMB 1ZAGA 1N7ML 3SY0A 5FDWA 4PJ9D 1AR1D 2XQBH 5J4MA 4WWKD 5I8CA 5F88B 2OS7A 4HSQA 1KELH 4Z7UF 5EPMA 4M48L 1HK6A 1KJ2H 1BEYH 4GBXB 1S7XB 4X98A 3MJ6A 4AZ8A 4X80H 3S34H 3L95B 1NAKL 2J5LC 4LSVH 1I9EA 4TULL 4R96A 1JZ4A 1RJYA 2FB4H 4EVNB 1ZHLA 2AI0L 3FN9A 2V2TA 3AU1B 1IEBB 1J0HA 4Z7QF 3TA3B 5B8CB 4EN3D 4QHLA 3LRSA 3C60B 4G6MH 2CO7B 3OPZL 4LQFL 1QFWM 2FIRT 5B4MD 5K9QG 1E6OL 1T7ZA 3CSGA 1K6QH 3WJJC 3HFML 2IH1A 4Z77A 4OFDA 3ARFC 1MWAH 3FRPA 3BD4A 2NLJA 1TQCC 1G1CA 2PR4H 3FQXA 1WZKA 5IMLA 4G6KH 3P9LB 2XZCL 4U6XB 4XCFH 2VZTA 4PD4K 3QI9D 4LLWB 2ZSVA 1OTSC 1FGNH 1YY8A 3BPNC 4ZO8A 4N1HB 1U8NB 4QRPB 4APQC 4JFPB 4LLAA 4CMHC 1VERA 2FATL 4P4KA 2Z8WC 1S3KH 1FYTB 3C5ZA 3K2UH 4LU5H 1TPXC 2O26U 3LHPH 2GK2A 4JFFA 1HXMB 5B22A 3UTQB 3U0TB 5SWZB 4RRPG 3EJZD 5TDNB 1TVHB 2CR6A 1A7QH 1K2DA 3BKMH 5I1HL 2QBWA 3QG7L 3SJVA 4WJ5B 2OL3A 1S78D 4FQJL 1XGPA 2W91A 4HIHA 4KK5D 5J11C 4JLRB 1F4XL 2M1KA 2F54E 1CR9H 3ROLB 2GFBB 4WW2B 2HKHH 2WWKO 3ARED 3H42H 2G9HB 2ADFL 3FB7A 2YPVH 4F33A 4JY6B 4MQSB 2NY0D 4MCYA 3ZYOA 4R3SB 4P46D 3VD5A 1TVHA 5H8DA 1XGTA 3PWPB 3TJHD 2W0FB 2QSQA 4EDWH 3M07A 4AQOA 1BJMA 4HLZG 1EMTH 5D6CA 4P5TA 1B2WL 4HS3A 4LPVA 4S11A 5INDB 3KNBA 2A9ML 2VDPL 1YEKL 4LSTL 4OF6A 3TLRA 5DMYA 5JW4M 4RMSA 2I24N 5M7QA 1CDUA 4NKDB 3LKRB 5GIRB 1EZVX 3M8OH 4NKOA 2EYRA 4P57B 1A4JB 2CLVA 3P4LA 3O45A 4P5MB 1QFPA 3ARBC 2XZAL 5FKPA 2AJUH 2JB6B 2X1PA 3FMGL 5DQDL 1I3RA 5CJOH 32C2B 1JBJA 5F96L 4FMFA 1ZA6A 4P2OD 4GG6B 1NCNA 4ORGA 4Q9QL 3KYOA 1KJMA 2X4OA 4WUUB 5DYOB 4LLMA 3LKRA 1DVFC 2FEEL 1NANI 2QSVA 1UJ3A 1HSAA 3D0LB 4U1IB 3O6FB 1JWMB 5JORB 3VGEA 5BW7A 1HSBB 5DI8A 2D3VA 1OSZA 3MV8B 2HLFD 2XWBB 2J88H 1J8HE 2X7LB 4PJ8B 5CZXC 4D0DB 5GGSA 3CAFA 1P4LA 3UTSD 1TNMA 3M1BA 4NCDA 4OLYL 4GW5B 2PO6B 5FYJL 3D39B 5FF6A 1NGZB 5EU4B 4GBXC 1T7YA 3ZO0A 1Z0MA 2DQJL 5SWZE 3NFSL 2XQBL 1UWGL 1AKJA 3B9EA 5AZ2L 5DEFA 4X5XB 4HWEH 3GMQA 2JJTA 1V7ML 5JMOC 5D2LE 1F3JB 1ADQL 2D03H 4HW6A 3RWGA 1IQWH 1CLCA 4MD4B 3ELAT 4P23C 3EDEA 1U58B 3V4PL 3BE1L 1R5IA 2WIIB 4Y1AB 3HG1B 1S7RA 5L8KB 2H41A 5KOVC 2A74A 2R23B 5ANMB 3RTQA 1RUQL 3BQUB 4H1LH 4QRPA 1KEGH 1MFEH 3HZYA 3CK0H 3PNWB 4PJ7E 3S5LB 3EOBB 3SGDH 1U2CA 2VLJE 4PJEE 1F8TL 2VIRB 4OZGF 3PWPD 3KPPA 3DRQB 4B7IA 1LEGB 4MX7A 3VI3F 2UZXB 4CVWA 3F7PC 1BMGA 3BZEA 4OFPA 5BS0A 3BD5A 3RIAF 4DOHB 5J11B 1K9TA 4YIQB 5AYUL 2IJ0C 1EO8L 5FYLD 1N0XL 4DKFH 2QJDA 1CGSH 1GZPB 1SYVA 2D7TH 1JZ5A 5C0BE 5ISZA 5IVXE 5BRZA 4U0RB 5GHWH 3QCTL 2NLJB 2AJZA 3EYFB 5IJVA 2VAJA 4UB0L 3NFPA 5I0ZA 5FA4A 5CJQH 4TVSa 4LPYA 4C54A 2B1HL 2Y5TA 3H7LA 3R0NA 1YECL 1XAUA 4YZFF 1ZT1B 4HS6A 4PUBL 2IQAA 2GT9B 3U46A 1M71A 5D70L 5C6TH 4IOIA 5EOQL 5GJSH 4LHUG 1TZGL 1JIBA 1UH4A 2NW3A 1LO2H 1EV2E 4OCSL 4UBDC 4NQVB 5D72L 5E6ID 4G6FD 4LLQA 1QBAA 4OCRH 5DMGC 3NZ8A 4F9LA 1EEZA 3RKPA 4KROC 5GRUL 5JDJA 1LO3L 5MENE 4KJWD 5DJ2B 1RIHH 1K4DA 3ARFA 5J1AA 3PJSA 4XX1E 3SDDA 5E00A 4WHYH 2ZKHL 4N5ED 4XCNA 3ZE1E 2Y7QB 3WS3A 3JWDH 1N26A 3WIIH 4ALAL 1F58L 3SGKC 3JV4B 4HFWB 4ELKB 3I75A 1AI1H 1GIGH 1Q9KA 3IFLH 4APQA 5EULV 3MRIA 3RZCA 3LPGA 1CIDA 2NTSP 4TSCL 5IHZB 3QDGB 1DQLH 2AJSH 3IF1A 4U05A 4EXKA 3J8F7 2VERN 3H3BC 3VFUA 4F37F 2QLVB 1MFBH 3GNMH 4U1MA 4WUUE 1A7RL 5FGBA 5CINH 1ACYL 5JW3H 3CX5J 3X3FH 4OCWL 3ULVE 1IGJB 4D9RE 3ROOA 1KCSL 5CP3A 5EBLA 3K1KC 5M95B 1CXHA 2PXYD 5F1SA 4WWKA 1RUKL 5BJTB 1MFCH 2EDXA 4NRZB 5CKAA 1FG2B 1FIGH 3TBWB 3SDCA 4PRAB 3QWOB 4LFHD 1T66C 4XAWL 5D5MF 5DFVC 3WO4B 5CEZD 5T1KA 3MLZH 2DICA 5LCVH 2DS4A 4N0UB 2YPKA 1G6RL 4XNZC 4Y89A 3B83A 4HIIA 4KKNA 1WCBA 1LEGA 1FL3B 4NRZA 2DM2A 3A67L 4M9PA 4M4PA 3W5NA 1XGQA 4HJJL 1IGFL 2K3TA 3QIUD 4NQEA 5J1TC 4XRCB 2XY2A 4PJFE 4X6EB 3EDDA 4AH2B 1GZQB 1G9NC 4U1HA 5KSAD 1JF6A 1RZ8A 4Z95L 4PJ7A 1QA9B 1E4JA 4NQDD 4ONHB 4DEPB 5EZOL 1S9KC 5JUEH 4IMLB 3VXMD 4ISVB 1R3JA 1RMFL 4PP1C 5CCKL 4NM4L 5AUMA 2BX5A 4FP8H 4ODUB 2WIMA 4NJAH 2APBA 3CFEA 1U8IB 3SO3C 4Q2ZA 1LK2A 3SGJC 1TCRB 2CK0L 2X4QB 1OPGH 4PS4L 3OKLB 1NCAH 3BJ91 3SE9H 1DZBA 3IGAB 2PXYA 3WFBH 2BSSB 5DRZA 3G6DH 1Y0LB 5CHNA 2AGJH 3ZT6A 4LCWA 4UB0H 4X6DA 5LQBL 3OF6A 3VFPA 5I15H 1MPAH 1IAIH 3IKKA 5CLWA 1IGCH 5F6IB 3WXWH 4U6YB 2FBJL 1FCGA 2FYYB 3ZHDA 3MLSL 1G7JA 4GAJL 1NCUA 3F65A 4N1EA 3UC0H 2DLTA 4PIRF 5C0BD 3I2CL 3RWCB 2C1PA 1PEZA 5DK2A 1CICC 3TBSB 5E8PB 5K59F 5C09A 4PJ5D 32C2A 1WWWX 2WK2A 2Y5TB 1EFXB 4WEBL 4YHPB 1H0DB 2VLLA 1CICD 3TO2A 4PJIA 5ESQA 3F7VA 3H9SE 4HPOL 4PRHE 2NX5A 2UZIH 2R1WB 3H9ZA 4JG0H 3OR7A 2F5AH 5SWQB 3H0TA 1D9KD 2H8PA 5BRZD 4I9WD 3U0WL 2NZ9C 2IMMA 2NY4D 4ODTH 5TE7L 1SBSH 3AAZA 3UPRA 2YD2A 5ICZA 1YNKH 3FZUC 5GSRA 5C0JA 3C5ZD 3U30C 4RWYL 3LKOA 3SOBL 3GM8A 4Y2DD 4L1HA 2IEPA 1JN6B 3GSOB 5TQ0H 1RZFH 3LB6D 1RFDL 4IHOA 2N4IA 4KK6D 2R4SH 4NIKB 4MX7B 2EH8L 5EUOE 3O6KH 4JZOB 4I18C 5D1ZA 4YAQB 4XNZB 2V2XA 4IS6B 2Y07H 3KLSA 1DQJA 2YRPA 2LE9A 4GRWF 4Y19B 4KI5E 2IPTL 3BEVB 4FXGA 4UAOB 2R8SL 3V5KB 1DLFH 1ZXQA 3R8QA 1NUDA 1D6EA 3OB0K 5AAMA 2GTZB 2D31B 3AS0A 5C0BB 1PKQE 3FHQA 4JPIB 4X5XA 1C8PA 4M1DH 3T65A 4HXAH 1W0YT 4WHYG 5DHYB 5I1EH 2XPGA 4KQ3H 4YFLI 1I4FA 5E99L 4PJEB 4TNVK 2AJUL 5A1AA 3PWUA 5BZDA 3NIGF 5ACLA 5JZ7D 4LAJH 4U3HA 5C86A 2VXTH 2NXYB 4KI5D 1WIPA 5T1MB 3TP4A 1BQHG 2CRMA 2SEBB 5C70A 5D2LB 3DYOA 3ULUC 4R8WH 1PZUB 4Z0XB 5LBSH 3HR5B 3FQWA 1MJJA 3IRZA 4XHJD 1LO5A 1YYLH 4X7FC 2HVKA 2XRAL 3JWOH 1X5AA 4OZGB 2JTDA 3MPCA 5ANMA 3RTQB 1JNLH 1OGAE 2W92A 5TQ2L 1U8QB 2H1PL 5FM8A 4QHUB 2AEIT 2NMSA 4HDIB 1ITBB 1H15A 5DJDA 1F97A 4P23D 5L0QB 2VLRE 4R3SA 3LHPL 3WDJA 4LLUA 5HHMD 3I50H 4OSUH 5E1AA 3E6HA 3VXOA 4HMEA 3L7FB 5LAXB 4IEFB 2AJ3A 3S4SG 5HYJE 4FA8A 4HWZB 4PBXA 4M9OA 4FQHB 4IRSD 4HX1A 3QPXL 3QUML 3O45B 4Z7NF 3F7YA 1KJVB 5FDWB 1XF3B 5KSBA 1WLHA 1INEL 3OKKA 1SEBB 1XCTA 3NA9H 4U1GC 2EYSB 2YK1L 3MQIA 4G43A 3MGTB 1FRGL 5A2FA 4TVPL 3ZDYF 3MOAH 2ZUWA 4H88L 2JE8A 2IBZX 3ZE2E 4N90D 5DYOA 3JV0A 4JDZB 2R56H 3QA3A 1ZLUK 2QTEA 4X5LA 3ZT7A 5D7SL 4K94C 1UZ8B 1HH6A 4P5KB 5IQ7H 5DQ9B 5T33L 3SGJA 1F3DJ 2BNRE 3SKUD 4Y5YA 4LARL 5C7XL 5E8EB 3LMJL 3O3BB 4LSQH 1UACH 4X80L 1RV6X 1BIIB 4DTGL 3IYLW 5DD1H 3VJ6B 5AZEL 2MCG1 3LMJH 3H0TB 1IC4H 3J7HA 1GYAA 4KTDH 4D0DA 1IZJA 4JZJB 1TETH 3BISA 3KWWA 2BY1A 3KAAA 3ARBA 3QO0A 3C60D 2ZCLL 3FT2B 3I6LD 3SGEH 1RFDH 1RUPH 4KJQC 1YEEH 1BAFL 3MUJA 1OCWL 4IIQC 1FRGH 2CLZB 1CICA 5JLZB 4FZ8H 3E8UH 1OGTA 3E0GA 2R1YA 4LHJB 2NPLX 1JPSL 3S97C 4KI5C 4GAGL 4HJ0C 2SEBA 1T7VA 1QA9A 1BVLB 2LQRA 3OJVC 4KK9C 1FVEB 4XP1H 5T5FH 4L8BB 3DURA 1ZHKA 4J8RB 5ESVA 3Q3GB 2OR9L 3L3JA 3P30L 4JRYE 5SX4H 1JPTH 3LIZL 1XIWA 5FYJU 2MWCA 3O4LB 3IAQA 4Y88A 5DK2B 4FFYH 3BO8A 2X4QA 4BZ1H 3SGEI 3T2OA 4OZHA 4JPWL 4OLUL 1U36A 4EUPH 2DL9A 5GGVL 2H1PH 1K3IA 5JXEC 1J8KA 1YMHB 4N0YH 2JF1A 1DDHB 1J05A 3S36L 1AXSB 4H0IA 5D9SA 4PJBF 5D1QB 1S7TA 4HWBL 4JN1L 5FO7B 5B39B 5B38G 1H15B 4LCYB 3GSVB 4S1DD 2B1AL 4UQ3A 1B9ZA 1ZGLB 4R7NA 3Q2CA 5F3HB 2ZOKA 3VXRA 3F62A 4JM2D 4KK8D 4HC1H 3DSNA 2PXYB 5I19L 4MDIA 2W60A 3WFBL 1NC4D 1IAKB 3DVGB 5IV2A 1KGCD 4KJYB 3A6BL 3RL1B 4JM4H 1HINH 4EOWL 4Y4KA 3CDFA 1IBGH 3NIDE 4NQDE 2AJ3B 1YEJH 3HRZB 5BV7B 5KS9B 2B5IC 3SE4A 4Q6YA 2CIIB 3DVNA 3FONB 3V6OC 5CZVL 5SX5H 3BHBB 3V4UL 4HQQL 1DQMH 2GAZA 2KPNA 1IC7L 2P1YA 2FHCA 3H8NA 3BKJL 2RIKA 1TQBC 3MJ8B 1T03H 4IRSC 4YE4H 3QNYA 2R39A 3QIWC 1C08A