2MQJA

Solution structure of ubiquitin-like protein from caldiarchaeum subterraneum
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
MKIKIVPAVGGGSPLELEVAPNATVGAVRTKVCAMKKLPPDTTRLTYKGRALKDTETLESLGVADGDKFVLITRTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein
publication title Solution structure of ubiquitin-like protein from Caldiarchaeum subterraneum
rcsb
source organism Candidatus caldiarchaeum subterraneum
molecule tags Ligase
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mqjA00
3AU5A 2FNJB 2OOBB 1YX5B 1WM2A 3TBLD 1GG3A 4KIKB 2BF8B 2KJHB 2V1YA 3DQVA 3ZLZA 4EZKA 5DPWA 3PRMB 3NOBA 3A1QB 3QIJA 4GDKB 1EUVB 1FXTB 1KOTA 2BGFA 3TL5A 4W9FA 1LM8B 2MBHA 4HVBA 3ENEA 2LASA 3N3KB 1GC6A 3KUDB 5AZFA 3R7QA 1WXVA 4KVGB 2KN5A 2V3SA 3X0WA 4G11A 1VD2A 1H4RA 1WGGA 2O6VA 3QARA 5KHQA 2L3ZA 5CX3A 4TQ0A 5G2NA 3RZFA 4G3XB 4KIKA 1WGDA 2G3QB 2MW5A 1P98A 3KYDD 4G0NB 1V5OA 4PYUA 2KDEB 2CHXA 2YVCA 3A1QA 2G45B 2FAZA 4GDKA 2KLGA 3DDCB 4MH0E 2J0JA 5AZGA 1P3QU 1E7UA 4EZJA 4RM8A 2HE7A 4F1SA 3P2BA 4EOYA 4II2B 3SHQA 1L2NA 3RT3B 3LDZE 3NHEB 4GU2A 2JZZA 3VFKA 4IC7B 1U4AA 4RM9A 3PGEA 1BT0A 3GZNI 2BYFA 4EFOA 1LXDA 1KJTA 3PHXB 1WMHB 2IBIB 3TIXA 3SU8X 2MP2B 2MQJA 3B08A 3M3JA 4HWIB 5J18A 2DZIA 4GOCA 3UIPB 2FCMA 2G4SA 2JZ3B 1V86A 3AULA 4FHJA 3S2AA 1WM3A 3L13A 1OEYA 4JIOU 4MSMB 4BKGA 3DBRI 2DAJA 4HDQA 5J2RA 4GDLB 4ANXA 2XBBC 1JRUA 1LQBA 2KDIA 3IHPC 1I42A 4WWOA 5IA7A 1KLVA 2KO3A 3U30A 4CO7A 2NBVB 1Q0WB 4AP4C 1WE6A 3ZDMC 3A9KA 3ECIA 4K1RB 3APFA 2BYEA 2CKHB 4FJVB 1E8WA 1T0YA 2Z0EB 4PS3A 2LGYA 3PLUA 3PLVA 1WIAA 2QHOA 2XK5B 5LXIB 2WX1A 2DX5B 3DBHI 4MDKE 4PS7A 1MG8A 2RGFA 4M8NA 2WDTB 3L08A 4AJWA 3ZRFA 3PHWB 4GDLA 2DENB 3VHTC 3CSTA 2NCNA 2KX3A 1UELA 2IY0B 2R2QA 4AWJA 4BKTA 1V81A 3TMPB 4LDTD 1TBEA 2BYVE 2GMIC 2MRPA 2N1WA 1S3SG 3H9DA 3KYCD 3APCA 2ZPYA 3ZNID 4CHKA 5EDSA 1WXAA 3PTFC 4DWFA 3IBEA 4B95A 4GMVA 3HHMA 4W9JA 2K8HA 3QX1A 2ZNVC 3NZSA 1F9JA 2RR9A 1D3ZA 2N1VA 4IWPA 2LUEA 5C23A 3UF8A 3U7DA 5E6NA 2L8JA 2ZNVB 4HCPB 1IPGA 2LJ5A 3LJ3A 2MCNB 3L16A 1UH6A 3ONSA 3WAMA 1WJNA 4HJKA 2LXAA 3DVGY 2NBUA 4ANWA 3SD5A 4GGQA 3DVNU 3QJZA 3M62B 4B6WA 3CF6E 2FUHB 4KZCA 4GXBA 1XQQA 2N7EA 4XZ4A 3SDLC 2KK8A 3EHVA 1YQBA 1RFAA 2KLCA 2C9WB 5LLIA 2JY6A 4EUTA 2D07B 2EMSA 2EKEC 2MX2A 3RYTA 2FIFA 1AARA 2KVRA 2UYZB 3N30A 3PV1A 4K7SA 3ZRCA 2KWVB 1S1QB 1HE8A 2KD0A 2CHZA 3RD2A 1C3TA 2HJ8A 5E6PA 1EF5A 1WGHA 2JWZA 3WIMA 4HCNB 2N4FA 5G55A 4WJNA 2K6DB 1YX6B 2KWUB 2ASQA 2AWTA 2MSED 2R2OA 4MGKE 4WJPA 3V62A 2G4DB 4BOZB 4I6PA 3AXCA 1E8ZA 2BKRB 2JPHA 1Q1OA 2C7HA 2IYDB 2PEAA 4W9DA 2ZEQA 2ZPNA 2KANA 2Z0DB 1NDDA 1E7VA 3PPAA 2GBJA 4PYZA 4ICUA 2C7NB 2HD5B 2LZ6A 2D2QA 3DVNV 4A3PA 2KWCA 2CU1A 2WX0A 1GJZA 3H1UA 1V5TA 4IUMB 1C1YB 4AJYB 2KX0A 4E3CA 4MELA 3JVZX 2L76A 1K8RB 2O6VD 4DHZB 1GNUA 4TQ1A 3EC8A 1R4MI 2LGXA 3ZTDA 5CHFA 4FHKA 4ANVA 2IO0B 3PRZA 3VTUA 4EKUA 2DAFA 4J6IA 3MTNB 1V6EA 2FIDA 3B0AA 5IAAC 2JRIB 1YIWA 3M95A 4FULA 1IP9A 1I35A 4MGYE 4WJOA 2IZVB 3ZIMA 3NS8A 3OJ4B 3KH0A 1J8CA 2KC1A 3PS6A 5FR6A 3A9KB 2MA9B 1CMXB 3R7RA 3KW5B 3QWZB 5HKHA 3R3MA 4JQWC 2AYOB 1YJ1A 4DK5A 2PJHA 4HDOA 3PREA 2KQSA 5C1ZA 2ZVOA 4BBNC 4BKSA 4KDLB 2LVQA 2MBOA 2OJRA 3Q3JA 5DPTA 3NZUA 1WY8A 4KSKC 3OJ3A 4WJQA 3JW0X 1Q5WB 3OAWA 1WX9A 2D11A 2HTHA 2IO1B 2NPTA 3NY5A 3PT2B 3H7SA 4HXDA 5CTRC 4IWOA 2K39A 2NBWB 4P7IA 3WAPA 3ZNZB 2DZKA 3UIOB 1WF9A 1WX7A 2DYMA 1ZW7A 2JVCA 2RPQA 5L83A 3EFUA 3VH3B 1E5WA 1SE9A 2L0FA 3KVFB 5D2MB 2GBRA 3UQBA 4XC2A 3VQIA 3IFWB 3N32A 2DHZA 4FJZA 3KUZA 3OLMD 4OVVA 4OVUA 1X1MA 4WAAA 4GIVA 3RULA 4ZDVA 4IG7B 2W9NA 2AL6A 3JYUA 2BKFA 4E74A 2Z59B 2KOXA 4LJPB 3IVFA 1XT9B 1WRDB 2CS4A 1SGHA 2BWFA 1WXMA 2NS5A 1WJUA 4BVUC 4EZLA 2C7MB 3H7PB 3DBLI 3ALBA 4TV3A 1A5RA 3VUXA 2KMCA 3D32A 2FCSA 1WR1A 2GBKA 4FADA 5DPRA 4HPMB 1WR6E 3BINA 2N9PC 3TJPA 2KDBA 4ICVA 2VRRB 1GUAB 1WGYA 4MJSA 3VUYA 2UWQA 4NAWA 2LGDA 1NI2A 2ZCBA 3RZWC 2Y5BB 3I3TB 4I6LB 2O2VB 4M8MA 4WWPA 1WJ6A 4KDIC 4AOFA 2M8SA 3ZO5B 5L95C 3M63B 2PE6B 1WXSA 2IY1B 4E71A 5JHBA 4RMAA 3VTVA 4W9KA 2ZCCA 2A4ZA 4WQOB 2YLMA 3HIZA 3HM6X 2GOWA 1EO6A 3X23A 1UD7A 2NR2A 2REXA 3H7PA 4K7WA 1WI0A 2LD9A 1WGRA 1OEYJ 4JGHB 4G50A 3ZNGC 4DDID 2ZVNA 2KJRA 2KTFA 2L05A 4MM3A 3AI5A 2WWZA 2XEWA 4ANUA 3ZW3A 4II3B 4DHJB 1V2YA 2DYOA 4TUUA 3A9JA 1RAXA 3L54A 2JF5A 4WWNA 5GMVA 4KV2A 2KKCA 2B3AA 2O2VA 3Q3FA 4NNJB 4F8CB 2JRHA 1Z2MA 1WZ3A 4BOSC 2BWES 2KMAA 2MBEA 2LVOA 1UGMA 2L00B 2MBQA 4FLHA 3W1YA 4HPLB 2LRWA 2D10A 4JLCA 5AEKB 1H8CA 2JXXA 1WX8A 4FBJB 3DBSA 2C5LC 3R66C 5JHAA 3DOWA 3VDZA 2AEHA 4HK2A 4URKA 4PS8A 3CMMB 1P9DU 2I1JA 5CHVC 3ZTCA 3V6CB 1WJ4A 2AL3A 3DPDA 4NJ6A 3VAWA 3PZDA 2K25A 1NBFC 3KUCB 3RCZA 4DHJD 5TR5A 1WYWB 2J0MA 4KSLC 2J7QB 3BY4B 3C0RB 3A4SC 3U8ZA 3VXWA 5E6OA 4IW0A 2KC2A 4ZRJA 2KXJA 2NPTB 1IYFA 3W1SA 2K8CA 2KQ7A 4W9CA 3L17A 3APDA 1RLFA 4FJYA 1OQYA 1V80A 2KJ6A 4M0WB 2KHWB 3EECA 4MGZE 3PRPB 2MWSB 2LRUA 3QA8A 2NVUI 4JL9A 4B9KA 4CYEA 3PVLA 3QCAA 1TGZB 4F7ZA 4W9EA 3V60A 3RUIB 4DDGD 2GBMA 4I6NB 2KTRB 2WYQA 1EF1A 2JUOA 2ZJDA 2D3GA 2KNBA 3VUWA 1WE7A 2M0XA 4XX5A 4BKSD 4AUQC 1SIFA 2JT4B 1Y8RC 2V4LA 1E90A 2KFKB 3K9OB 1RRBA 3HK0A 5KHOA 3ZVVA 2LWPA 3QK0A 5D6JB 3TCAA 3WANA 4EEWA 3K9PB 4LCDE 2FCNA 1TZ1A 3V61A 4IM3A 2GBNA 1E8YA 4W9GA 1KM7A 3H6NA 3UQAA 3QQ8B 1R4NI 2MLBA 2K6QA 1LFDA 3MJWA 4HLEA 5AZHA 3QAQA 1P1AA 2C60A 3WAOA 2KTRA 3DCGA 3ML8A 4LDTB 4IM2A 4MJSB 4NAWB 2MBBB 2LXCA 2N9XA 4FN2A 4KZ0A 4YL8A 3MHSD 4MGIE 1QZEA 1V49A 2DZJA 4K7UA 4BFRA 3WA0A 2KFKA 1YD8U 5JH5C 1V9JA 2J0KA 4W9HA 5D7GA 4MSQB 2DZMA 1XD3B 1WMHA 2A5UA 1ISNA 2MP2A 2CHWA 1UZXB 5CHWA 2N7DA 4K81A 4ZYNA 3T9LA 4A3OA 3HM3A 1L7YA 3QC8B 4A20A 4NY0A 5DCNA 2ZZPB 1PQSA 4ASWC 4GB9A 5JZEB 3A9JB 3JSVB 2RSUA 2IO3B 2KFJA 3L0WB 2RD0A 3O65B 1UBIA 2M4NA 2K8BA 1WH3A 5D94A 2I1KA 1UBQA 2DYBA 4N9F4 3CSFA 4W9IA 3ZUNA 2M17A 2L0TA 3DVGX 2BPSA 4TKNA 4FA6A 2M1MA 1WFYA 4IM0A 5BO4B 3UINB 2L7RA 3WALA 2K1FA 2XK5A 3VTWA 2N9EB 4NJ7A 3ML9A 1G6JA 1GC7A 3ZKJC 3L10B 4NQKE 4MEMA 2EMTA 4DHZE 2KDFB 1J19A 3GOEA 2CR5A 2LVPA 2PE9A 1ZGUB 3JSVA 3PSEB 4IWQA 4W9LA 3VVWB 3T8MA 5LXHA 1ZKHA 1M94A 2KZRA 1VCBA 1OGWA 3VH4B 3ZDTA 4X57B 2PPHA 1P0RA 4NPNA 1J0GA 4DXAB 3A33B 3AU4A 4GN1A 2IO2B 1E8XA 3UGBB 4NQLB 5DPSA 3W1SC 5J17A 3A4RA 1Z5SB 4LJOB 2LI5A 1TTNA 4ZRIA 4DBGA 4ZRKA 3B1LX 2O6VB 2FCQA 3QHTA 3ZNHB 4GSWA 3V6EB 4BBNF 1WZ0A 3IG3A 1OTRB
chains in the Genus database with same CATH superfamily
4EE2A 2V1YA 3ZLZA 2NTTA 3J9CA 3Q8FA 2I2YA 3VRAB 3IXSA 1KOTA 2BGFA 3N1YC 1E10A 1LM8B 1ESFA 3AE8B 1STEA 2LASA 2WHIA 3KUDB 1SE4A 1N61A 1K52A 2V3SA 2WLBA 1VD2A 1WGGA 1SF0A 2WXKA 3SEBA 4S17A 4TQ0A 3VRBB 4G0NB 3KYDD 4MACA 2PW9A 1TKGA 2G45B 3CIRB 4GDKA 3DDCB 3AH7A 1P3QU 1R4NB 3P2BA 4II2B 1L2NA 3AE9B 3RT3B 4HPPA 2KMMA 4RM9A 3GZNI 3NZ3A 2MQJA 4HWIB 4GOCA 3UIPB 4FHJA 2KN4A 1L6UA 1OEYA 4BKGA 1TS3A 1UNSA 3DBRI 4HDQA 2XBBC 3IHPC 1AN8A 2KDIA 1KLVA 1C4CA 1VJKA 2KO3A 4CO7A 1PGAA 4P6VF 4YSYB 3NRZA 3ZDMC 1TY0A 3DWGC 1SJED 4L2YA 1DOXA 5LXIB 2QHOA 4KX6B 3I63C 4MDKE 4PS7A 3KWLA 2WDVB 2RGFA 2WXGA 4RFBA 1JW9D 1JWUD 3PHWB 3B2FA 5FK9C 3UI3A 2RDGA 3I57A 4AWJA 4US8A 3MC9A 2JX5A 1I4HA 4K3CA 2BYTA 1TBEA 2GMIC 2MRPA 4Q2JA 1QOGA 1FIQA 3KYCD 1MVKA 2WXIA 3ZNID 5EDSA 1WXAA 4GMVA 2K8HA 3NZSA 1GOZA 1D3ZA 3UF8A 3U7DA 5E6NA 4HCPB 1E9MA 2LJ5A 2QILA 4LNOA 4HJKA 2D5GA 2WXJA 4GGQA 4KGTA 1WYGA 3QJZA 1C76A 4B6WA 1QOAA 4XZ4A 3TUOA 2D07B 2UYZB 2MH7A 2KD0A 3Q3NC 2JWZA 3WIMA 4HCNB 2K6DB 2AWTA 1SEBD 1YN4A 2MJ3A 2IYDB 1HZ6A 2PEAA 2GBJA 3T3OA 2KWCA 4HKZE 4M02A 3NVVA 4DHZB 2JSVX 3EC8A 3ZTDA 2DLBA 4FHKA 3ZXVA 2FIDA 3R8BA 2IPKD 4FULA 1NYQA 2E6XA 3NS8A 3FKYA 3KH0A 1J8CA 3LB8C 3R7RA 1K53A 3B9JA 1DYQA 2AYOB 1L4DB 3PREA 1EU4A 4KDLB 5BYRA 2LVQA 4N6EB 5DPTA 3NZUA 4WJQA 3JW0X 1Q5WB 3OAWA 5CTRC 3H7SA 5JXVA 4IWOA 2LJIA 4LLGM 1WX7A 3L4PA 1GB4A 1ZW7A 3EGRA 3EFCA 5BYSA 3UQBA 3ZJTA 2B76B 2BTEA 3VR9B 1V1PB 2ZW1A 2AL6A 4WURA 3AE4B 3JYUA 2K5PA 2Z59B 1XLPA 1V8CA 4A90A 1WXMA 4BVUC 3DBLI 2IGDA 3ALBA 3SR6A 2GBKA 4FADA 1CQVA 1TT5B 2HDEA 1WGYA 3VUYA 3I3TB 4I6LB 4WWPA 1QF6A 1ZDXA 4KDIC 2RDHA 4YTMB 1D6EC 3M63B 2YLMA 5EE3A 1DGJA 1QT9A 4JPSA 3TEXA 2NR2A 3H7PA 3R2TA 1WI0A 2LD9A 4K7WA 1OEYJ 2ZVNA 2KTFA 2V0GA 3AI5A 2WWZA 2IDYA 2XEWA 4II3B 1L0YB 4TUUA 1RAXA 2JF5A 4KV2A 2B3AA 2O2VA 4C7ZA 1Z2MA 4BOSC 3E56A 2Y5PA 2KMAA 3RPFC 1WWTA 4HPLB 2LRWA 4JLCA 1H8CA 5AEKB 5JHAA 2EELA 2AEHA 4PS8A 3CMMB 1WJ4A 3DPDA 3RCZA 2CJNA 3A4SC 5E6JA 2G9HD 4ZRJA 2QSDA 1J7BA 3MFGA 5H8YE 3W1SA 3Q14C 4W9CA 1OQYA 1FCLA 2W3RA 4KGRA 4WAFA 3QA8A 1NVID 3PVLA 4W9EA 4I6NB 2ZJDA 1EF1A 2KACA 1WE7A 1YNTE 2KFKB 1KRHA 3T3NA 1RRBA 3QK0A 1N5XA 4M0WA 1HEZE 4IM3A 2GBNA 3P1MA 3UQAA 1R4NI 3MJWA 1JCKB 2KTRA 4LDTB 4NAWB 2MBBB 4FN2A 4ZHPA 3MHSD 1I7HA 1QZEA 1V49A 4MGIE 1T3QA 5JH5C 1V9JA 2J0KA 3DHGC 3PZ8A 2DZMA 3R2IA 1XD3B 2MP2A 2CHWA 1BXTA 3HM3A 4TSSA 4MM3B 4NY0A 4JX1C 2IO3B 2E3TA 4MT5A 5AUIA 2M4NA 2I1KA 1UBQA 1NI3A 3EUB2 1LO5D 3ZUNA 1OFFA 2L0TA 3DVGX 2BPSA 3AMZA 3UINB 1WFYA 3WALA 2XK5A 3VTWA 3U2SC 3FAHA 1G6JA 2J4XA 3JSVA 3VVWB 3T8MA 1GPXA 1ZPSA 1TKYA 1M94A 1J7CA 2HJ1A 2KZRA 2JQRB 1J0GA 3W1SC 3AU4A 4GN1A 2IO2B 1E8XA 5J17A 2V9HA 1Z5SB 3HVZA 3QHTA 3V6EB 1WZ0A 3M95A 3MJ5A 2FNJB 2JYTA 3TBLD 2BF8B 3DQVA 2QMTA 3NOBA 4GDKB 1ZDVA 1FXTB 3TL5A 3W5VB 3BZDB 1YMHE 4W9FA 3W9CB 3N3KB 1GC6A 3R7QA 1MFWA 4UDUC 1GB1A 2MJEA 1UWMA 3P63A 3QARA 2WQYB 3AEEB 3AN1A 5CX3A 3RZFA 2WXPA 2LMCA 4G3XB 4KIKA 2G3QB 3A1QA 1IGDA 2FAZA 4MH0E 4EZJA 4RM8A 2HE7A 3DHHC 4EOYA 3SHQA 3LDZE 1C77A 4GU2A 4LTUA 3VFKA 1PUTA 3BK1A 3PGEA 5FKAC 2BYFA 1LXDA 3TIXA 3SU8X 3B08A 5J18A 2FCMA 1AWDA 3S2AA 1WM3A 3DBLB 1F0ZA 1T6BX 1I42A 2EKIA 1JRUA 4WWOA 5GXGB 4AP4C 1WE6A 4USAA 3A9KA 3ECIA 3APFA 1T0YA 2H88B 2LGYA 3Q3MC 3BK2A 1Y56A 3H8HA 1D5XC 1IGCA 2QDFA 4M8NA 3L08A 4AJWA 3ZRFA 5AUKA 1D4BA 3VHTC 3CSTA 2NCNA 4B0EA 1V81A 5D3IB 3Q6BA 3FILA 2ZNVC 3V3XA 2LUEA 1IPGA 1V1OA 3LJ3A 2MCNB 1WJNA 1F1HA 3SD5A 1JMLA 2FUHB 4GXBA 1RFAA 1P7FA 2KLCA 1T0SC 2K0PA 3E9SA 2MX2A 2QC8A 2KVRA 3V05A 3PV1A 1HTOA 3Q8CA 2HJ8A 2XN9C 5E6PA 1EF5A 1V97A 4ARIA 2AQ2B 2ASQA 4WJPA 2W3SA 1JQ4A 1E8ZA 2WGSA 2ZPNA 4C56C 1AW7A 4LNIA 3RNCC 4ICUA 2LZ6A 2Z8LA 3DVNV 2R61A 4C80A 1F52A 4IUMB 4AJYB 1YN3A 4LK0M 3TEYA 3JVZX 2L76A 1K8RB 2O6VD 4TQ1A 3GE3C 1R4MI 1TY2A 1MG4A 4EKUA 4AS1A 4J6IA 1V6EA 3B0AA 5IAAC 1YIWA 1LGRA 1N5WA 1EWYC 5G5HA 3NUHB 3W2DA 1HQRD 3OJ4B 3PS6A 5IKCM 4L1BA 4YTPB 2INNE 3NS1A 5HKHA 2PMVA 2JZPA 1XCTL 1YJ1A 4DK5A 4PK1A 4HDOA 3BYYB 4BKSA 1RWSA 2IGHA 4BZAA 4HXDA 2HTHA 2CJOA 4P7IA 3ZNZB 3Q8EA 5BYQA 4CQNA 1E5WA 2FUG1 2XNAC 2WXFA 1QLBB 4REZA 4XC2A 3N32A 2DHZA 4OVVA 1X1MA 4IG7B 2KT7A 2PVGC 2W9NA 1XO3A 3GB1A 1CJEA 4E74A 2QCZA 2KOXA 2PLPA 3AEGB 1QILA 1WRDB 5C3JB 2BWFA 2D3CA 1SBBB 1TS4A 3H7PB 3VUXA 2KMCA 2ONQA 2FCSA 1WR1A 3AE5B 5MPOA 5HI1A 2VRRB 1GUAB 3OG5A 1OQQA 2M0AA 2LGIA 1NI2A 1T0RC 2Y5BB 2O2VB 4XDDA 1WJ6A 1WXSA 4RMAA 2ZCCA 2A4ZA 3HM6X 1XLNA 2GOWA 1KF6B 3N9YC 4ZHOA 1HTQA 4G50A 3ZNGC 4XWTA 1SXTA 4DHJB 5GMVA 1TJEA 1I4RA 1MI0A 1WZ3A 2MBEA 2KQ4X 2L00B 2DNFA 4FLHA 1F2RC 3Q3OC 1PDXA 3DBSA 2C5LC 3VDZA 1NYRA 4HK2A 3ABVB 1KLUD 3ZTCA 4NJ6A 3PZDA 1TKEA 1VDVA 1NBFC 4DHJD 3BY4B 3C0RB 3U8ZA 3RFZB 1IBXB 3OWEB 2KC2A 2NPTB 3KLSX 1IYFA 3AE3B 3GE8C 4LNKA 2K8CA 2KQ7A 3APDA 4FJYA 4M0WB 3PRPB 4JL9A 4CYEA 3QCAA 3V60A 2KTRB 5HG2A 2D3GA 2KNBA 2M0XA 4XX5A 4AUQC 1VRAB 1Y8RC 2V4LA 4C4VB 2JU6X 5D6JB 3EA6A 2JWUA 3Q2AC 4WIPA 2KDMA 3K9PB 1BUIC 1E8YA 1KM7A 4GLSC 4WH4A 3SFDB 5AZHA 1P1AA 3WAOA 4MJSB 2J52A 4IM2A 4KZ0A 2LXCA 2N9XA 4K7UA 4JWSC 4D2KA 1UF0A 5D7GA 4MSQB 1T5XD 2A5UA 4QAYA 4K81A 3T9LA 4RF0A 4A3OA 2DBYA 3QC8B 1C79A 2ZZPB 1PQSA 2N0SB 3AECB 3A9JB 3JSVB 3L0WB 3O65B 3N1ZC 2V3NA 1E7PB 4HROA 3VR8B 3Q8AA 4XE0A 4W9IA 1N63A 4OZAA 2M1MA 3AV8A 1P7EA 3I5JC 1GC7A 3L10B 1EWCA 1FPYA 3RNBC 2YEPB 1ET6A 1J19A 3GOEA 3PSEB 4IWQA 1BMLC 4HJGE 3VH4B 2J53A 5TSSA 1WRIA 1P0RA 1R4MB 3UGBB 3NVZA 4ZRPA 2J42A 4LJOB 3C8YA 4ZRIA 4RNAA 2LEKA 3B1LX 4K7SA 2DWQA 2OOBB 1WM2A 2L52A 1GG3A 4KIKB 1MHXA 4EZKA 2W54A 3PRMB 3A1QB 3QIJA 4A8XC 1EUVB 4MH8A 5AZFA 1WXVA 2KN5A 4G11A 1H4RA 3NVYA 5KHQA 2L3ZA 2W82A 1UWXA 2KAJA 5G2NA 3ZXRA 1WGDA 2MW5A 2INDC 1V5OA 1WSPA 4DXFA 4PYUA 5C1ZA 2UU7A 3MHZA 2KLGA 2K3UA 4A9AA 3N20C 1SIJA 1R7SA 4XDCA 3NHEB 3TEZA 3ZGZA 1JALA 1BT0A 1KJTA 2V4IB 3PHXB 1WMHB 3M3JA 1QQRA 2G4SA 1V86A 3AULA 3L13A 1AYFA 1QKZA 4MSMB 5J2RA 4LNNA 3U4EG 5IA7A 3AEFB 3ETRA 1XEEA 1FXIA 3BVZA 4K1RB 4AQ7A 2CKHB 1HZ5A 1FNUA 1KH0A 2Z0EB 3I9V1 3FILB 3HUIA 2DX5B 4WQMA 1M4VA 1MG8A 2WDTB 4GDLA 2DENB 4IKGA 2KX3A 1UELA 2R2QA 4RGTA 1JROA 2LHDA 3TMPB 4LDTD 1DOYA 1FFUA 2I38A 2N1WA 1S3SG 1D5ZC 1KTKA 4RGOS 3IBEA 4B95A 3HHMA 3QX1A 1YN5A 1F9JA 2RR9A 2RMMA 2KYWA 3ONSA 4OW0A 3FC4A 2D3AA 3DVGY 1CK1A 2SAKA 2PVOD 3M62B 2VH1A 2WXOA 2N7EA 3EHVA 2JY6A 2X8XX 1HXYD 2BT6A 3RYTA 2FIFA 1AARA 1MHHE 1S1QB 1HE8A 5H92C 3RD2A 1WGHA 1IUEA 2N4FA 5G55A 4WJNA 1YX6B 3LYYA 2MSED 2R2OA 4BOZB 4MGKE 1TS2A 2LFIA 4I6PA 3AXCA 2JPHA 1Q1OA 2C7HA 4W9DA 2ZEQA 2WU5B 2Z0DB 1NDDA 1E7VA 2C7NB 2HD5B 4KKJA 2L83A 4A3PA 1GJZA 3H1UA 3RNFC 1V5TA 2KX0A 4E3CA 1GNUA 1FMAD 2LGXA 5CHFA 2ON8A 3PRZA 3VTUA 2DAFA 3MTNB 4YTNB 1I35A 2JRIB 1IP9A 4MGYE 1C9FA 3RNAC 3ZIMA 1EM7A 1JWBD 1YJJA 2NMQA 1FFVA 2PKOA 2MA9B 1CMXB 2OEDA 3KQ4A 3QWZB 3R3MA 4JQWC 4RH6A 2WXRA 1HA5A 4RGMA 1KFYB 2OJRA 2MBOA 3DBHB 4OHJA 3P4RB 5T8IA 3OJ3A 2IJ0A 4C7YA 1FRRA 1WX9A 2BS3B 2D11A 1GAQB 3NY5A 3PT2B 2N9KA 1QOFA 4J3OD 3WAPA 2DZKA 3UIOB 2W55A 2GB1A 1T0QC 1K51A 1SE9A 3ZYYX 3IFWB 4FJZA 4BAXA 4OVUA 3TEWA 3AEAB 3RULA 4ZDVA 4A6QA 4LJPB 5HFYA 2D3BA 1XT9B 2WXNA 1WJUA 4EZLA 2C7MB 3U52E 4TV3A 3D32A 1NENB 1I4XA 4HPMB 3BINA 2N9PC 3TJPA 2KDBA 4ICVA 4OVZA 4NAWA 2LGDA 2ZCBA 4O1NA 2MJDA 2WNMA 4M8MA 4YSZB 4US9A 2M8SA 5L95C 5D3DA 4E71A 4WQOB 3BWUD 3HIZA 1EO6A 2HTME 2V3PA 2REXA 4P1BC 3U7ZA 5BMHA 1CZPA 4DDID 4XWWA 2FE8A 1MJDA 2L05A 4MM3A 4ANUA 2DYOA 4WWNA 2JRHA 1F77A 1PGBA 5EE1A 5HHDG 4S0RA 4IDIA 2LVOA 2MBQA 3W1YA 2D10A 3O13A 1WX8A 3R66C 1D5MC 2X38A 1P9DU 2I1JA 1UGJA 4OZCA 3V6CB 2K25A 3KUCB 5TR5A 2J0MA 4KSLC 4K3BA 3MP9A 4DQOC 3AE1B 1SE3A 5E6OA 1L5PA 3NG0A 3P4QB 4DXGA 2ICIA 2FBWB 1N6ZA 3L17A 3B2GA 1UUPA 2KHWB 3EECA 4ARCA 2N9LA 4MGZE 3WCQA 4B9KA 5IP4D 2NTSA 4DDGD 2GBMA 4JE3B 3RN9C 4YT0B 1SIFA 2LHEA 3K9OB 3HK0A 3TCAA 4EEWA 4NJCA 3V61A 4LCDE 2FCNA 3QQ8B 2MLBA 1SJHD 4HLEA 3DCGA 1XLOA 4YL8A 2AX5A 4BFRA 1RM6C 2Q5WD 4W9HA 4NAMA 2PTLA 2RDBC 2RPVA 4R3DA 5CHWA 1SSNA 2N7DA 1L7YA 1JWMD 5DCNA 4ASWC 5JZEB 4YWGG 2WDRB 3P4PB 1NEKB 1QOBA 2RSUA 1UBIA 1WH3A 4ZOHC 1ZOYB 2DYBA 4N9F4 3CSFA 2M17A 3GS2A 4TKNA 2L7RA 2KVZA 2WP9B 2JYEA 2N9EB 2GI9A 4NJ7A 3ML9A 3AE2B 1PFDA 4NQKE 2EMTA 2CR5A 2PE9A 3RMKC 1ZGUB 1ZKHA 2IGGA 1VCBA 1OGWA 1XF5L 5IO9A 3ZDTA 4DXAB 3IAM1 4ZRQA 4NQLB 3DWMA 4H2AA 2FCQA 3ZNHB 4GSWA 4BBNF 1OTRB 3AU5A 4A55A 1YX5B 2KJHB 3BVGA 5DPWA 4KGSA 2MHJA 3IAS1 2GRIA 2MBHA 4HVBA 3ENEA 4KVGB 3X0WA 3PO0A 2O6VA 4RF1A 1FRDA 1P98A 1MPEA 1ENFA 2AQ3B 3CWIA 1RYJA 2CHXA 2KDEB 2YVCA 4W9KA 1ET9A 2J0JA 5AZGA 1E7UA 2WDQB 3AEDB 2INCC 4F1SA 1F2RI 2WXQA 2JZZA 4IC7B 1U4AA 4EFOA 2IBIB 2MP2B 2DZIA 4C00A 3AEBB 2JZ3B 5FR3A 1I4GA 4JIOU 3AE7B 5EE9A 2M19A 2DAJA 2BS2B 4GDLB 4ANXA 4ACFA 1LQBA 1RFKA 4HEA1 3U30A 4KKIA 1FNVA 2NBVB 1Q0WB 2K9XA 2WXMA 1TS5A 2K22A 1L4ZB 2BYEA 4FJVB 1E8WA 4PS3A 3PLUA 4P1CC 1JRPA 3PLVA 1L0VB 1WIAA 2XK5B 2WX1A 3DBHI 2Y3AA 1I4QA 1ZXIA 3BYTB 4NZLB 2IY0B 4BKTA 2OHFA 1FEHA 2BYVE 1I4PA 1Q10A 3H9DA 3APCA 2ZPYA 4CHKA 4HRSA 3PTFC 1FD6A 4DWFA 3LXFA 4W9JA 2N1VA 2VZKB 4IWPA 5C23A 2KWDA 2L8JA 2ZNVB 3L16A 1UH6A 3WAMA 2LXAA 2NBUA 4ANWA 3DVNU 3MC0B 3SFEB 3CF6E 4M00A 4KZCA 1XQQA 3SDLC 2KK8A 3ZJVA 2TSSA 1YQBA 2C9WB 5LLIA 4EUTA 2EMSA 3NVWA 2EKEC 5LNK1 1SE2A 3RNEC 3N30A 3ZRCA 2KWVB 2BVCA 2WXHA 2CHZA 1VR9A 1C3TA 1JWAD 1YOVB 2VZKD 2KWUB 3V62A 4JWUC 2G4DB 2G1EA 2BKRB 2JXTA 1FNWA 2KANA 3MC8A 3PPAA 4RCOA 4PYZA 2LUMA 2D2QA 2CU1A 1YJIA 2WX0A 4XYCA 3AE6B 1C1YB 3P4SB 4IOIE 4MELA 4ZYSA 3GZNB 4M01A 1K50A 4WWMA 1TYGB 2M56B 5I4DA 4ANVA 2IO0B 3KWVA 2BBCA 4WJOA 3BVMA 2IZVB 5EE0A 3W5UB 2CU3A 2L32A 3DBRB 2KC1A 2INPE 5FR6A 3A9KB 3KW5B 2WS3B 4RGNA 2MEKA 1VLBA 2PJHA 1XLQA 1C4PA 1E0ZA 3AB5A 2KQSA 2ZVOA 1XXGA 4BBNC 3Q3JA 1WY8A 4KSKC 1IBXA 1ZUD2 3Q8BA 2IO1B 2NPTA 2K39A 2NBWB 1WF9A 2DYMA 4L23A 2JVCA 2YEPF 2RPQA 5L83A 3EFUA 3VH3B 1FCCC 3RNGC 3P42A 1JWSD 2L0FA 3KVFB 5D2MB 1C4AA 2GBRA 4FXCA 2BB6A 3VQIA 3DHIC 3KUZA 1N60A 3OLMD 4WAAA 4GIVA 2BKFA 1E6EB 4C4VA 3IVFA 2CS4A 1SGHA 3Q69A 2NS5A 1ACCA 2L1AA 5G5GA 1A5RA 5DPRA 1WR6E 4MJSA 2UWQA 1V1PA 3RZWC 1VZ8A 1A70A 1PGXA 4AOFA 1N62A 3ZO5B 2PE6B 2IY1B 5JHBA 3VTVA 5BMGA 5IN7A 3X23A 1UD7A 3RI7C 3HRDD 1WGRA 4JGHB 5IOIA 2BW2A 1DOIA 2KJRA 3GP7A 3ZW3A 2QJLA 1V2YA 4TMAB 3N1XC 3A9JA 3L54A 1TIFA 4PT5A 2SEBD 2KKCA 4N58A 3Q3FA 4NNJB 4F8CB 3ZQ4A 2BWES 1UGMA 2N7JA 1SB3C 1C78A 1L0XB 2JXXA 4FBJB 3DOWA 3PZ7A 1ZXHA 4URKA 4OZBA 2GLSA 5CHVC 1L6VA 2AL3A 1VZ6A 3VAWA 1WYWB 2J7QB 3VXWA 1YQ4B 1XCQL 4IW0A 2BS4B 4XGAB 2WXLA 1B1ZA 2KXJA 1RLFA 3IT4B 1V80A 2KJ6A 2QIEB 2BQQA 2PIAA 2MWSB 2LRUA 4HKQA 2NVUI 2Y5CA 4F7ZA 1TGZB 3RUIB 1WGKA 1YQ3B 2WYQA 2JUOA 3AM9A 3VUWA 4YXDB 4BKSD 1ROEA 2JT4B 1FO4A 1E90A 5KHOA 3ZVVA 2LGSA 2LWPA 3WANA 3C19A 1TZ1A 3ZJUA 2OJWA 3NJTA 2ZW0A 2WU2B 4LNFA 4W9GA 3H6NA 2K6QA 1LFDA 3QAQA 2C60A 2H89B 1TZOA 3ML8A 4B0MA 4N59A 2VH2A 2DZJA 3WA0A 2KFKA 1YD8U 1WMHA 1KLGD 1ISNA 2QEJC 1PYWD 1UZXB 4ZYNA 3HVDA 4ITKA 4A20A 3IT6B 4YSXB 1ZP0B 3TSSA 3URYA 4GB9A 2KFJA 5C2TB 1B9RA 2RD0A 1ZE3D 2K8BA 5D94A 1OQRA 4P16A 3BIID 4FA6A 4IM0A 5BO4B 2K1FA 1FM0D 1J7AA 2ACZB 3ZKJC 2AQ1B 4MEMA 4DHZE 2KDFB 2LVPA 5LXHA 4W9LA 1VZ7A 2BB5A 1FXAA 1WXQA 4X57B 2PPHA 5BMIA 4NPNA 3A33B 5DPSA 3A4RA 2LI5A 1TTNA 1EU3A 4DBGA 4ZRKA 2O6VB 3IG3A
chains in the Genus database with same CATH topology
3AU5A 2FNJB 2OOBB 1YX5B 1WM2A 3TBLD 1GG3A 4KIKB 2BF8B 2KJHB 2V1YA 3DQVA 3ZLZA 4EZKA 5DPWA 3PRMB 3NOBA 3A1QB 3QIJA 4GDKB 1EUVB 1FXTB 1KOTA 2BGFA 3TL5A 4W9FA 1LM8B 2MBHA 4HVBA 3ENEA 2LASA 3N3KB 1GC6A 3KUDB 5AZFA 3R7QA 1WXVA 4KVGB 2KN5A 2V3SA 3X0WA 4G11A 1VD2A 1H4RA 1WGGA 2O6VA 3QARA 5KHQA 2L3ZA 5CX3A 4TQ0A 5G2NA 3RZFA 4G3XB 4KIKA 1WGDA 2G3QB 2MW5A 1P98A 3KYDD 4G0NB 1V5OA 4PYUA 2KDEB 2CHXA 2YVCA 3A1QA 2G45B 2FAZA 4GDKA 2KLGA 3DDCB 4MH0E 2J0JA 5AZGA 1P3QU 1E7UA 4EZJA 4RM8A 2HE7A 4F1SA 3P2BA 4EOYA 4II2B 3SHQA 1L2NA 3RT3B 3LDZE 3NHEB 4GU2A 2JZZA 3VFKA 4IC7B 1U4AA 4RM9A 3PGEA 1BT0A 3GZNI 2BYFA 4EFOA 1LXDA 1KJTA 3PHXB 1WMHB 2IBIB 3TIXA 3SU8X 2MP2B 2MQJA 3B08A 3M3JA 4HWIB 5J18A 2DZIA 4GOCA 3UIPB 2FCMA 2G4SA 2JZ3B 1V86A 3AULA 4FHJA 3S2AA 1WM3A 3L13A 1OEYA 4JIOU 4MSMB 4BKGA 3DBRI 2DAJA 4HDQA 5J2RA 4GDLB 4ANXA 2XBBC 1JRUA 1LQBA 2KDIA 3IHPC 1I42A 4WWOA 5IA7A 1KLVA 2KO3A 3U30A 4CO7A 2NBVB 1Q0WB 4AP4C 1WE6A 3ZDMC 3A9KA 3ECIA 4K1RB 3APFA 2BYEA 2CKHB 4FJVB 1E8WA 1T0YA 2Z0EB 4PS3A 2LGYA 3PLUA 3PLVA 1WIAA 2QHOA 2XK5B 5LXIB 2WX1A 2DX5B 3DBHI 4MDKE 4PS7A 1MG8A 2RGFA 4M8NA 2WDTB 3L08A 4AJWA 3ZRFA 3PHWB 4GDLA 2DENB 3VHTC 3CSTA 2NCNA 2KX3A 1UELA 2IY0B 2R2QA 4AWJA 4BKTA 1V81A 3TMPB 4LDTD 1TBEA 2BYVE 2GMIC 2MRPA 2N1WA 1S3SG 3H9DA 3KYCD 3APCA 2ZPYA 3ZNID 4CHKA 5EDSA 1WXAA 3PTFC 4DWFA 3IBEA 4B95A 4GMVA 3HHMA 4W9JA 2K8HA 3QX1A 2ZNVC 3NZSA 1F9JA 2RR9A 1D3ZA 2N1VA 4IWPA 2LUEA 5C23A 3UF8A 3U7DA 5E6NA 2L8JA 2ZNVB 4HCPB 1IPGA 2LJ5A 3LJ3A 2MCNB 3L16A 1UH6A 3ONSA 3WAMA 1WJNA 4HJKA 2LXAA 3DVGY 2NBUA 4ANWA 3SD5A 4GGQA 3DVNU 3QJZA 3M62B 4B6WA 3CF6E 2FUHB 4KZCA 4GXBA 1XQQA 2N7EA 4XZ4A 3SDLC 2KK8A 3EHVA 1YQBA 1RFAA 2KLCA 2C9WB 5LLIA 2JY6A 4EUTA 2D07B 2EMSA 2EKEC 2MX2A 3RYTA 2FIFA 1AARA 2KVRA 2UYZB 3N30A 3PV1A 4K7SA 3ZRCA 2KWVB 1S1QB 1HE8A 2KD0A 2CHZA 3RD2A 1C3TA 2HJ8A 5E6PA 1EF5A 1WGHA 2JWZA 3WIMA 4HCNB 2N4FA 5G55A 4WJNA 2K6DB 1YX6B 2KWUB 2ASQA 2AWTA 2MSED 2R2OA 4MGKE 4WJPA 3V62A 2G4DB 4BOZB 4I6PA 3AXCA 1E8ZA 2BKRB 2JPHA 1Q1OA 2C7HA 2IYDB 2PEAA 4W9DA 2ZEQA 2ZPNA 2KANA 2Z0DB 1NDDA 1E7VA 3PPAA 2GBJA 4PYZA 4ICUA 2C7NB 2HD5B 2LZ6A 2D2QA 3DVNV 4A3PA 2KWCA 2CU1A 2WX0A 1GJZA 3H1UA 1V5TA 4IUMB 1C1YB 4AJYB 2KX0A 4E3CA 4MELA 3JVZX 2L76A 1K8RB 2O6VD 4DHZB 1GNUA 4TQ1A 3EC8A 1R4MI 2LGXA 3ZTDA 5CHFA 4FHKA 4ANVA 2IO0B 3PRZA 3VTUA 4EKUA 2DAFA 4J6IA 3MTNB 1V6EA 2FIDA 3B0AA 5IAAC 2JRIB 1YIWA 3M95A 4FULA 1IP9A 1I35A 4MGYE 4WJOA 2IZVB 3ZIMA 3NS8A 3OJ4B 3KH0A 1J8CA 2KC1A 3PS6A 5FR6A 3A9KB 2MA9B 1CMXB 3R7RA 3KW5B 3QWZB 5HKHA 3R3MA 4JQWC 2AYOB 1YJ1A 4DK5A 2PJHA 4HDOA 3PREA 2KQSA 5C1ZA 2ZVOA 4BBNC 4BKSA 4KDLB 2LVQA 2MBOA 2OJRA 3Q3JA 5DPTA 3NZUA 1WY8A 4KSKC 3OJ3A 4WJQA 3JW0X 1Q5WB 3OAWA 1WX9A 2D11A 2HTHA 2IO1B 2NPTA 3NY5A 3PT2B 3H7SA 4HXDA 5CTRC 4IWOA 2K39A 2NBWB 4P7IA 3WAPA 3ZNZB 2DZKA 3UIOB 1WF9A 1WX7A 2DYMA 1ZW7A 2JVCA 2RPQA 5L83A 3EFUA 3VH3B 1E5WA 1SE9A 2L0FA 3KVFB 5D2MB 2GBRA 3UQBA 4XC2A 3VQIA 3IFWB 3N32A 2DHZA 4FJZA 3KUZA 3OLMD 4OVVA 4OVUA 1X1MA 4WAAA 4GIVA 3RULA 4ZDVA 4IG7B 2W9NA 2AL6A 3JYUA 2BKFA 4E74A 2Z59B 2KOXA 4LJPB 3IVFA 1XT9B 1WRDB 2CS4A 1SGHA 2BWFA 1WXMA 2NS5A 1WJUA 4BVUC 4EZLA 2C7MB 3H7PB 3DBLI 3ALBA 4TV3A 1A5RA 3VUXA 2KMCA 3D32A 2FCSA 1WR1A 2GBKA 4FADA 5DPRA 4HPMB 1WR6E 3BINA 2N9PC 3TJPA 2KDBA 4ICVA 2VRRB 1GUAB 1WGYA 4MJSA 3VUYA 2UWQA 4NAWA 2LGDA 1NI2A 2ZCBA 3RZWC 2Y5BB 3I3TB 4I6LB 2O2VB 4M8MA 4WWPA 1WJ6A 4KDIC 4AOFA 2M8SA 3ZO5B 5L95C 3M63B 2PE6B 1WXSA 2IY1B 4E71A 5JHBA 4RMAA 3VTVA 4W9KA 2ZCCA 2A4ZA 4WQOB 2YLMA 3HIZA 3HM6X 2GOWA 1EO6A 3X23A 1UD7A 2NR2A 2REXA 3H7PA 4K7WA 1WI0A 2LD9A 1WGRA 1OEYJ 4JGHB 4G50A 3ZNGC 4DDID 2ZVNA 2KJRA 2KTFA 2L05A 4MM3A 3AI5A 2WWZA 2XEWA 4ANUA 3ZW3A 4II3B 4DHJB 1V2YA 2DYOA 4TUUA 3A9JA 1RAXA 3L54A 2JF5A 4WWNA 5GMVA 4KV2A 2KKCA 2B3AA 2O2VA 3Q3FA 4NNJB 4F8CB 2JRHA 1Z2MA 1WZ3A 4BOSC 2BWES 2KMAA 2MBEA 2LVOA 1UGMA 2L00B 2MBQA 4FLHA 3W1YA 4HPLB 2LRWA 2D10A 4JLCA 5AEKB 1H8CA 2JXXA 1WX8A 4FBJB 3DBSA 2C5LC 3R66C 5JHAA 3DOWA 3VDZA 2AEHA 4HK2A 4URKA 4PS8A 3CMMB 1P9DU 2I1JA 5CHVC 3ZTCA 3V6CB 1WJ4A 2AL3A 3DPDA 4NJ6A 3VAWA 3PZDA 2K25A 1NBFC 3KUCB 3RCZA 4DHJD 5TR5A 1WYWB 2J0MA 4KSLC 2J7QB 3BY4B 3C0RB 3A4SC 3U8ZA 3VXWA 5E6OA 4IW0A 2KC2A 4ZRJA 2KXJA 2NPTB 1IYFA 3W1SA 2K8CA 2KQ7A 4W9CA 3L17A 3APDA 1RLFA 4FJYA 1OQYA 1V80A 2KJ6A 4M0WB 2KHWB 3EECA 4MGZE 3PRPB 2MWSB 2LRUA 3QA8A 2NVUI 4JL9A 4B9KA 4CYEA 3PVLA 3QCAA 1TGZB 4F7ZA 4W9EA 3V60A 3RUIB 4DDGD 2GBMA 4I6NB 2KTRB 2WYQA 1EF1A 2JUOA 2ZJDA 2D3GA 2KNBA 3VUWA 1WE7A 2M0XA 4XX5A 4BKSD 4AUQC 1SIFA 2JT4B 1Y8RC 2V4LA 1E90A 2KFKB 3K9OB 1RRBA 3HK0A 5KHOA 3ZVVA 2LWPA 3QK0A 5D6JB 3TCAA 3WANA 4EEWA 3K9PB 4LCDE 2FCNA 1TZ1A 3V61A 4IM3A 2GBNA 1E8YA 4W9GA 1KM7A 3H6NA 3UQAA 3QQ8B 1R4NI 2MLBA 2K6QA 1LFDA 3MJWA 4HLEA 5AZHA 3QAQA 1P1AA 2C60A 3WAOA 2KTRA 3DCGA 3ML8A 4LDTB 4IM2A 4MJSB 4NAWB 2MBBB 2LXCA 2N9XA 4FN2A 4KZ0A 4YL8A 3MHSD 4MGIE 1QZEA 1V49A 2DZJA 4K7UA 4BFRA 3WA0A 2KFKA 1YD8U 5JH5C 1V9JA 2J0KA 4W9HA 5D7GA 4MSQB 2DZMA 1XD3B 1WMHA 2A5UA 1ISNA 2MP2A 2CHWA 1UZXB 5CHWA 2N7DA 4K81A 4ZYNA 3T9LA 4A3OA 3HM3A 1L7YA 3QC8B 4A20A 4NY0A 5DCNA 2ZZPB 1PQSA 4ASWC 4GB9A 5JZEB 3A9JB 3JSVB 2RSUA 2IO3B 2KFJA 3L0WB 2RD0A 3O65B 1UBIA 2M4NA 2K8BA 1WH3A 5D94A 2I1KA 1UBQA 2DYBA 4N9F4 3CSFA 4W9IA 3ZUNA 2M17A 2L0TA 3DVGX 2BPSA 4TKNA 4FA6A 2M1MA 1WFYA 4IM0A 5BO4B 3UINB 2L7RA 3WALA 2K1FA 2XK5A 3VTWA 2N9EB 4NJ7A 3ML9A 1G6JA 1GC7A 3ZKJC 3L10B 4NQKE 4MEMA 2EMTA 4DHZE 2KDFB 1J19A 3GOEA 2CR5A 2LVPA 2PE9A 1ZGUB 3JSVA 3PSEB 4IWQA 4W9LA 3VVWB 3T8MA 5LXHA 1ZKHA 1M94A 2KZRA 1VCBA 1OGWA 3VH4B 3ZDTA 4X57B 2PPHA 1P0RA 4NPNA 1J0GA 4DXAB 3A33B 3AU4A 4GN1A 2IO2B 1E8XA 3UGBB 4NQLB 5DPSA 3W1SC 5J17A 3A4RA 1Z5SB 4LJOB 2LI5A 1TTNA 4ZRIA 4DBGA 4ZRKA 3B1LX 2O6VB 2FCQA 3QHTA 3ZNHB 4GSWA 3V6EB 4BBNF 1WZ0A 3IG3A 1OTRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  2FNJ B;  2OOB B;  1YX5 B;  1WM2 A;  3TBL D;  1GG3 A;  4KIK B;  2BF8 B;  2KJH B;  2V1Y A;  3DQV A;  3ZLZ A;  4EZK A;  5DPW A;  3PRM B;  3NOB A;  3A1Q B;  3QIJ A;  4GDK B;  1EUV B;  1FXT B;  1KOT A;  2BGF A;  3TL5 A;  4W9F A;  1LM8 B;  2MBH A;  4HVB A;  3ENE A;  2LAS A;  3N3K B;  1GC6 A;  3KUD B;  5AZF A;  3R7Q A;  1WXV A;  4KVG B;  2KN5 A;  2V3S A;  3X0W A;  4G11 A;  1VD2 A;  1H4R A;  1WGG A;  2O6V A;  3QAR A;  5KHQ A;  2L3Z A;  5CX3 A;  4TQ0 A;  5G2N A;  3RZF A;  4G3X B;  4KIK A;  1WGD A;  2G3Q B;  2MW5 A;  1P98 A;  3KYD D;  4G0N B;  1V5O A;  4PYU A;  2KDE B;  2CHX A;  2YVC A;  3A1Q A;  2G45 B;  2FAZ A;  4GDK A;  2KLG A;  3DDC B;  4MH0 E;  2J0J A;  5AZG A;  1P3Q U;  1E7U A;  4EZJ A;  4RM8 A;  2HE7 A;  4F1S A;  3P2B A;  4EOY A;  4II2 B;  3SHQ A;  1L2N A;  3RT3 B;  3LDZ E;  3NHE B;  4GU2 A;  2JZZ A;  3VFK A;  4IC7 B;  1U4A A;  4RM9 A;  3PGE A;  1BT0 A;  3GZN I;  2BYF A;  4EFO A;  1LXD A;  1KJT A;  3PHX B;  1WMH B;  2IBI B;  3TIX A;  3SU8 X;  2MP2 B;  2MQJ A;  3B08 A;  3M3J A;  4HWI B;  5J18 A;  2DZI A;  4GOC A;  3UIP B;  2FCM A;  2G4S A;  2JZ3 B;  1V86 A;  3AUL A;  4FHJ A;  3S2A A;  1WM3 A;  3L13 A;  1OEY A;  4JIO U;  4MSM B;  4BKG A;  3DBR I;  2DAJ A;  4HDQ A;  5J2R A;  4GDL B;  4ANX A;  2XBB C;  1JRU A;  1LQB A;  2KDI A;  3IHP C;  1I42 A;  4WWO A;  5IA7 A;  1KLV A;  2KO3 A;  3U30 A;  4CO7 A;  2NBV B;  1Q0W B;  4AP4 C;  1WE6 A;  3ZDM C;  3A9K A;  3ECI A;  4K1R B;  3APF A;  2BYE A;  2CKH B;  4FJV B;  1E8W A;  1T0Y A;  2Z0E B;  4PS3 A;  2LGY A;  3PLU A;  3PLV A;  1WIA A;  2QHO A;  2XK5 B;  5LXI B;  2WX1 A;  2DX5 B;  3DBH I;  4MDK E;  4PS7 A;  1MG8 A;  2RGF A;  4M8N A;  2WDT B;  3L08 A;  4AJW A;  3ZRF A;  3PHW B;  4GDL A;  2DEN B;  3VHT C;  3CST A;  2NCN A;  2KX3 A;  1UEL A;  2IY0 B;  2R2Q A;  4AWJ A;  4BKT A;  1V81 A;  3TMP B;  4LDT D;  1TBE A;  2BYV E;  2GMI C;  2MRP A;  2N1W A;  1S3S G;  3H9D A;  3KYC D;  3APC A;  2ZPY A;  3ZNI D;  4CHK A;  5EDS A;  1WXA A;  3PTF C;  4DWF A;  3IBE A;  4B95 A;  4GMV A;  3HHM A;  4W9J A;  2K8H A;  3QX1 A;  2ZNV C;  3NZS A;  1F9J A;  2RR9 A;  1D3Z A;  2N1V A;  4IWP A;  2LUE A;  5C23 A;  3UF8 A;  3U7D A;  5E6N A;  2L8J A;  2ZNV B;  4HCP B;  1IPG A;  2LJ5 A;  3LJ3 A;  2MCN B;  3L16 A;  1UH6 A;  3ONS A;  3WAM A;  1WJN A;  4HJK A;  2LXA A;  3DVG Y;  2NBU A;  4ANW A;  3SD5 A;  4GGQ A;  3DVN U;  3QJZ A;  3M62 B;  4B6W A;  3CF6 E;  2FUH B;  4KZC A;  4GXB A;  1XQQ A;  2N7E A;  4XZ4 A;  3SDL C;  2KK8 A;  3EHV A;  1YQB A;  1RFA A;  2KLC A;  2C9W B;  5LLI A;  2JY6 A;  4EUT A;  2D07 B;  2EMS A;  2EKE C;  2MX2 A;  3RYT A;  2FIF A;  1AAR A;  2KVR A;  2UYZ B;  3N30 A;  3PV1 A;  4K7S A;  3ZRC A;  2KWV B;  1S1Q B;  1HE8 A;  2KD0 A;  2CHZ A;  3RD2 A;  1C3T A;  2HJ8 A;  5E6P A;  1EF5 A;  1WGH A;  2JWZ A;  3WIM A;  4HCN B;  2N4F A;  5G55 A;  4WJN A;  2K6D B;  1YX6 B;  2KWU B;  2ASQ A;  2AWT A;  2MSE D;  2R2O A;  4MGK E;  4WJP A;  3V62 A;  2G4D B;  4BOZ B;  4I6P A;  3AXC A;  1E8Z A;  2BKR B;  2JPH A;  1Q1O A;  2C7H A;  2IYD B;  2PEA A;  4W9D A;  2ZEQ A;  2ZPN A;  2KAN A;  2Z0D B;  1NDD A;  1E7V A;  3PPA A;  2GBJ A;  4PYZ A;  4ICU A;  2C7N B;  2HD5 B;  2LZ6 A;  2D2Q A;  3DVN V;  4A3P A;  2KWC A;  2CU1 A;  2WX0 A;  1GJZ A;  3H1U A;  1V5T A;  4IUM B;  1C1Y B;  4AJY B;  2KX0 A;  4E3C A;  4MEL A;  3JVZ X;  2L76 A;  1K8R B;  2O6V D;  4DHZ B;  1GNU A;  4TQ1 A;  3EC8 A;  1R4M I;  2LGX A;  3ZTD A;  5CHF A;  4FHK A;  4ANV A;  2IO0 B;  3PRZ A;  3VTU A;  4EKU A;  2DAF A;  4J6I A;  3MTN B;  1V6E A;  2FID A;  3B0A A;  5IAA C;  2JRI B;  1YIW A;  3M95 A;  4FUL A;  1IP9 A;  1I35 A;  4MGY E;  4WJO A;  2IZV B;  3ZIM A;  3NS8 A;  3OJ4 B;  3KH0 A;  1J8C A;  2KC1 A;  3PS6 A;  5FR6 A;  3A9K B;  2MA9 B;  1CMX B;  3R7R A;  3KW5 B;  3QWZ B;  5HKH A;  3R3M A;  4JQW C;  2AYO B;  1YJ1 A;  4DK5 A;  2PJH A;  4HDO A;  3PRE A;  2KQS A;  5C1Z A;  2ZVO A;  4BBN C;  4BKS A;  4KDL B;  2LVQ A;  2MBO A;  2OJR A;  3Q3J A;  5DPT A;  3NZU A;  1WY8 A;  4KSK C;  3OJ3 A;  4WJQ A;  3JW0 X;  1Q5W B;  3OAW A;  1WX9 A;  2D11 A;  2HTH A;  2IO1 B;  2NPT A;  3NY5 A;  3PT2 B;  3H7S A;  4HXD A;  5CTR C;  4IWO A;  2K39 A;  2NBW B;  4P7I A;  3WAP A;  3ZNZ B;  2DZK A;  3UIO B;  1WF9 A;  1WX7 A;  2DYM A;  1ZW7 A;  2JVC A;  2RPQ A;  5L83 A;  3EFU A;  3VH3 B;  1E5W A;  1SE9 A;  2L0F A;  3KVF B;  5D2M B;  2GBR A;  3UQB A;  4XC2 A;  3VQI A;  3IFW B;  3N32 A;  2DHZ A;  4FJZ A;  3KUZ A;  3OLM D;  4OVV A;  4OVU A;  1X1M A;  4WAA A;  4GIV A;  3RUL A;  4ZDV A;  4IG7 B;  2W9N A;  2AL6 A;  3JYU A;  2BKF A;  4E74 A;  2Z59 B;  2KOX A;  4LJP B;  3IVF A;  1XT9 B;  1WRD B;  2CS4 A;  1SGH A;  2BWF A;  1WXM A;  2NS5 A;  1WJU A;  4BVU C;  4EZL A;  2C7M B;  3H7P B;  3DBL I;  3ALB A;  4TV3 A;  1A5R A;  3VUX A;  2KMC A;  3D32 A;  2FCS A;  1WR1 A;  2GBK A;  4FAD A;  5DPR A;  4HPM B;  1WR6 E;  3BIN A;  2N9P C;  3TJP A;  2KDB A;  4ICV A;  2VRR B;  1GUA B;  1WGY A;  4MJS A;  3VUY A;  2UWQ A;  4NAW A;  2LGD A;  1NI2 A;  2ZCB A;  3RZW C;  2Y5B B;  3I3T B;  4I6L B;  2O2V B;  4M8M A;  4WWP A;  1WJ6 A;  4KDI C;  4AOF A;  2M8S A;  3ZO5 B;  5L95 C;  3M63 B;  2PE6 B;  1WXS A;  2IY1 B;  4E71 A;  5JHB A;  4RMA A;  3VTV A;  4W9K A;  2ZCC A;  2A4Z A;  4WQO B;  2YLM A;  3HIZ A;  3HM6 X;  2GOW A;  1EO6 A;  3X23 A;  1UD7 A;  2NR2 A;  2REX A;  3H7P A;  4K7W A;  1WI0 A;  2LD9 A;  1WGR A;  1OEY J;  4JGH B;  4G50 A;  3ZNG C;  4DDI D;  2ZVN A;  2KJR A;  2KTF A;  2L05 A;  4MM3 A;  3AI5 A;  2WWZ A;  2XEW A;  4ANU A;  3ZW3 A;  4II3 B;  4DHJ B;  1V2Y A;  2DYO A;  4TUU A;  3A9J A;  1RAX A;  3L54 A;  2JF5 A;  4WWN A;  5GMV A;  4KV2 A;  2KKC A;  2B3A A;  2O2V A;  3Q3F A;  4NNJ B;  4F8C B;  2JRH A;  1Z2M A;  1WZ3 A;  4BOS C;  2BWE S;  2KMA A;  2MBE A;  2LVO A;  1UGM A;  2L00 B;  2MBQ A;  4FLH A;  3W1Y A;  4HPL B;  2LRW A;  2D10 A;  4JLC A;  5AEK B;  1H8C A;  2JXX A;  1WX8 A;  4FBJ B;  3DBS A;  2C5L C;  3R66 C;  5JHA A;  3DOW A;  3VDZ A;  2AEH A;  4HK2 A;  4URK A;  4PS8 A;  3CMM B;  1P9D U;  2I1J A;  5CHV C;  3ZTC A;  3V6C B;  1WJ4 A;  2AL3 A;  3DPD A;  4NJ6 A;  3VAW A;  3PZD A;  2K25 A;  1NBF C;  3KUC B;  3RCZ A;  4DHJ D;  5TR5 A;  1WYW B;  2J0M A;  4KSL C;  2J7Q B;  3BY4 B;  3C0R B;  3A4S C;  3U8Z A;  3VXW A;  5E6O A;  4IW0 A;  2KC2 A;  4ZRJ A;  2KXJ A;  2NPT B;  1IYF A;  3W1S A;  2K8C A;  2KQ7 A;  4W9C A;  3L17 A;  3APD A;  1RLF A;  4FJY A;  1OQY A;  1V80 A;  2KJ6 A;  4M0W B;  2KHW B;  3EEC A;  4MGZ E;  3PRP B;  2MWS B;  2LRU A;  3QA8 A;  2NVU I;  4JL9 A;  4B9K A;  4CYE A;  3PVL A;  3QCA A;  1TGZ B;  4F7Z A;  4W9E A;  3V60 A;  3RUI B;  4DDG D;  2GBM A;  4I6N B;  2KTR B;  2WYQ A;  1EF1 A;  2JUO A;  2ZJD A;  2D3G A;  2KNB A;  3VUW A;  1WE7 A;  2M0X A;  4XX5 A;  4BKS D;  4AUQ C;  1SIF A;  2JT4 B;  1Y8R C;  2V4L A;  1E90 A;  2KFK B;  3K9O B;  1RRB A;  3HK0 A;  5KHO A;  3ZVV A;  2LWP A;  3QK0 A;  5D6J B;  3TCA A;  3WAN A;  4EEW A;  3K9P B;  4LCD E;  2FCN A;  1TZ1 A;  3V61 A;  4IM3 A;  2GBN A;  1E8Y A;  4W9G A;  1KM7 A;  3H6N A;  3UQA A;  3QQ8 B;  1R4N I;  2MLB A;  2K6Q A;  1LFD A;  3MJW A;  4HLE A;  5AZH A;  3QAQ A;  1P1A A;  2C60 A;  3WAO A;  2KTR A;  3DCG A;  3ML8 A;  4LDT B;  4IM2 A;  4MJS B;  4NAW B;  2MBB B;  2LXC A;  2N9X A;  4FN2 A;  4KZ0 A;  4YL8 A;  3MHS D;  4MGI E;  1QZE A;  1V49 A;  2DZJ A;  4K7U A;  4BFR A;  3WA0 A;  2KFK A;  1YD8 U;  5JH5 C;  1V9J A;  2J0K A;  4W9H A;  5D7G A;  4MSQ B;  2DZM A;  1XD3 B;  1WMH A;  2A5U A;  1ISN A;  2MP2 A;  2CHW A;  1UZX B;  5CHW A;  2N7D A;  4K81 A;  4ZYN A;  3T9L A;  4A3O A;  3HM3 A;  1L7Y A;  3QC8 B;  4A20 A;  4NY0 A;  5DCN A;  2ZZP B;  1PQS A;  4ASW C;  4GB9 A;  5JZE B;  3A9J B;  3JSV B;  2RSU A;  2IO3 B;  2KFJ A;  3L0W B;  2RD0 A;  3O65 B;  1UBI A;  2M4N A;  2K8B A;  1WH3 A;  5D94 A;  2I1K A;  1UBQ A;  2DYB A;  4N9F 4;  3CSF A;  4W9I A;  3ZUN A;  2M17 A;  2L0T A;  3DVG X;  2BPS A;  4TKN A;  4FA6 A;  2M1M A;  1WFY A;  4IM0 A;  5BO4 B;  3UIN B;  2L7R A;  3WAL A;  2K1F A;  2XK5 A;  3VTW A;  2N9E B;  4NJ7 A;  3ML9 A;  1G6J A;  1GC7 A;  3ZKJ C;  3L10 B;  4NQK E;  4MEM A;  2EMT A;  4DHZ E;  2KDF B;  1J19 A;  3GOE A;  2CR5 A;  2LVP A;  2PE9 A;  1ZGU B;  3JSV A;  3PSE B;  4IWQ A;  4W9L A;  3VVW B;  3T8M A;  5LXH A;  1ZKH A;  1M94 A;  2KZR A;  1VCB A;  1OGW A;  3VH4 B;  3ZDT A;  4X57 B;  2PPH A;  1P0R A;  4NPN A;  1J0G A;  4DXA B;  3A33 B;  3AU4 A;  4GN1 A;  2IO2 B;  1E8X A;  3UGB B;  4NQL B;  5DPS A;  3W1S C;  5J17 A;  3A4R A;  1Z5S B;  4LJO B;  2LI5 A;  1TTN A;  4ZRI A;  4DBG A;  4ZRK A;  3B1L X;  2O6V B;  2FCQ A;  3QHT A;  3ZNH B;  4GSW A;  3V6E B;  4BBN F;  1WZ0 A;  3IG3 A;  1OTR B; 
#chains in the Genus database with same CATH topology
 4EE2 A;  2V1Y A;  3ZLZ A;  2NTT A;  3J9C A;  3Q8F A;  2I2Y A;  3VRA B;  3IXS A;  1KOT A;  2BGF A;  3N1Y C;  1E10 A;  1LM8 B;  1ESF A;  3AE8 B;  1STE A;  2LAS A;  2WHI A;  3KUD B;  1SE4 A;  1N61 A;  1K52 A;  2V3S A;  2WLB A;  1VD2 A;  1WGG A;  1SF0 A;  2WXK A;  3SEB A;  4S17 A;  4TQ0 A;  3VRB B;  4G0N B;  3KYD D;  4MAC A;  2PW9 A;  1TKG A;  2G45 B;  3CIR B;  4GDK A;  3DDC B;  3AH7 A;  1P3Q U;  1R4N B;  3P2B A;  4II2 B;  1L2N A;  3AE9 B;  3RT3 B;  4HPP A;  2KMM A;  4RM9 A;  3GZN I;  3NZ3 A;  2MQJ A;  4HWI B;  4GOC A;  3UIP B;  4FHJ A;  2KN4 A;  1L6U A;  1OEY A;  4BKG A;  1TS3 A;  1UNS A;  3DBR I;  4HDQ A;  2XBB C;  3IHP C;  1AN8 A;  2KDI A;  1KLV A;  1C4C A;  1VJK A;  2KO3 A;  4CO7 A;  1PGA A;  4P6V F;  4YSY B;  3NRZ A;  3ZDM C;  1TY0 A;  3DWG C;  1SJE D;  4L2Y A;  1DOX A;  5LXI B;  2QHO A;  4KX6 B;  3I63 C;  4MDK E;  4PS7 A;  3KWL A;  2WDV B;  2RGF A;  2WXG A;  4RFB A;  1JW9 D;  1JWU D;  3PHW B;  3B2F A;  5FK9 C;  3UI3 A;  2RDG A;  3I57 A;  4AWJ A;  4US8 A;  3MC9 A;  2JX5 A;  1I4H A;  4K3C A;  2BYT A;  1TBE A;  2GMI C;  2MRP A;  4Q2J A;  1QOG A;  1FIQ A;  3KYC D;  1MVK A;  2WXI A;  3ZNI D;  5EDS A;  1WXA A;  4GMV A;  2K8H A;  3NZS A;  1GOZ A;  1D3Z A;  3UF8 A;  3U7D A;  5E6N A;  4HCP B;  1E9M A;  2LJ5 A;  2QIL A;  4LNO A;  4HJK A;  2D5G A;  2WXJ A;  4GGQ A;  4KGT A;  1WYG A;  3QJZ A;  1C76 A;  4B6W A;  1QOA A;  4XZ4 A;  3TUO A;  2D07 B;  2UYZ B;  2MH7 A;  2KD0 A;  3Q3N C;  2JWZ A;  3WIM A;  4HCN B;  2K6D B;  2AWT A;  1SEB D;  1YN4 A;  2MJ3 A;  2IYD B;  1HZ6 A;  2PEA A;  2GBJ A;  3T3O A;  2KWC A;  4HKZ E;  4M02 A;  3NVV A;  4DHZ B;  2JSV X;  3EC8 A;  3ZTD A;  2DLB A;  4FHK A;  3ZXV A;  2FID A;  3R8B A;  2IPK D;  4FUL A;  1NYQ A;  2E6X A;  3NS8 A;  3FKY A;  3KH0 A;  1J8C A;  3LB8 C;  3R7R A;  1K53 A;  3B9J A;  1DYQ A;  2AYO B;  1L4D B;  3PRE A;  1EU4 A;  4KDL B;  5BYR A;  2LVQ A;  4N6E B;  5DPT A;  3NZU A;  4WJQ A;  3JW0 X;  1Q5W B;  3OAW A;  5CTR C;  3H7S A;  5JXV A;  4IWO A;  2LJI A;  4LLG M;  1WX7 A;  3L4P A;  1GB4 A;  1ZW7 A;  3EGR A;  3EFC A;  5BYS A;  3UQB A;  3ZJT A;  2B76 B;  2BTE A;  3VR9 B;  1V1P B;  2ZW1 A;  2AL6 A;  4WUR A;  3AE4 B;  3JYU A;  2K5P A;  2Z59 B;  1XLP A;  1V8C A;  4A90 A;  1WXM A;  4BVU C;  3DBL I;  2IGD A;  3ALB A;  3SR6 A;  2GBK A;  4FAD A;  1CQV A;  1TT5 B;  2HDE A;  1WGY A;  3VUY A;  3I3T B;  4I6L B;  4WWP A;  1QF6 A;  1ZDX A;  4KDI C;  2RDH A;  4YTM B;  1D6E C;  3M63 B;  2YLM A;  5EE3 A;  1DGJ A;  1QT9 A;  4JPS A;  3TEX A;  2NR2 A;  3H7P A;  3R2T A;  1WI0 A;  2LD9 A;  4K7W A;  1OEY J;  2ZVN A;  2KTF A;  2V0G A;  3AI5 A;  2WWZ A;  2IDY A;  2XEW A;  4II3 B;  1L0Y B;  4TUU A;  1RAX A;  2JF5 A;  4KV2 A;  2B3A A;  2O2V A;  4C7Z A;  1Z2M A;  4BOS C;  3E56 A;  2Y5P A;  2KMA A;  3RPF C;  1WWT A;  4HPL B;  2LRW A;  4JLC A;  1H8C A;  5AEK B;  5JHA A;  2EEL A;  2AEH A;  4PS8 A;  3CMM B;  1WJ4 A;  3DPD A;  3RCZ A;  2CJN A;  3A4S C;  5E6J A;  2G9H D;  4ZRJ A;  2QSD A;  1J7B A;  3MFG A;  5H8Y E;  3W1S A;  3Q14 C;  4W9C A;  1OQY A;  1FCL A;  2W3R A;  4KGR A;  4WAF A;  3QA8 A;  1NVI D;  3PVL A;  4W9E A;  4I6N B;  2ZJD A;  1EF1 A;  2KAC A;  1WE7 A;  1YNT E;  2KFK B;  1KRH A;  3T3N A;  1RRB A;  3QK0 A;  1N5X A;  4M0W A;  1HEZ E;  4IM3 A;  2GBN A;  3P1M A;  3UQA A;  1R4N I;  3MJW A;  1JCK B;  2KTR A;  4LDT B;  4NAW B;  2MBB B;  4FN2 A;  4ZHP A;  3MHS D;  1I7H A;  1QZE A;  1V49 A;  4MGI E;  1T3Q A;  5JH5 C;  1V9J A;  2J0K A;  3DHG C;  3PZ8 A;  2DZM A;  3R2I A;  1XD3 B;  2MP2 A;  2CHW A;  1BXT A;  3HM3 A;  4TSS A;  4MM3 B;  4NY0 A;  4JX1 C;  2IO3 B;  2E3T A;  4MT5 A;  5AUI A;  2M4N A;  2I1K A;  1UBQ A;  1NI3 A;  3EUB 2;  1LO5 D;  3ZUN A;  1OFF A;  2L0T A;  3DVG X;  2BPS A;  3AMZ A;  3UIN B;  1WFY A;  3WAL A;  2XK5 A;  3VTW A;  3U2S C;  3FAH A;  1G6J A;  2J4X A;  3JSV A;  3VVW B;  3T8M A;  1GPX A;  1ZPS A;  1TKY A;  1M94 A;  1J7C A;  2HJ1 A;  2KZR A;  2JQR B;  1J0G A;  3W1S C;  3AU4 A;  4GN1 A;  2IO2 B;  1E8X A;  5J17 A;  2V9H A;  1Z5S B;  3HVZ A;  3QHT A;  3V6E B;  1WZ0 A;  3M95 A;  3MJ5 A;  2FNJ B;  2JYT A;  3TBL D;  2BF8 B;  3DQV A;  2QMT A;  3NOB A;  4GDK B;  1ZDV A;  1FXT B;  3TL5 A;  3W5V B;  3BZD B;  1YMH E;  4W9F A;  3W9C B;  3N3K B;  1GC6 A;  3R7Q A;  1MFW A;  4UDU C;  1GB1 A;  2MJE A;  1UWM A;  3P63 A;  3QAR A;  2WQY B;  3AEE B;  3AN1 A;  5CX3 A;  3RZF A;  2WXP A;  2LMC A;  4G3X B;  4KIK A;  2G3Q B;  3A1Q A;  1IGD A;  2FAZ A;  4MH0 E;  4EZJ A;  4RM8 A;  2HE7 A;  3DHH C;  4EOY A;  3SHQ A;  3LDZ E;  1C77 A;  4GU2 A;  4LTU A;  3VFK A;  1PUT A;  3BK1 A;  3PGE A;  5FKA C;  2BYF A;  1LXD A;  3TIX A;  3SU8 X;  3B08 A;  5J18 A;  2FCM A;  1AWD A;  3S2A A;  1WM3 A;  3DBL B;  1F0Z A;  1T6B X;  1I42 A;  2EKI A;  1JRU A;  4WWO A;  5GXG B;  4AP4 C;  1WE6 A;  4USA A;  3A9K A;  3ECI A;  3APF A;  1T0Y A;  2H88 B;  2LGY A;  3Q3M C;  3BK2 A;  1Y56 A;  3H8H A;  1D5X C;  1IGC A;  2QDF A;  4M8N A;  3L08 A;  4AJW A;  3ZRF A;  5AUK A;  1D4B A;  3VHT C;  3CST A;  2NCN A;  4B0E A;  1V81 A;  5D3I B;  3Q6B A;  3FIL A;  2ZNV C;  3V3X A;  2LUE A;  1IPG A;  1V1O A;  3LJ3 A;  2MCN B;  1WJN A;  1F1H A;  3SD5 A;  1JML A;  2FUH B;  4GXB A;  1RFA A;  1P7F A;  2KLC A;  1T0S C;  2K0P A;  3E9S A;  2MX2 A;  2QC8 A;  2KVR A;  3V05 A;  3PV1 A;  1HTO A;  3Q8C A;  2HJ8 A;  2XN9 C;  5E6P A;  1EF5 A;  1V97 A;  4ARI A;  2AQ2 B;  2ASQ A;  4WJP A;  2W3S A;  1JQ4 A;  1E8Z A;  2WGS A;  2ZPN A;  4C56 C;  1AW7 A;  4LNI A;  3RNC C;  4ICU A;  2LZ6 A;  2Z8L A;  3DVN V;  2R61 A;  4C80 A;  1F52 A;  4IUM B;  4AJY B;  1YN3 A;  4LK0 M;  3TEY A;  3JVZ X;  2L76 A;  1K8R B;  2O6V D;  4TQ1 A;  3GE3 C;  1R4M I;  1TY2 A;  1MG4 A;  4EKU A;  4AS1 A;  4J6I A;  1V6E A;  3B0A A;  5IAA C;  1YIW A;  1LGR A;  1N5W A;  1EWY C;  5G5H A;  3NUH B;  3W2D A;  1HQR D;  3OJ4 B;  3PS6 A;  5IKC M;  4L1B A;  4YTP B;  2INN E;  3NS1 A;  5HKH A;  2PMV A;  2JZP A;  1XCT L;  1YJ1 A;  4DK5 A;  4PK1 A;  4HDO A;  3BYY B;  4BKS A;  1RWS A;  2IGH A;  4BZA A;  4HXD A;  2HTH A;  2CJO A;  4P7I A;  3ZNZ B;  3Q8E A;  5BYQ A;  4CQN A;  1E5W A;  2FUG 1;  2XNA C;  2WXF A;  1QLB B;  4REZ A;  4XC2 A;  3N32 A;  2DHZ A;  4OVV A;  1X1M A;  4IG7 B;  2KT7 A;  2PVG C;  2W9N A;  1XO3 A;  3GB1 A;  1CJE A;  4E74 A;  2QCZ A;  2KOX A;  2PLP A;  3AEG B;  1QIL A;  1WRD B;  5C3J B;  2BWF A;  2D3C A;  1SBB B;  1TS4 A;  3H7P B;  3VUX A;  2KMC A;  2ONQ A;  2FCS A;  1WR1 A;  3AE5 B;  5MPO A;  5HI1 A;  2VRR B;  1GUA B;  3OG5 A;  1OQQ A;  2M0A A;  2LGI A;  1NI2 A;  1T0R C;  2Y5B B;  2O2V B;  4XDD A;  1WJ6 A;  1WXS A;  4RMA A;  2ZCC A;  2A4Z A;  3HM6 X;  1XLN A;  2GOW A;  1KF6 B;  3N9Y C;  4ZHO A;  1HTQ A;  4G50 A;  3ZNG C;  4XWT A;  1SXT A;  4DHJ B;  5GMV A;  1TJE A;  1I4R A;  1MI0 A;  1WZ3 A;  2MBE A;  2KQ4 X;  2L00 B;  2DNF A;  4FLH A;  1F2R C;  3Q3O C;  1PDX A;  3DBS A;  2C5L C;  3VDZ A;  1NYR A;  4HK2 A;  3ABV B;  1KLU D;  3ZTC A;  4NJ6 A;  3PZD A;  1TKE A;  1VDV A;  1NBF C;  4DHJ D;  3BY4 B;  3C0R B;  3U8Z A;  3RFZ B;  1IBX B;  3OWE B;  2KC2 A;  2NPT B;  3KLS X;  1IYF A;  3AE3 B;  3GE8 C;  4LNK A;  2K8C A;  2KQ7 A;  3APD A;  4FJY A;  4M0W B;  3PRP B;  4JL9 A;  4CYE A;  3QCA A;  3V60 A;  2KTR B;  5HG2 A;  2D3G A;  2KNB A;  2M0X A;  4XX5 A;  4AUQ C;  1VRA B;  1Y8R C;  2V4L A;  4C4V B;  2JU6 X;  5D6J B;  3EA6 A;  2JWU A;  3Q2A C;  4WIP A;  2KDM A;  3K9P B;  1BUI C;  1E8Y A;  1KM7 A;  4GLS C;  4WH4 A;  3SFD B;  5AZH A;  1P1A A;  3WAO A;  4MJS B;  2J52 A;  4IM2 A;  4KZ0 A;  2LXC A;  2N9X A;  4K7U A;  4JWS C;  4D2K A;  1UF0 A;  5D7G A;  4MSQ B;  1T5X D;  2A5U A;  4QAY A;  4K81 A;  3T9L A;  4RF0 A;  4A3O A;  2DBY A;  3QC8 B;  1C79 A;  2ZZP B;  1PQS A;  2N0S B;  3AEC B;  3A9J B;  3JSV B;  3L0W B;  3O65 B;  3N1Z C;  2V3N A;  1E7P B;  4HRO A;  3VR8 B;  3Q8A A;  4XE0 A;  4W9I A;  1N63 A;  4OZA A;  2M1M A;  3AV8 A;  1P7E A;  3I5J C;  1GC7 A;  3L10 B;  1EWC A;  1FPY A;  3RNB C;  2YEP B;  1ET6 A;  1J19 A;  3GOE A;  3PSE B;  4IWQ A;  1BML C;  4HJG E;  3VH4 B;  2J53 A;  5TSS A;  1WRI A;  1P0R A;  1R4M B;  3UGB B;  3NVZ A;  4ZRP A;  2J42 A;  4LJO B;  3C8Y A;  4ZRI A;  4RNA A;  2LEK A;  3B1L X;  4K7S A;  2DWQ A;  2OOB B;  1WM2 A;  2L52 A;  1GG3 A;  4KIK B;  1MHX A;  4EZK A;  2W54 A;  3PRM B;  3A1Q B;  3QIJ A;  4A8X C;  1EUV B;  4MH8 A;  5AZF A;  1WXV A;  2KN5 A;  4G11 A;  1H4R A;  3NVY A;  5KHQ A;  2L3Z A;  2W82 A;  1UWX A;  2KAJ A;  5G2N A;  3ZXR A;  1WGD A;  2MW5 A;  2IND C;  1V5O A;  1WSP A;  4DXF A;  4PYU A;  5C1Z A;  2UU7 A;  3MHZ A;  2KLG A;  2K3U A;  4A9A A;  3N20 C;  1SIJ A;  1R7S A;  4XDC A;  3NHE B;  3TEZ A;  3ZGZ A;  1JAL A;  1BT0 A;  1KJT A;  2V4I B;  3PHX B;  1WMH B;  3M3J A;  1QQR A;  2G4S A;  1V86 A;  3AUL A;  3L13 A;  1AYF A;  1QKZ A;  4MSM B;  5J2R A;  4LNN A;  3U4E G;  5IA7 A;  3AEF B;  3ETR A;  1XEE A;  1FXI A;  3BVZ A;  4K1R B;  4AQ7 A;  2CKH B;  1HZ5 A;  1FNU A;  1KH0 A;  2Z0E B;  3I9V 1;  3FIL B;  3HUI A;  2DX5 B;  4WQM A;  1M4V A;  1MG8 A;  2WDT B;  4GDL A;  2DEN B;  4IKG A;  2KX3 A;  1UEL A;  2R2Q A;  4RGT A;  1JRO A;  2LHD A;  3TMP B;  4LDT D;  1DOY A;  1FFU A;  2I38 A;  2N1W A;  1S3S G;  1D5Z C;  1KTK A;  4RGO S;  3IBE A;  4B95 A;  3HHM A;  3QX1 A;  1YN5 A;  1F9J A;  2RR9 A;  2RMM A;  2KYW A;  3ONS A;  4OW0 A;  3FC4 A;  2D3A A;  3DVG Y;  1CK1 A;  2SAK A;  2PVO D;  3M62 B;  2VH1 A;  2WXO A;  2N7E A;  3EHV A;  2JY6 A;  2X8X X;  1HXY D;  2BT6 A;  3RYT A;  2FIF A;  1AAR A;  1MHH E;  1S1Q B;  1HE8 A;  5H92 C;  3RD2 A;  1WGH A;  1IUE A;  2N4F A;  5G55 A;  4WJN A;  1YX6 B;  3LYY A;  2MSE D;  2R2O A;  4BOZ B;  4MGK E;  1TS2 A;  2LFI A;  4I6P A;  3AXC A;  2JPH A;  1Q1O A;  2C7H A;  4W9D A;  2ZEQ A;  2WU5 B;  2Z0D B;  1NDD A;  1E7V A;  2C7N B;  2HD5 B;  4KKJ A;  2L83 A;  4A3P A;  1GJZ A;  3H1U A;  3RNF C;  1V5T A;  2KX0 A;  4E3C A;  1GNU A;  1FMA D;  2LGX A;  5CHF A;  2ON8 A;  3PRZ A;  3VTU A;  2DAF A;  3MTN B;  4YTN B;  1I35 A;  2JRI B;  1IP9 A;  4MGY E;  1C9F A;  3RNA C;  3ZIM A;  1EM7 A;  1JWB D;  1YJJ A;  2NMQ A;  1FFV A;  2PKO A;  2MA9 B;  1CMX B;  2OED A;  3KQ4 A;  3QWZ B;  3R3M A;  4JQW C;  4RH6 A;  2WXR A;  1HA5 A;  4RGM A;  1KFY B;  2OJR A;  2MBO A;  3DBH B;  4OHJ A;  3P4R B;  5T8I A;  3OJ3 A;  2IJ0 A;  4C7Y A;  1FRR A;  1WX9 A;  2BS3 B;  2D11 A;  1GAQ B;  3NY5 A;  3PT2 B;  2N9K A;  1QOF A;  4J3O D;  3WAP A;  2DZK A;  3UIO B;  2W55 A;  2GB1 A;  1T0Q C;  1K51 A;  1SE9 A;  3ZYY X;  3IFW B;  4FJZ A;  4BAX A;  4OVU A;  3TEW A;  3AEA B;  3RUL A;  4ZDV A;  4A6Q A;  4LJP B;  5HFY A;  2D3B A;  1XT9 B;  2WXN A;  1WJU A;  4EZL A;  2C7M B;  3U52 E;  4TV3 A;  3D32 A;  1NEN B;  1I4X A;  4HPM B;  3BIN A;  2N9P C;  3TJP A;  2KDB A;  4ICV A;  4OVZ A;  4NAW A;  2LGD A;  2ZCB A;  4O1N A;  2MJD A;  2WNM A;  4M8M A;  4YSZ B;  4US9 A;  2M8S A;  5L95 C;  5D3D A;  4E71 A;  4WQO B;  3BWU D;  3HIZ A;  1EO6 A;  2HTM E;  2V3P A;  2REX A;  4P1B C;  3U7Z A;  5BMH A;  1CZP A;  4DDI D;  4XWW A;  2FE8 A;  1MJD A;  2L05 A;  4MM3 A;  4ANU A;  2DYO A;  4WWN A;  2JRH A;  1F77 A;  1PGB A;  5EE1 A;  5HHD G;  4S0R A;  4IDI A;  2LVO A;  2MBQ A;  3W1Y A;  2D10 A;  3O13 A;  1WX8 A;  3R66 C;  1D5M C;  2X38 A;  1P9D U;  2I1J A;  1UGJ A;  4OZC A;  3V6C B;  2K25 A;  3KUC B;  5TR5 A;  2J0M A;  4KSL C;  4K3B A;  3MP9 A;  4DQO C;  3AE1 B;  1SE3 A;  5E6O A;  1L5P A;  3NG0 A;  3P4Q B;  4DXG A;  2ICI A;  2FBW B;  1N6Z A;  3L17 A;  3B2G A;  1UUP A;  2KHW B;  3EEC A;  4ARC A;  2N9L A;  4MGZ E;  3WCQ A;  4B9K A;  5IP4 D;  2NTS A;  4DDG D;  2GBM A;  4JE3 B;  3RN9 C;  4YT0 B;  1SIF A;  2LHE A;  3K9O B;  3HK0 A;  3TCA A;  4EEW A;  4NJC A;  3V61 A;  4LCD E;  2FCN A;  3QQ8 B;  2MLB A;  1SJH D;  4HLE A;  3DCG A;  1XLO A;  4YL8 A;  2AX5 A;  4BFR A;  1RM6 C;  2Q5W D;  4W9H A;  4NAM A;  2PTL A;  2RDB C;  2RPV A;  4R3D A;  5CHW A;  1SSN A;  2N7D A;  1L7Y A;  1JWM D;  5DCN A;  4ASW C;  5JZE B;  4YWG G;  2WDR B;  3P4P B;  1NEK B;  1QOB A;  2RSU A;  1UBI A;  1WH3 A;  4ZOH C;  1ZOY B;  2DYB A;  4N9F 4;  3CSF A;  2M17 A;  3GS2 A;  4TKN A;  2L7R A;  2KVZ A;  2WP9 B;  2JYE A;  2N9E B;  2GI9 A;  4NJ7 A;  3ML9 A;  3AE2 B;  1PFD A;  4NQK E;  2EMT A;  2CR5 A;  2PE9 A;  3RMK C;  1ZGU B;  1ZKH A;  2IGG A;  1VCB A;  1OGW A;  1XF5 L;  5IO9 A;  3ZDT A;  4DXA B;  3IAM 1;  4ZRQ A;  4NQL B;  3DWM A;  4H2A A;  2FCQ A;  3ZNH B;  4GSW A;  4BBN F;  1OTR B;  3AU5 A;  4A55 A;  1YX5 B;  2KJH B;  3BVG A;  5DPW A;  4KGS A;  2MHJ A;  3IAS 1;  2GRI A;  2MBH A;  4HVB A;  3ENE A;  4KVG B;  3X0W A;  3PO0 A;  2O6V A;  4RF1 A;  1FRD A;  1P98 A;  1MPE A;  1ENF A;  2AQ3 B;  3CWI A;  1RYJ A;  2CHX A;  2KDE B;  2YVC A;  4W9K A;  1ET9 A;  2J0J A;  5AZG A;  1E7U A;  2WDQ B;  3AED B;  2INC C;  4F1S A;  1F2R I;  2WXQ A;  2JZZ A;  4IC7 B;  1U4A A;  4EFO A;  2IBI B;  2MP2 B;  2DZI A;  4C00 A;  3AEB B;  2JZ3 B;  5FR3 A;  1I4G A;  4JIO U;  3AE7 B;  5EE9 A;  2M19 A;  2DAJ A;  2BS2 B;  4GDL B;  4ANX A;  4ACF A;  1LQB A;  1RFK A;  4HEA 1;  3U30 A;  4KKI A;  1FNV A;  2NBV B;  1Q0W B;  2K9X A;  2WXM A;  1TS5 A;  2K22 A;  1L4Z B;  2BYE A;  4FJV B;  1E8W A;  4PS3 A;  3PLU A;  4P1C C;  1JRP A;  3PLV A;  1L0V B;  1WIA A;  2XK5 B;  2WX1 A;  3DBH I;  2Y3A A;  1I4Q A;  1ZXI A;  3BYT B;  4NZL B;  2IY0 B;  4BKT A;  2OHF A;  1FEH A;  2BYV E;  1I4P A;  1Q10 A;  3H9D A;  3APC A;  2ZPY A;  4CHK A;  4HRS A;  3PTF C;  1FD6 A;  4DWF A;  3LXF A;  4W9J A;  2N1V A;  2VZK B;  4IWP A;  5C23 A;  2KWD A;  2L8J A;  2ZNV B;  3L16 A;  1UH6 A;  3WAM A;  2LXA A;  2NBU A;  4ANW A;  3DVN U;  3MC0 B;  3SFE B;  3CF6 E;  4M00 A;  4KZC A;  1XQQ A;  3SDL C;  2KK8 A;  3ZJV A;  2TSS A;  1YQB A;  2C9W B;  5LLI A;  4EUT A;  2EMS A;  3NVW A;  2EKE C;  5LNK 1;  1SE2 A;  3RNE C;  3N30 A;  3ZRC A;  2KWV B;  2BVC A;  2WXH A;  2CHZ A;  1VR9 A;  1C3T A;  1JWA D;  1YOV B;  2VZK D;  2KWU B;  3V62 A;  4JWU C;  2G4D B;  2G1E A;  2BKR B;  2JXT A;  1FNW A;  2KAN A;  3MC8 A;  3PPA A;  4RCO A;  4PYZ A;  2LUM A;  2D2Q A;  2CU1 A;  1YJI A;  2WX0 A;  4XYC A;  3AE6 B;  1C1Y B;  3P4S B;  4IOI E;  4MEL A;  4ZYS A;  3GZN B;  4M01 A;  1K50 A;  4WWM A;  1TYG B;  2M56 B;  5I4D A;  4ANV A;  2IO0 B;  3KWV A;  2BBC A;  4WJO A;  3BVM A;  2IZV B;  5EE0 A;  3W5U B;  2CU3 A;  2L32 A;  3DBR B;  2KC1 A;  2INP E;  5FR6 A;  3A9K B;  3KW5 B;  2WS3 B;  4RGN A;  2MEK A;  1VLB A;  2PJH A;  1XLQ A;  1C4P A;  1E0Z A;  3AB5 A;  2KQS A;  2ZVO A;  1XXG A;  4BBN C;  3Q3J A;  1WY8 A;  4KSK C;  1IBX A;  1ZUD 2;  3Q8B A;  2IO1 B;  2NPT A;  2K39 A;  2NBW B;  1WF9 A;  2DYM A;  4L23 A;  2JVC A;  2YEP F;  2RPQ A;  5L83 A;  3EFU A;  3VH3 B;  1FCC C;  3RNG C;  3P42 A;  1JWS D;  2L0F A;  3KVF B;  5D2M B;  1C4A A;  2GBR A;  4FXC A;  2BB6 A;  3VQI A;  3DHI C;  3KUZ A;  1N60 A;  3OLM D;  4WAA A;  4GIV A;  2BKF A;  1E6E B;  4C4V A;  3IVF A;  2CS4 A;  1SGH A;  3Q69 A;  2NS5 A;  1ACC A;  2L1A A;  5G5G A;  1A5R A;  5DPR A;  1WR6 E;  4MJS A;  2UWQ A;  1V1P A;  3RZW C;  1VZ8 A;  1A70 A;  1PGX A;  4AOF A;  1N62 A;  3ZO5 B;  2PE6 B;  2IY1 B;  5JHB A;  3VTV A;  5BMG A;  5IN7 A;  3X23 A;  1UD7 A;  3RI7 C;  3HRD D;  1WGR A;  4JGH B;  5IOI A;  2BW2 A;  1DOI A;  2KJR A;  3GP7 A;  3ZW3 A;  2QJL A;  1V2Y A;  4TMA B;  3N1X C;  3A9J A;  3L54 A;  1TIF A;  4PT5 A;  2SEB D;  2KKC A;  4N58 A;  3Q3F A;  4NNJ B;  4F8C B;  3ZQ4 A;  2BWE S;  1UGM A;  2N7J A;  1SB3 C;  1C78 A;  1L0X B;  2JXX A;  4FBJ B;  3DOW A;  3PZ7 A;  1ZXH A;  4URK A;  4OZB A;  2GLS A;  5CHV C;  1L6V A;  2AL3 A;  1VZ6 A;  3VAW A;  1WYW B;  2J7Q B;  3VXW A;  1YQ4 B;  1XCQ L;  4IW0 A;  2BS4 B;  4XGA B;  2WXL A;  1B1Z A;  2KXJ A;  1RLF A;  3IT4 B;  1V80 A;  2KJ6 A;  2QIE B;  2BQQ A;  2PIA A;  2MWS B;  2LRU A;  4HKQ A;  2NVU I;  2Y5C A;  4F7Z A;  1TGZ B;  3RUI B;  1WGK A;  1YQ3 B;  2WYQ A;  2JUO A;  3AM9 A;  3VUW A;  4YXD B;  4BKS D;  1ROE A;  2JT4 B;  1FO4 A;  1E90 A;  5KHO A;  3ZVV A;  2LGS A;  2LWP A;  3WAN A;  3C19 A;  1TZ1 A;  3ZJU A;  2OJW A;  3NJT A;  2ZW0 A;  2WU2 B;  4LNF A;  4W9G A;  3H6N A;  2K6Q A;  1LFD A;  3QAQ A;  2C60 A;  2H89 B;  1TZO A;  3ML8 A;  4B0M A;  4N59 A;  2VH2 A;  2DZJ A;  3WA0 A;  2KFK A;  1YD8 U;  1WMH A;  1KLG D;  1ISN A;  2QEJ C;  1PYW D;  1UZX B;  4ZYN A;  3HVD A;  4ITK A;  4A20 A;  3IT6 B;  4YSX B;  1ZP0 B;  3TSS A;  3URY A;  4GB9 A;  2KFJ A;  5C2T B;  1B9R A;  2RD0 A;  1ZE3 D;  2K8B A;  5D94 A;  1OQR A;  4P16 A;  3BII D;  4FA6 A;  4IM0 A;  5BO4 B;  2K1F A;  1FM0 D;  1J7A A;  2ACZ B;  3ZKJ C;  2AQ1 B;  4MEM A;  4DHZ E;  2KDF B;  2LVP A;  5LXH A;  4W9L A;  1VZ7 A;  2BB5 A;  1FXA A;  1WXQ A;  4X57 B;  2PPH A;  5BMI A;  4NPN A;  3A33 B;  5DPS A;  3A4R A;  2LI5 A;  1TTN A;  1EU3 A;  4DBG A;  4ZRK A;  2O6V B;  3IG3 A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  2FNJ B;  2OOB B;  1YX5 B;  1WM2 A;  3TBL D;  1GG3 A;  4KIK B;  2BF8 B;  2KJH B;  2V1Y A;  3DQV A;  3ZLZ A;  4EZK A;  5DPW A;  3PRM B;  3NOB A;  3A1Q B;  3QIJ A;  4GDK B;  1EUV B;  1FXT B;  1KOT A;  2BGF A;  3TL5 A;  4W9F A;  1LM8 B;  2MBH A;  4HVB A;  3ENE A;  2LAS A;  3N3K B;  1GC6 A;  3KUD B;  5AZF A;  3R7Q A;  1WXV A;  4KVG B;  2KN5 A;  2V3S A;  3X0W A;  4G11 A;  1VD2 A;  1H4R A;  1WGG A;  2O6V A;  3QAR A;  5KHQ A;  2L3Z A;  5CX3 A;  4TQ0 A;  5G2N A;  3RZF A;  4G3X B;  4KIK A;  1WGD A;  2G3Q B;  2MW5 A;  1P98 A;  3KYD D;  4G0N B;  1V5O A;  4PYU A;  2KDE B;  2CHX A;  2YVC A;  3A1Q A;  2G45 B;  2FAZ A;  4GDK A;  2KLG A;  3DDC B;  4MH0 E;  2J0J A;  5AZG A;  1P3Q U;  1E7U A;  4EZJ A;  4RM8 A;  2HE7 A;  4F1S A;  3P2B A;  4EOY A;  4II2 B;  3SHQ A;  1L2N A;  3RT3 B;  3LDZ E;  3NHE B;  4GU2 A;  2JZZ A;  3VFK A;  4IC7 B;  1U4A A;  4RM9 A;  3PGE A;  1BT0 A;  3GZN I;  2BYF A;  4EFO A;  1LXD A;  1KJT A;  3PHX B;  1WMH B;  2IBI B;  3TIX A;  3SU8 X;  2MP2 B;  2MQJ A;  3B08 A;  3M3J A;  4HWI B;  5J18 A;  2DZI A;  4GOC A;  3UIP B;  2FCM A;  2G4S A;  2JZ3 B;  1V86 A;  3AUL A;  4FHJ A;  3S2A A;  1WM3 A;  3L13 A;  1OEY A;  4JIO U;  4MSM B;  4BKG A;  3DBR I;  2DAJ A;  4HDQ A;  5J2R A;  4GDL B;  4ANX A;  2XBB C;  1JRU A;  1LQB A;  2KDI A;  3IHP C;  1I42 A;  4WWO A;  5IA7 A;  1KLV A;  2KO3 A;  3U30 A;  4CO7 A;  2NBV B;  1Q0W B;  4AP4 C;  1WE6 A;  3ZDM C;  3A9K A;  3ECI A;  4K1R B;  3APF A;  2BYE A;  2CKH B;  4FJV B;  1E8W A;  1T0Y A;  2Z0E B;  4PS3 A;  2LGY A;  3PLU A;  3PLV A;  1WIA A;  2QHO A;  2XK5 B;  5LXI B;  2WX1 A;  2DX5 B;  3DBH I;  4MDK E;  4PS7 A;  1MG8 A;  2RGF A;  4M8N A;  2WDT B;  3L08 A;  4AJW A;  3ZRF A;  3PHW B;  4GDL A;  2DEN B;  3VHT C;  3CST A;  2NCN A;  2KX3 A;  1UEL A;  2IY0 B;  2R2Q A;  4AWJ A;  4BKT A;  1V81 A;  3TMP B;  4LDT D;  1TBE A;  2BYV E;  2GMI C;  2MRP A;  2N1W A;  1S3S G;  3H9D A;  3KYC D;  3APC A;  2ZPY A;  3ZNI D;  4CHK A;  5EDS A;  1WXA A;  3PTF C;  4DWF A;  3IBE A;  4B95 A;  4GMV A;  3HHM A;  4W9J A;  2K8H A;  3QX1 A;  2ZNV C;  3NZS A;  1F9J A;  2RR9 A;  1D3Z A;  2N1V A;  4IWP A;  2LUE A;  5C23 A;  3UF8 A;  3U7D A;  5E6N A;  2L8J A;  2ZNV B;  4HCP B;  1IPG A;  2LJ5 A;  3LJ3 A;  2MCN B;  3L16 A;  1UH6 A;  3ONS A;  3WAM A;  1WJN A;  4HJK A;  2LXA A;  3DVG Y;  2NBU A;  4ANW A;  3SD5 A;  4GGQ A;  3DVN U;  3QJZ A;  3M62 B;  4B6W A;  3CF6 E;  2FUH B;  4KZC A;  4GXB A;  1XQQ A;  2N7E A;  4XZ4 A;  3SDL C;  2KK8 A;  3EHV A;  1YQB A;  1RFA A;  2KLC A;  2C9W B;  5LLI A;  2JY6 A;  4EUT A;  2D07 B;  2EMS A;  2EKE C;  2MX2 A;  3RYT A;  2FIF A;  1AAR A;  2KVR A;  2UYZ B;  3N30 A;  3PV1 A;  4K7S A;  3ZRC A;  2KWV B;  1S1Q B;  1HE8 A;  2KD0 A;  2CHZ A;  3RD2 A;  1C3T A;  2HJ8 A;  5E6P A;  1EF5 A;  1WGH A;  2JWZ A;  3WIM A;  4HCN B;  2N4F A;  5G55 A;  4WJN A;  2K6D B;  1YX6 B;  2KWU B;  2ASQ A;  2AWT A;  2MSE D;  2R2O A;  4MGK E;  4WJP A;  3V62 A;  2G4D B;  4BOZ B;  4I6P A;  3AXC A;  1E8Z A;  2BKR B;  2JPH A;  1Q1O A;  2C7H A;  2IYD B;  2PEA A;  4W9D A;  2ZEQ A;  2ZPN A;  2KAN A;  2Z0D B;  1NDD A;  1E7V A;  3PPA A;  2GBJ A;  4PYZ A;  4ICU A;  2C7N B;  2HD5 B;  2LZ6 A;  2D2Q A;  3DVN V;  4A3P A;  2KWC A;  2CU1 A;  2WX0 A;  1GJZ A;  3H1U A;  1V5T A;  4IUM B;  1C1Y B;  4AJY B;  2KX0 A;  4E3C A;  4MEL A;  3JVZ X;  2L76 A;  1K8R B;  2O6V D;  4DHZ B;  1GNU A;  4TQ1 A;  3EC8 A;  1R4M I;  2LGX A;  3ZTD A;  5CHF A;  4FHK A;  4ANV A;  2IO0 B;  3PRZ A;  3VTU A;  4EKU A;  2DAF A;  4J6I A;  3MTN B;  1V6E A;  2FID A;  3B0A A;  5IAA C;  2JRI B;  1YIW A;  3M95 A;  4FUL A;  1IP9 A;  1I35 A;  4MGY E;  4WJO A;  2IZV B;  3ZIM A;  3NS8 A;  3OJ4 B;  3KH0 A;  1J8C A;  2KC1 A;  3PS6 A;  5FR6 A;  3A9K B;  2MA9 B;  1CMX B;  3R7R A;  3KW5 B;  3QWZ B;  5HKH A;  3R3M A;  4JQW C;  2AYO B;  1YJ1 A;  4DK5 A;  2PJH A;  4HDO A;  3PRE A;  2KQS A;  5C1Z A;  2ZVO A;  4BBN C;  4BKS A;  4KDL B;  2LVQ A;  2MBO A;  2OJR A;  3Q3J A;  5DPT A;  3NZU A;  1WY8 A;  4KSK C;  3OJ3 A;  4WJQ A;  3JW0 X;  1Q5W B;  3OAW A;  1WX9 A;  2D11 A;  2HTH A;  2IO1 B;  2NPT A;  3NY5 A;  3PT2 B;  3H7S A;  4HXD A;  5CTR C;  4IWO A;  2K39 A;  2NBW B;  4P7I A;  3WAP A;  3ZNZ B;  2DZK A;  3UIO B;  1WF9 A;  1WX7 A;  2DYM A;  1ZW7 A;  2JVC A;  2RPQ A;  5L83 A;  3EFU A;  3VH3 B;  1E5W A;  1SE9 A;  2L0F A;  3KVF B;  5D2M B;  2GBR A;  3UQB A;  4XC2 A;  3VQI A;  3IFW B;  3N32 A;  2DHZ A;  4FJZ A;  3KUZ A;  3OLM D;  4OVV A;  4OVU A;  1X1M A;  4WAA A;  4GIV A;  3RUL A;  4ZDV A;  4IG7 B;  2W9N A;  2AL6 A;  3JYU A;  2BKF A;  4E74 A;  2Z59 B;  2KOX A;  4LJP B;  3IVF A;  1XT9 B;  1WRD B;  2CS4 A;  1SGH A;  2BWF A;  1WXM A;  2NS5 A;  1WJU A;  4BVU C;  4EZL A;  2C7M B;  3H7P B;  3DBL I;  3ALB A;  4TV3 A;  1A5R A;  3VUX A;  2KMC A;  3D32 A;  2FCS A;  1WR1 A;  2GBK A;  4FAD A;  5DPR A;  4HPM B;  1WR6 E;  3BIN A;  2N9P C;  3TJP A;  2KDB A;  4ICV A;  2VRR B;  1GUA B;  1WGY A;  4MJS A;  3VUY A;  2UWQ A;  4NAW A;  2LGD A;  1NI2 A;  2ZCB A;  3RZW C;  2Y5B B;  3I3T B;  4I6L B;  2O2V B;  4M8M A;  4WWP A;  1WJ6 A;  4KDI C;  4AOF A;  2M8S A;  3ZO5 B;  5L95 C;  3M63 B;  2PE6 B;  1WXS A;  2IY1 B;  4E71 A;  5JHB A;  4RMA A;  3VTV A;  4W9K A;  2ZCC A;  2A4Z A;  4WQO B;  2YLM A;  3HIZ A;  3HM6 X;  2GOW A;  1EO6 A;  3X23 A;  1UD7 A;  2NR2 A;  2REX A;  3H7P A;  4K7W A;  1WI0 A;  2LD9 A;  1WGR A;  1OEY J;  4JGH B;  4G50 A;  3ZNG C;  4DDI D;  2ZVN A;  2KJR A;  2KTF A;  2L05 A;  4MM3 A;  3AI5 A;  2WWZ A;  2XEW A;  4ANU A;  3ZW3 A;  4II3 B;  4DHJ B;  1V2Y A;  2DYO A;  4TUU A;  3A9J A;  1RAX A;  3L54 A;  2JF5 A;  4WWN A;  5GMV A;  4KV2 A;  2KKC A;  2B3A A;  2O2V A;  3Q3F A;  4NNJ B;  4F8C B;  2JRH A;  1Z2M A;  1WZ3 A;  4BOS C;  2BWE S;  2KMA A;  2MBE A;  2LVO A;  1UGM A;  2L00 B;  2MBQ A;  4FLH A;  3W1Y A;  4HPL B;  2LRW A;  2D10 A;  4JLC A;  5AEK B;  1H8C A;  2JXX A;  1WX8 A;  4FBJ B;  3DBS A;  2C5L C;  3R66 C;  5JHA A;  3DOW A;  3VDZ A;  2AEH A;  4HK2 A;  4URK A;  4PS8 A;  3CMM B;  1P9D U;  2I1J A;  5CHV C;  3ZTC A;  3V6C B;  1WJ4 A;  2AL3 A;  3DPD A;  4NJ6 A;  3VAW A;  3PZD A;  2K25 A;  1NBF C;  3KUC B;  3RCZ A;  4DHJ D;  5TR5 A;  1WYW B;  2J0M A;  4KSL C;  2J7Q B;  3BY4 B;  3C0R B;  3A4S C;  3U8Z A;  3VXW A;  5E6O A;  4IW0 A;  2KC2 A;  4ZRJ A;  2KXJ A;  2NPT B;  1IYF A;  3W1S A;  2K8C A;  2KQ7 A;  4W9C A;  3L17 A;  3APD A;  1RLF A;  4FJY A;  1OQY A;  1V80 A;  2KJ6 A;  4M0W B;  2KHW B;  3EEC A;  4MGZ E;  3PRP B;  2MWS B;  2LRU A;  3QA8 A;  2NVU I;  4JL9 A;  4B9K A;  4CYE A;  3PVL A;  3QCA A;  1TGZ B;  4F7Z A;  4W9E A;  3V60 A;  3RUI B;  4DDG D;  2GBM A;  4I6N B;  2KTR B;  2WYQ A;  1EF1 A;  2JUO A;  2ZJD A;  2D3G A;  2KNB A;  3VUW A;  1WE7 A;  2M0X A;  4XX5 A;  4BKS D;  4AUQ C;  1SIF A;  2JT4 B;  1Y8R C;  2V4L A;  1E90 A;  2KFK B;  3K9O B;  1RRB A;  3HK0 A;  5KHO A;  3ZVV A;  2LWP A;  3QK0 A;  5D6J B;  3TCA A;  3WAN A;  4EEW A;  3K9P B;  4LCD E;  2FCN A;  1TZ1 A;  3V61 A;  4IM3 A;  2GBN A;  1E8Y A;  4W9G A;  1KM7 A;  3H6N A;  3UQA A;  3QQ8 B;  1R4N I;  2MLB A;  2K6Q A;  1LFD A;  3MJW A;  4HLE A;  5AZH A;  3QAQ A;  1P1A A;  2C60 A;  3WAO A;  2KTR A;  3DCG A;  3ML8 A;  4LDT B;  4IM2 A;  4MJS B;  4NAW B;  2MBB B;  2LXC A;  2N9X A;  4FN2 A;  4KZ0 A;  4YL8 A;  3MHS D;  4MGI E;  1QZE A;  1V49 A;  2DZJ A;  4K7U A;  4BFR A;  3WA0 A;  2KFK A;  1YD8 U;  5JH5 C;  1V9J A;  2J0K A;  4W9H A;  5D7G A;  4MSQ B;  2DZM A;  1XD3 B;  1WMH A;  2A5U A;  1ISN A;  2MP2 A;  2CHW A;  1UZX B;  5CHW A;  2N7D A;  4K81 A;  4ZYN A;  3T9L A;  4A3O A;  3HM3 A;  1L7Y A;  3QC8 B;  4A20 A;  4NY0 A;  5DCN A;  2ZZP B;  1PQS A;  4ASW C;  4GB9 A;  5JZE B;  3A9J B;  3JSV B;  2RSU A;  2IO3 B;  2KFJ A;  3L0W B;  2RD0 A;  3O65 B;  1UBI A;  2M4N A;  2K8B A;  1WH3 A;  5D94 A;  2I1K A;  1UBQ A;  2DYB A;  4N9F 4;  3CSF A;  4W9I A;  3ZUN A;  2M17 A;  2L0T A;  3DVG X;  2BPS A;  4TKN A;  4FA6 A;  2M1M A;  1WFY A;  4IM0 A;  5BO4 B;  3UIN B;  2L7R A;  3WAL A;  2K1F A;  2XK5 A;  3VTW A;  2N9E B;  4NJ7 A;  3ML9 A;  1G6J A;  1GC7 A;  3ZKJ C;  3L10 B;  4NQK E;  4MEM A;  2EMT A;  4DHZ E;  2KDF B;  1J19 A;  3GOE A;  2CR5 A;  2LVP A;  2PE9 A;  1ZGU B;  3JSV A;  3PSE B;  4IWQ A;  4W9L A;  3VVW B;  3T8M A;  5LXH A;  1ZKH A;  1M94 A;  2KZR A;  1VCB A;  1OGW A;  3VH4 B;  3ZDT A;  4X57 B;  2PPH A;  1P0R A;  4NPN A;  1J0G A;  4DXA B;  3A33 B;  3AU4 A;  4GN1 A;  2IO2 B;  1E8X A;  3UGB B;  4NQL B;  5DPS A;  3W1S C;  5J17 A;  3A4R A;  1Z5S B;  4LJO B;  2LI5 A;  1TTN A;  4ZRI A;  4DBG A;  4ZRK A;  3B1L X;  2O6V B;  2FCQ A;  3QHT A;  3ZNH B;  4GSW A;  3V6E B;  4BBN F;  1WZ0 A;  3IG3 A;  1OTR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...