2MQJA

Solution structure of ubiquitin-like protein from caldiarchaeum subterraneum
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'MKIKIVPAVGGGSPLELEVAPNATVGAVRTKVCAMKKLPPDTTRLTYKGRALKDTETLESLGVADGDKFVLITRTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein
publication title Solution structure of ubiquitin-like protein from Caldiarchaeum subterraneum
rcsb
source organism Candidatus caldiarchaeum subterraneum
molecule tags Ligase
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mqjA00
1S3SG 1HE8A 1WJ4A 2IO3B 4MDKE 5FR6A 5C23A 2N1WA 5AZGA 2PEAA 2R2QA 1WRDB 1WGHA 2N9PC 3IVFA 3VFKA 2OJRA 3HK0A 2ZZPB 3EC8A 3CMMB 1R4NI 2DZIA 2Z0DB 2KX3A 2MBHA 2MP2A 2N4FA 2VRRB 4HXDA 3RYTA 4NY0A 4F8CB 3ZUNA 2IY0B 4A20A 4DHJB 3M95A 4EZLA 2ZNVB 3O65B 4JIOU 1WR6E 2J0KA 3QCAA 4MGYE 2A5UA 2EKEC 3ZNHB 2ZVOA 3TJPA 3P2BA 1SE9A 2C7HA 5E6OA 2KOXA 2M0XA 2CS4A 4EOYA 4NPNA 2BKRB 2GBJA 3AU5A 4BFRA 5IAAC 1IYFA 2CHWA 4KIKB 4ICVA 3IFWB 1KOTA 1P9DU 2BPSA 1WGYA 4LDTD 1UZXB 2EMTA 3HIZA 1E8YA 3Q3FA 2FCNA 2KC2A 3QA8A 4MEMA 3ZLZA 2CR5A 2XK5A 4K7WA 2JZZA 1V2YA 2DZJA 2HJ8A 3DPDA 4B6WA 3QWZB 3VDZA 4FN2A 3NOBA 4LJPB 5D2MB 3H6NA 3ZNID 2BGFA 2GBRA 2KKCA 3PHXB 3H7SA 4GOCA 3QC8B 1K8RB 3PRPB 3VUWA 1A5RA 2L3ZA 1YD8U 2PPHA 4WJQA 4MELA 4HPMB 3VH4B 4MSMB 3OLMD 4B95A 4WJPA 3EFUA 3B1LX 3APDA 3ZO5B 4FULA 1GC7A 3KUCB 5GMVA 3Q3JA 3UGBB 1EF1A 2L7RA 1WH3A 2IYDB 3KW5B 2HE7A 1OEYJ 4EFOA 3ZDMC 4N9F4 2LWPA 5G55A 1RRBA 1YX6B 3DVNU 3D32A 1WJNA 3KUZA 2KD0A 2DENB 3W1SC 2N7DA 2KDEB 2KDIA 4W9KA 4EZKA 2HTHA 2CU1A 1WIAA 3UIOB 3AI5A 2NBUA 3EHVA 2IBIB 2BYFA 3DBHI 3W1SA 1WM3A 2LGXA 3ZTCA 4NAWA 1I42A 4X57B 4A3PA 3DBRI 4IC7B 1P0RA 2LJ5A 1ZKHA 4OVVA 3WAPA 4DHJD 2LASA 2RGFA 4G11A 2GOWA 1YJ1A 5CHWA 1WGGA 3HM6X 1EO6A 1OGWA 4I6PA 4DHZB 3ENEA 3ZVVA 5DCNA 5IA7A 2MBBB 4FA6A 4JGHB 3QQ8B 2L0TA 2DYOA 2MA9B 1H8CA 2R2OA 4FHJA 3K9OB 4KZ0A 5DPSA 2BWES 1XT9B 1KM7A 2FAZA 2KLGA 1KJTA 3A1QA 1E7VA 4HDOA 5J2RA 4AJWA 3OJ3A 3PPAA 2AWTA 3SDLC 2JZ3B 3H7PA 3V61A 2KFKB 2KN5A 2KWCA 4W9CA 3A9JA 2KVRA 4WWNA 5CX3A 4TQ1A 4LJOB 3OAWA 2O6VB 3M63B 2K8HA 2IO0B 2KJ6A 2RR9A 2K1FA 2ZVNA 2D07B 3RZWC 2BYVE 5JH5C 4GN1A 1PQSA 2LVOA 2M17A 2MRPA 1TZ1A 1YIWA 1ZGUB 4K1RB 1TGZB 1TBEA 3W1YA 4NNJB 3U30A 3UINB 3KUDB 2YLMA 3JSVA 3H1UA 1GC6A 2AYOB 2JUOA 2RD0A 1BT0A 2RPQA 2BWFA 4MJSA 3DBSA 1Q1OA 3ML9A 2IO1B 2GBMA 1L7YA 2MX2A 4KSKC 4E3CA 3NZSA 2AL3A 2ASQA 2CHZA 4KDLB 2D3GA 2B3AA 4EKUA 4G0NB 3QK0A 1WXAA 3JVZX 3UIPB 5D94A 2L76A 1T0YA 2MW5A 2V4LA 4FJYA 2KTRA 3TMPB 1P98A 2XBBC 3MTNB 3EECA 4DHZE 2KTFA 2KLCA 2WWZA 5JHBA 4IW0A 1YQBA 2FCQA 3R66C 3L08A 3LDZE 3TL5A 2MWSB 4GIVA 2ZNVC 3PLVA 3U8ZA 4WJOA 4ZDVA 4FHKA 5L95C 5J17A 3JW0X 4GMVA 2KXJA 1EF5A 2DAFA 3A4SC 3N32A 1WFYA 3DBLI 3WAMA 3GOEA 2K8CA 4GDKB 2Y5BB 3PHWB 1NDDA 3ZKJC 2KMCA 2UYZB 4M8NA 2L8JA 4JQWC 2ZEQA 3SHQA 4HPLB 4GDLA 4HCPB 3QHTA 3VXWA 4EUTA 4F1SA 5CTRC 4IM2A 4AJYB 2L0FA 2CKHB 3WA0A 3CF6E 2YVCA 4I6NB 3KH0A 3CSFA 4HK2A 4KIKA 2WYQA 2C5LC 2XK5B 2O6VD 1WXSA 3VUYA 2IZVB 2NCNA 2O2VB 3ML8A 1E90A 3PLUA 1WXMA 2HD5B 4KV2A 3KYDD 1V6EA 2DHZA 2DZMA 2ZPYA 3PS6A 4IWPA 3H9DA 4HJKA 4BKSA 5J18A 4ICUA 3IHPC 4K7SA 4FADA 1C1YB 1AARA 2G3QB 2GMIC 1WMHB 5AZFA 2DYMA 5LXHA 3UQAA 4TV3A 4IG7B 4E71A 5AZHA 2FIDA 2ZCCA 3PVLA 2GBKA 2MQJA 2IY1B 2K6DB 4MGZE 1V86A 2BKFA 3I3TB 1OTRB 4KVGB 5LLIA 4BKTA 3QAQA 5AEKB 4E74A 3RCZA 5L83A 3SD5A 2G4DB 1UBIA 3DDCB 2NBVB 4BKGA 1Z2MA 4K81A 4W9FA 1E8WA 4AUQC 4CHKA 4ZYNA 2KHWB 4DXAB 2C7NB 4BBNF 2MCNB 3S2AA 4AP4C 4DWFA 4PS3A 2A4ZA 3AXCA 2MSED 2MBQA 5JZEB 3A9KB 1RAXA 4GGQA 2C60A 4M0WB 4MM3A 2REXA 5EDSA 3M3JA 4MGIE 4FBJB 2L05A 1F9JA 2J0MA 2WDTB 3TCAA 2LRWA 3ZW3A 4DBGA 1E8ZA 5KHOA 2BF8B 4PS7A 1RLFA 3L16A 4GSWA 4KDIC 4YL8A 4JL9A 3UF8A 5CHFA 4FJZA 4DDGD 3R7RA 1ZW7A 1GJZA 3N3KB 3APFA 1UH6A 1J19A 1V9JA 3A9JB 4BKSD 1XD3B 1I35A 2WX0A 4ZRIA 3X23A 1SGHA 1WXVA 1J8CA 1X1MA 4OVUA 4HVBA 3B08A 4NJ6A 3PT2B 3PGEA 4G3XB 2O6VA 2PJHA 5BO4B 4F7ZA 3L0WB 3NY5A 1JRUA 3ZIMA 4TKNA 2C9WB 2G45B 2KQ7A 1GG3A 2I1JA 2NPTA 3MJWA 4IM0A 2EMSA 5D6JB 5HKHA 4MGKE 4BOSC 2LXCA 1ISNA 2DZKA 1Z5SB 4IUMB 3A33B 1IPGA 4WQOB 3CSTA 2DAJA 3IBEA 2Z0EB 1WF9A 3DVGY 4ZRJA 4W9IA 4WAAA 3RT3B 2M8SA 3DOWA 2JRIB 4GXBA 4K7UA 1WM2A 3M62B 1U4AA 3KYCD 4PYZA 4URKA 5KHQA 4FJVB 4ZRKA 4HCNB 2JRHA 2D11A 2NVUI 2J0JA 2M4NA 3AU4A 3V6EB 1WYWB 1YX5B 3RUIB 1V5TA 1UBQA 2KTRB 4TUUA 4W9EA 2I1KA 2MP2B 3IG3A 4M8MA 1WR1A 4EEWA 3SU8X 2LI5A 1IP9A 1WX9A 1LFDA 3BINA 1P1AA 4J6IA 2KC1A 3L17A 3QX1A 5DPRA 1E7UA 2PE9A 4W9HA 4DDID 2FNJB 3PTFC 4IM3A 4W9GA 1WGDA 4II2B 2KJRA 3QIJA 4PS8A 3RULA 3U7DA 3NHEB 4I6LB 1WX8A 4P7IA 2KDBA 2V1YA 1WI0A 4IWOA 4A3OA 2KJHB 1WE7A 1V81A 5TR5A 3N30A 1SIFA 3L10B 1WY8A 3T8MA 1E5WA 2V3SA 4GDKA 2KX0A 2MBEA 1FXTB 3DQVA 4XX5A 3APCA 3ZTDA 4W9DA 2FIFA 3PRMB 1G6JA 4GDLB 2KZRA 3ZDTA 2KFJA 1KLVA 2LGYA 3VHTC 1Y8RC 2WX1A 1TTNA 4BBNC 2K39A 3NZUA 3ZNGC 1RFAA 2DX5B 3V62A 3WANA 2RSUA 4LCDE 4W9LA 1C3TA 3JYUA 4NQLB 2JXXA 4HDQA 2IO2B 4EZJA 1H4RA 2K25A 3T9LA 4RM9A 2O2VA 2CHXA 4NQKE 3WIMA 3AULA 4KZCA 2OOBB 2ZJDA 3VQIA 3VTVA 2LVQA 2KDFB 1V49A 2N9XA 1LXDA 2LRUA 3VTUA 3ONSA 4G50A 3R3MA 2M1MA 5JHAA 3V6CB 1Q5WB 2ZCBA 3DVGX 3L13A 1WMHA 4W9JA 3WALA 2N7EA 5CHVC 1MG8A 4ANUA 2D2QA 2MLBA 3ZRFA 2LZ6A 5E6NA 1WE6A 3K9PB 3RD2A 1E8XA 3VUXA 2NS5A 3ALBA 1NBFC 2KNBA 2C7MB 2AEHA 3ECIA 2KMAA 4ANWA 5D7GA 2JVCA 2J7QB 4IWQA 4XC2A 4WWOA 2KANA 2QHOA 4NAWB 4XZ4A 4KSLC 2NBWB 4B9KA 1VD2A 4GB9A 2JT4B 1UELA 4CYEA 5E6PA 2LVPA 1D3ZA 4TQ0A 3PV1A 1WJ6A 1R4MI 1LQBA 1QZEA 1M94A 1EUVB 1WZ0A 3VAWA 2GBNA 3R7QA 3HHMA 1P3QU 4WWPA 4BOZB 1V5OA 2UWQA 3X0WA 5C1ZA 2BYEA 4NJ7A 1VCBA 2K6QA 3A9KA 4HLEA 3A1QB 1CMXB 2N1VA 3B0AA 3C0RB 3HM3A 3QARA 3L54A 2W9NA 4AWJA 4RMAA 2LUEA 1UD7A 3H7PB 4ASWC 3VTWA 2FCSA 4WJNA 3WAOA 2L00B 5DPWA 1OQYA 1UGMA 2KFKA 2DYBA 4GU2A 4MSQB 4RM8A 1LM8B 4HWIB 5G2NA 2D10A 4DK5A 2LGDA 4ANVA 2KWUB 3PSEB 5DPTA 1WZ3A 4LDTB 2KQSA 2KWVB 2JWZA 3A4RA 3PRZA 3ZRCA 1L2NA 1J0GA 2G4SA 4MH0E 3PZDA 1S1QB 3LJ3A 1Q0WB 4FLHA 1GNUA 4ANXA 3ZNZB 3VH3B 1OEYA 1V80A 2AL6A 2FUHB 2JY6A 1WGRA 3JSVB 4JLCA 2LXAA 2XEWA 1WJUA 4II3B 2MBOA 3NS8A 3PREA 4CO7A 2NPTB 3TBLD 2LD9A 2JPHA 2KO3A 4MJSB 5LXIB 3V60A 2N9EB 2KK8A 3GZNI 3MHSD 3QJZA 1XQQA 2ZPNA 1NI2A 3VVWB 3DCGA 2NR2A 4BVUC 2JF5A 4AOFA 3UQBA 3RZFA 1WX7A 2Z59B 4PYUA 3BY4B 1GUAB 3KVFB 3TIXA 3OJ4B 2PE6B 2FCMA 3DVNV 2K8BA
chains in the Genus database with same CATH superfamily
2W55A 1S3SG 1WJ4A 2N1WA 2R2QA 2N9PC 3HK0A 3EC8A 5HFYA 2KX3A 2N4FA 4NY0A 3P42A 2OEDA 1FEHA 2ACZB 2I2YA 3QCAA 1I4PA 4O1NA 2C7HA 2KOXA 2M0XA 4EOYA 2GBJA 1QQRA 2CHWA 2BPSA 4LDTD 3QA8A 1E8YA 2KC2A 2XK5A 2JZZA 3LXFA 3VDZA 3P63A 4LJPB 4NJCA 3H6NA 2BGFA 1P7EA 3QC8B 3PRPB 3VUWA 2L3ZA 4WJQA 4MELA 4HPMB 3VH4B 2NTTA 4WJPA 4EE2A 4C00A 1JCKB 5GMVA 3UGBB 2D3AA 1WH3A 3J9CA 2IYDB 1SIJA 4EFOA 1D4BA 4N9F4 2LWPA 5G55A 1TS2A 3DVNU 1WJNA 2N7DA 4WQMA 3BYYB 3UIOB 2IBIB 1D5MC 2BBCA 1I42A 4A3PA 1TZOA 5BYQA 4DHJD 2LASA 2PMVA 3RNFC 2MH7A 2GOWA 1F0ZA 1WGGA 3HM6X 1SEBD 4NAMA 3BZDB 1EWCA 4FA6A 3QQ8B 2R2OA 2M0AA 1IUEA 4RFBA 2WXQA 2M56B 5J2RA 4WWMA 3OJ3A 3SDLC 2L83A 2KN5A 3BVMA 3U7ZA 3A9JA 4WWNA 5CX3A 3FILA 3OAWA 2IDYA 2O6VB 2JSVX 4KX6B 2W3SA 3KWLA 2LVOA 2M17A 2MRPA 1FNVA 1ZGUB 1FNWA 1TGZB 3W1YA 1T0QC 4DXFA 3JSVA 1XEEA 2QDFA 2WXLA 5C3JB 1V1PB 2BWFA 2LEKA 2I38A 4A8XC 3I57A 3DBSA 2MX2A 2GBMA 1L7YA 4KSKC 1KFYB 4KDLB 2CHZA 2J53A 4EKUA 1TKYA 3QK0A 3JVZX 2L76A 1T0RC 1PFDA 2V4LA 1V97A 3TUOA 1I7HA 3Q8EA 2Q5WD 3TEZA 2WWZA 3KWVA 4DXGA 2MWSB 5EE9A 3U8ZA 4WJOA 2RDGA 2WXRA 2DAFA 2BB6A 4GDKB 3C19A 1NDDA 2UYZB 2PW9A 1JWAD 3GS2A 4JQWC 2G1EA 2FUG1 4HCPB 2BQQA 2CKHB 3R8BA 4I6NB 2CU3A 3AM9A 2IZVB 2NCNA 1BMLC 4P16A 4YTPB 3W5UB 4MACA 1WXMA 4KV2A 2AQ3B 5TSSA 3H9DA 4HJKA 3MC8A 2G3QB 4IDIA 1WMHB 1FRDA 4KGSA 4IG7B 1FRRA 4ITKA 4N6EB 5AZHA 3RNGC 2GBKA 3OWEB 1HTQA 2GB1A 3QAQA 2AX5A 5AEKB 3EA6A 5L83A 3T3OA 3P1MA 1AN8A 4K81A 2PLPA 5H92C 4ZYNA 2HTME 1TS4A 3S2AA 4PS3A 1NEKB 5JZEB 1RAXA 4GGQA 2REXA 3MJ5A 1F9JA 5D3IB 2BB5A 2LRWA 2WDQB 1E8ZA 1KTKA 1FNUA 2ONQA 3Q3OC 3HVDA 5CHFA 4DDGD 4A90A 2R61A 3N3KB 3N20C 4OW0A 4BKSD 3X23A 4NJ6A 1SXTA 3PT2B 1JRUA 1FCLA 2G45B 1GG3A 2J42A 2NPTA 3MJWA 5D6JB 4C7ZA 4BOSC 1KF6B 2LXCA 3AEDB 4WIPA 1D6EC 3A33B 4WQOB 3CSTA 4ARCA 3DVGY 3DOWA 2JRIB 4K7UA 2WLBA 3KYCD 3RMKC 4HCNB 1PDXA 3V6EB 5BMIA 4C80A 1SE4A 3IG3A 1WX9A 2WXIA 1E7UA 4LK0M 3PTFC 2INNE 4YTMB 3RULA 1SE3A 4P7IA 2KDBA 2V1YA 4A3OA 2WXJA 1E5WA 5IN7A 2V3SA 4WAFA 1FXTB 1UWMA 1G6JA 3APCA 2FIFA 3PRMB 4GDLB 3DHGC 2KFJA 3VHTC 2PIAA 3ZNGC 1RFAA 3NZ3A 3V62A 2RSUA 4W9LA 1C3TA 1LGRA 4HDQA 2IO2B 3T3NA 2E3TA 4RM9A 1FIQA 4KZCA 3VQIA 2KDFB 2N9XA 1LXDA 3P4PB 3ONSA 4AQ7A 5JHAA 4L2YA 1JW9D 2N9LA 1VZ7A 2WS3B 3NVVA 4LNKA 2N7EA 2LZ6A 3VUXA 1P7FA 3ALBA 1NBFC 2KNBA 4ANWA 5D7GA 2JVCA 2J7QB 4XC2A 2KANA 4XZ4A 1VD2A 4GB9A 4RF1A 5E6PA 2J52A 1HTOA 2X38A 2WDRB 4M01A 1P3QU 4S0RA 3AB5A 1BUIC 3A9KA 2N1VA 1CK1A 3QARA 3L54A 1TY2A 4RF0A 2N9KA 4UDUC 3W2DA 2L00B 1L0XB 1UGMA 2DYBA 4DK5A 1I4RA 2LGDA 1UF0A 3PSEB 1V1OA 3FILB 1YMHE 4LDTB 4PT5A 1J0GA 2PVOD 1YQ4B 2DNFA 3ZNZB 3KQ4A 3JSVB 1V80A 2AL6A 1WGRA 1WJUA 2AQ1B 3NS8A 1V1PA 3ETRA 2JPHA 4DQOC 2N9EB 5MPOA 3GZNI 1M4VA 4XWWA 2ZPNA 1NI2A 3BY4B 2Y5PA 3TIXA 4A6QA 1FPYA 3DVNV 1OQQA 4MDKE 5FR6A 1WGHA 2ZZPB 3CMMB 4ZRQA 2DZIA 5IKCM 1L6VA 2V4IB 4LNFA 4DHJB 3ZJUA 1RWSA 4JIOU 1WR6E 5HI1A 3CWIA 1ZE3D 3TJPA 3P2BA 3V3XA 1NYRA 1SE9A 5E6OA 5I4DA 3IT6B 1IYFA 4A9AA 2K3UA 1UZXB 1T3QA 1V2YA 2DZJA 2D5GA 5C2TB 2OHFA 4C4VA 2KKCA 1YD8U 3NVWA 3MHZA 1D5ZC 1GC7A 3Q3JA 3AE1B 2L7RA 1N60A 1OEYJ 1YX6B 3D32A 1DOIA 4B0EA 2KDEB 2KDIA 2BVCA 4EZKA 1T5XD 2CU1A 3AI5A 2NBUA 3EHVA 1L5PA 3P4SB 2BYFA 3DBHI 1XXGA 3ZTCA 2LJ5A 4G11A 1ET6A 5LNK1 3ZVVA 5IA7A 2PKOA 4L23A 2DYOA 4FHJA 3K9OB 5DPSA 3SR6A 3BK1A 1ROEA 2FAZA 4NZLB 1V8CA 3H7PA 3V61A 1QLBB 3SFEB 1AYFA 4GLSC 2L32A 2K8HA 1TS5A 2RR9A 2K1FA 3RZWC 2BYVE 1PQSA 1FCCC 3BVZA 3O13A 1YIWA 2NTSA 4K1RB 1TBEA 1Y56A 3KUDB 1L4ZB 3C8YA 1SB3C 1MHXA 3RNAC 1D5XC 4E3CA 3NZSA 2B3AA 2DLBA 2MW5A 3AE9B 4XE0A 4US9A 4FJYA 1E6EB 1P98A 2XBBC 3GE8C 4DHZE 2M19A 3HRDD 2KTFA 2CJOA 5JHBA 1NENB 4IW0A 1CJEA 3L08A 4LNOA 2ZNVC 3PLVA 3HUIA 2QILA 5J17A 4GMVA 4ACFA 1WFYA 3DBLI 3WAMA 3GOEA 1AWDA 1ENFA 2JWUA 2Y5BB 5BMHA 3ZKJC 2L8JA 2VZKB 3PZ8A 4GDLA 3VXWA 1HEZE 1J7CA 2YVCA 1QILA 2JQRB 3KH0A 3CSFA 1CZPA 4KIKA 2WYQA 2E6XA 2C5LC 1L6UA 4N58A 1WXSA 2LGSA 2W3RA 3VUYA 1E90A 1MG4A 3KYDD 1MI0A 2WXHA 3RN9C 2DZMA 1QOAA 2ZPYA 4M00A 3PS6A 5J18A 2D3CA 3IHPC 2KWDA 1C1YB 1DYQA 3UQAA 1ZDXA 1QF6A 3H8HA 3AMZA 4JE3B 2ZCCA 3PVLA 2IY1B 5HG2A 4MGZE 1V86A 1TT5B 2BKFA 1OTRB 1HA5A 2KN4A 3CIRB 4E74A 3SD5A 4W9FA 4AUQC 3AE8B 2C7NB 4AP4C 2MJDA 2A4ZA 1YN5A 2MBQA 2MSED 3A9KB 4YSXB 4FBJB 4Q2JA 1QOBA 2J0MA 2X8XX 1L0VB 4KDIC 4YL8A 1GJZA 1UH6A 1V9JA 1WGKA 1XD3B 1I35A 2WX0A 1SGHA 4HVBA 3PGEA 4G3XB 1IBXA 2PJHA 5BO4B 5E6JA 4IM0A 5HKHA 1VLBA 2MJ3A 4IUMB 2QJLA 3P4QB 2DAJA 2IJ0A 3IBEA 4WAAA 3RT3B 2M8SA 3U52E 1WM2A 1XF5L 1C78A 2JRHA 2NVUI 3EUB2 5HHDG 2J0JA 1V5TA 1OQRA 2FE8A 2I1KA 4M8MA 1EWYC 1ZOYB 3GZNB 1IP9A 3BINA 1P1AA 4J6IA 2KC1A 2KT7A 3L17A 4W9HA 2WXNA 3DHHC 4IM3A 1WGDA 3Q8FA 3LB8C 4I6LB 1FO4A 1B1ZA 3FC4A 2KJHB 2L1AA 1WY8A 3T8MA 3RNEC 1LO5D 3DQVA 3AE2B 4XX5A 4S17A 4W9DA 1AW7A 1UGJA 4ZOHC 4C4VB 2LHDA 4YT0B 4EZJA 3VRAB 2K25A 3WCQA 2O2VA 2CHXA 3AEEB 3AULA 3VTVA 2LGIA 2EELA 1V49A 3NUHB 2Z8LA 1F52A 5AUKA 2TSSA 2ZCBA 3DVGX 2W54A 3L13A 1YOVB 5CHVC 4ANUA 2MLBA 5E6NA 1XCTL 3K9PB 2C7MB 2KMAA 4HKZE 4IWQA 2MHJA 4B9KA 3ZGZA 1UELA 3P4RB 1R4MI 1QZEA 1EUVB 3VAWA 1VR9A 4BOZB 1V5OA 2UWQA 2VZKD 4NJ7A 1VCBA 4MM3B 5IOIA 1MVKA 4M0WA 1XLQA 3H7PB 3B2GA 3WAOA 5DPWA 4GU2A 4HWIB 2KWUB 5DPTA 1WZ3A 4JWUC 3ZRCA 3W9CB 2L52A 3PZDA 3TEYA 4FLHA 1L4DB 4ANXA 3AEFB 4JLCA 1K51A 3GP7A 1F2RC 4H2AA 2XEWA 2MBOA 1E10A 1HQRD 3IAM1 4P1CC 5JXVA 3VVWB 3DCGA 3MC9A 1WX7A 2Z59B 2SAKA 2VH2A 1FXAA 2IO3B 5C23A 3NRZA 3IVFA 3VFKA 2OJRA 2RPVA 3DHIC 3GB1A 1SJHD 4HXDA 3B2FA 4F8CB 2IY0B 1UNSA 3M95A 4EZLA 3AEBB 1N62A 2ZNVB 2J0KA 1A70A 1GPXA 2QCZA 1UWXA 4MGYE 2A5UA 2EKEC 4L1BA 3ZNHB 3AV8A 4BFRA 2BKRB 3AU5A 1XCQL 4KIKB 1KOTA 1P9DU 4XDDA 4USAA 2EMTA 4K7WA 4B6WA 3DPDA 2HJ8A 3Q3MC 2BS3B 3NOBA 4US8A 4YSZB 3ZNID 2K5PA 3RFZB 3H7SA 2PPHA 3AH7A 4MSMB 3OLMD 1L0YB 3TEWA 3EFUA 4BZAA 3IT4B 3B1LX 3BYTB 1C79A 4FULA 1HZ6A 1EF1A 3KW5B 2HE7A 5BYSA 1E9MA 4REZA 2V3PA 3KUZA 2KD0A 4W9KA 1K52A 1B9RA 3VR8B 2LJIA 2ON8A 2LGXA 2JYEA 3AECB 4NAWA 4X57B 3DBRI 4IC7B 1P0RA 4OVVA 4QAYA 1SE2A 3WAPA 2RGFA 2PTLA 5CHWA 4DHZB 2GRIA 1EO6A 1OGWA 2BW2A 1YNTE 2L0TA 1PGXA 2N0SB 2BWES 1XT9B 1KM7A 3A1QA 1KJTA 4HDOA 2H89B 1XLOA 3PPAA 2AWTA 2XNAC 4P1BC 2JZ3B 2QSDA 1IGDA 2KWCA 4W9CA 2KVRA 1IBXB 3M63B 2IO0B 2KJ6A 2ZVNA 2D07B 3MC0B 5JH5C 1JROA 1TZ1A 4HEA1 4NNJB 3U30A 1JMLA 3MP9A 2WQYB 3H1UA 2AYOB 2RD0A 3AN1A 2IGHA 4MJSA 4XDCA 4KGRA 2AL3A 4N59A 1T6BX 1F1HA 1WXAA 5D94A 3N1ZC 2W82A 3TMPB 2WHIA 3Q6BA 3MTNB 3EECA 1VJKA 1E0ZA 3BK2A 2KLCA 3RI7C 3BWUD 3R66C 3LDZE 4ZDVA 4RCOA 5L95C 4FXCA 4HROA 2KXJA 1FMAD 2K8CA 1J7AA 3PHWB 3PZ7A 2KMCA 4M8NA 4LLGM 2ZEQA 3SHQA 4C7YA 3AE5B 4HPLB 3ZXRA 3QHTA 4EUTA 2INDC 4IM2A 2L0FA 3WA0A 3W5VB 1EU3A 4HK2A 3GE3C 2O2VB 2HD5B 2NMQA 4OHJA 2YEPB 4RGTA 4C56C 4IWPA 2BYTA 4ICUA 4K7SA 5LXHA 2DYMA 4TV3A 4E71A 2IGDA 4OZBA 1C4PA 2JYTA 3I3TB 4KVGB 5LLIA 1ZXIA 1YN4A 3RCZA 2G4DB 2HJ1A 4BKGA 1QT9A 3HVZA 3ZQ4A 1E8WA 2KVZA 4CHKA 4K3CA 3FKYA 2KHWB 4DXAB 2WXPA 2MCNB 5D3DA 4BAXA 2C60A 4M0WB 4MM3A 4KKJA 2XN9C 2L05A 3TCAA 4DBGA 1FXIA 3EGRA 4ARIA 3L16A 5BMGA 4ZRPA 1R4MB 3R7RA 1ZW7A 4RH6A 3APFA 3L4PA 5G5GA 2AQ2B 1X1MA 4OVUA 1RFKA 3V05A 4F7ZA 3NY5A 1DOXA 4TKNA 1C4CA 2KQ7A 1C4AA 2BT6A 1ZDVA 4MGKE 2WU2B 5EE1A 1ISNA 2DZKA 1Z5SB 1WSPA 1TKEA 1WF9A 4ZRJA 4W9IA 3SEBA 5FK9C 1U4AA 3LYYA 4URKA 4FJVB 4ZHOA 4ZRKA 2D11A 2M4NA 2RMMA 3AU4A 1WYWB 3RUIB 1UBQA 2KTRB 4EEWA 4HKQA 2WXMA 1LFDA 2PE9A 4DDID 2FNJB 1FFVA 3AEAB 1I4GA 4W9GA 4II2B 4PS8A 3QIJA 3U7DA 1I4XA 1WX8A 1GB1A 1ZUD2 2N7JA 2G9HD 2MBEA 1ZP0B 3Q3NC 4J3OD 2K39A 1E7PB 2V3NA 5AUIA 1JWMD 4LCDE 5H8YE 1KLGD 1H4RA 3WIMA 2ZJDA 2LVQA 1N63A 5GXGB 3I63C 4G50A 2M1MA 3V6CB 1Q5WB 2KMMA 3N1YC 4RNAA 2QIEB 1MG8A 4LTUA 2D2QA 3ZRFA 4TMAB 5IO9A 1WE6A 1C76A 3RD2A 1E8XA 4YSYB 4WWOA 2QHOA 4NAWB 4OZCA 4OVZA 1MJDA 2JT4B 4D2KA 4CYEA 1D3ZA 4TQ0A 1FFUA 2BS2B 3PV1A 4RGNA 3HHMA 2YEPF 1YQ3B 1GAQB 3X0WA 1JRPA 1TS3A 3AE4B 1N61A 4HLEA 3A1QB 3C0RB 3HM3A 4AS1A 4AWJA 2H88B 4RMAA 1C77A 2FCSA 4WJNA 3U2SC 1YJJA 3DBRB 4MSQB 5EE3A 5G2NA 1CQVA 4ANVA 2WNMA 1K53A 2KWVB 3DWMA 3PRZA 1SF0A 3AE6B 1WWTA 3Q8AA 3VR9B 2G4SA 4MH0E 2GI9A 5BYRA 3LJ3A 1Q0WB 2V9HA 3VH3B 1OEYA 1DGJA 4R3DA 1VRAB 2K9XA 4CO7A 3TBLD 2IGGA 4RGOS 4LNNA 2KO3A 4KKIA 4MJSB 4IOIE 2OJWA 1DOYA 2KK8A 3MHSD 3QJZA 1TY0A 4HPPA 3UQBA 1NYQA 4AOFA 3RZFA 1ET9A 4PYUA 2JXTA 1GOZA 3KVFB 1XO3A 2K8BA 1HE8A 1PUTA 4HRSA 5AZGA 2PEAA 1WRDB 2EKIA 2QMTA 3E56A 1R4NI 2Z0DB 1K50A 2MP2A 2MBHA 2VRRB 3RYTA 3B9JA 3ZUNA 4A20A 1YN3A 3O65B 2ZVOA 2D3BA 2JU6X 3AEGB 1SBBB 1XLPA 2CS4A 4NPNA 5IAAC 4ICVA 3IFWB 1WGYA 2CJNA 3HIZA 4MEMA 3Q3FA 2FCNA 3ZLZA 2CR5A 4JPSA 3QWZB 4FN2A 5D2MB 1RM6C 2GBRA 2LHEA 3PHXB 4GOCA 1A5RA 1K8RB 1ACCA 4B95A 2J4XA 1TIFA 3APDA 3ZO5B 3KUCB 2BTEA 1I4HA 4LNIA 1EU4A 3ZDMC 1RRBA 1NI3A 2LFIA 3N1XC 2DENB 1QOFA 3W1SC 2HTHA 1WIAA 4HJGE 3FAHA 4MT5A 2DBYA 2ZW1A 3ABVB 1MPEA 4JX1C 3W1SA 4WH4A 1WM3A 1PGAA 2WXGA 1ZKHA 2UU7A 1R7SA 1YJ1A 4I6PA 3DBHB 3ENEA 1TKGA 5DCNA 1F77A 2MBBB 4RGMA 4JGHB 3Q69A 2MA9B 1H8CA 2JZPA 4KZ0A 2KLGA 3BIID 1E7VA 4AJWA 1C9FA 3I5JC 4YXDB 2KFKB 1OFFA 1YJIA 3ZXVA 2QC8A 4TQ1A 4LJOB 3N9YC 2KACA 1N6ZA 4GN1A 1F2RI 1I4QA 3UINB 2BS4B 3NVYA 2YLMA 1GC6A 2JUOA 1BT0A 2RPQA 2QEJC 1KH0A 1FD6A 1Q1OA 3ML9A 2IO1B 2ASQA 2D3GA 3U4EG 1EM7A 1JWUD 1XLNA 4G0NB 3UIPB 1UUPA 1T0YA 3EFCA 2KTRA 1N5WA 2INPE 1ESFA 2WXFA 1YQBA 2FCQA 2KQ4X 3TL5A 4GIVA 4FHKA 3NVZA 1JWBD 3JW0X 2MJEA 1STEA 1EF5A 3A4SC 3N32A 1VDVA 3NG0A 2IPKD 1IGCA 2KAJA 2WXKA 2V0GA 3DBLB 4F1SA 5CTRC 3Q14C 4AJYB 3CF6E 1NVID 3KLSX 2XK5B 2O6VD 2K22A 3ML8A 3PLUA 3R2IA 1V6EA 2DHZA 3ZJTA 2KDMA 4BKSA 3DWGC 4FADA 1PGBA 3MFGA 1AARA 2GMIC 5AZFA 3OG5A 2FIDA 3TEXA 2MQJA 2K6DB 3RNCC 1KRHA 4BKTA 3Q8BA 2WXOA 3DDCB 1UBIA 2NBVB 2FBWB 1Z2MA 4JWSC 1BXTA 4B0MA 2WGSA 4BBNF 4DWFA 3IXSA 3AXCA 3RPFC 2RDBC 3IAS1 2LUMA 4WURA 5EDSA 3M3JA 4MGIE 1SSNA 4A55A 3I9V1 2WDTB 3ZW3A 1FM0D 2BF8B 5KHOA 4PS7A 1RLFA 4GSWA 4P6VF 4JL9A 3UF8A 2B76B 1J7BA 4FJZA 1J19A 1T0SC 4XYCA 2GLSA 1MFWA 2WU5B 3A9JB 2Y5CA 4ZRIA 1WXVA 1J8CA 3B08A 1HZ5A 2O6VA 3UI3A 3L0WB 3ZIMA 2C9WB 2I1JA 1N5XA 2EMSA 1ZPSA 2Y3AA 3AE3B 2K0PA 1JQ4A 2RDHA 4KGTA 1IPGA 3PO0A 3BVGA 2ZW0A 2Z0EB 5FKAC 4GXBA 1GB4A 3M62B 4PYZA 5KHQA 1JWSD 2KYWA 1YX5B 3R2TA 4TUUA 2DWQA 3NJTA 4W9EA 5G5HA 2MP2B 4ZYSA 5FR3A 1WR1A 3SU8X 2LI5A 3QX1A 5DPRA 1QKZA 2KJRA 1WXQA 3NHEB 5T8IA 1WI0A 4IWOA 1WE7A 1V81A 4YWGG 5TR5A 3N30A 1SIFA 3L10B 4GDKA 2KX0A 3ZTDA 3Q2AC 4OZAA 1R4NB 2KZRA 3ZDTA 1KLVA 2LGYA 1Y8RC 2WX1A 1TTNA 1ZXHA 4BBNC 1QOGA 2LMCA 3NZUA 1WYGA 2ICIA 1MHHE 2DX5B 3WANA 4K3BA 3JYUA 4NQLB 2JXXA 2VH1A 3T9LA 4NQKE 2OOBB 1PYWD 1SJED 2LRUA 3VTUA 3R3MA 3AE7B 2WDVB 4XGAB 4YTNB 2MEKA 1WMHA 4W9JA 3WALA 3TSSA 3URYA 3RNBC 2NS5A 2AEHA 3ECIA 5EE0A 4KSLC 2NBWB 3NS1A 1VZ6A 2LVPA 2HDEA 1WJ6A 1LQBA 1M94A 1WZ0A 4XWTA 2GBNA 3R7QA 1Q10A 4IKGA 4WWPA 5C1ZA 5IP4D 2BYEA 2K6QA 2INCC 1VZ8A 1CMXB 3B0AA 2W9NA 1WRIA 2LUEA 1UD7A 4ASWC 3VTWA 3VRBB 3SFDB 1OQYA 2KFKA 4RM8A 2JX5A 1LM8B 2D10A 2PVGC 2KQSA 2JWZA 3A4RA 1L2NA 1S1QB 1GNUA 3E9SA 4MH8A 4M02A 1TJEA 1TYGB 1KLUD 2FUHB 2JY6A 2LXAA 3ZJVA 4TSSA 4CQNA 4II3B 3PREA 2NPTB 3ZYYX 2LD9A 5LXIB 1HXYD 3V60A 3Q8CA 1JALA 1XQQA 2NR2A 4BVUC 2JF5A 4PK1A 2WP9B 1GUAB 4ZHPA 3OJ4B 2PE6B 1RYJA 2SEBD 2FCMA
chains in the Genus database with same CATH topology
1S3SG 1HE8A 1WJ4A 2IO3B 4MDKE 5FR6A 5C23A 2N1WA 5AZGA 2PEAA 2R2QA 1WRDB 1WGHA 2N9PC 3IVFA 3VFKA 2OJRA 3HK0A 2ZZPB 3EC8A 3CMMB 1R4NI 2DZIA 2Z0DB 2KX3A 2MBHA 2MP2A 2N4FA 2VRRB 4HXDA 3RYTA 4NY0A 4F8CB 3ZUNA 2IY0B 4A20A 4DHJB 3M95A 4EZLA 2ZNVB 3O65B 4JIOU 1WR6E 2J0KA 3QCAA 4MGYE 2A5UA 2EKEC 3ZNHB 2ZVOA 3TJPA 3P2BA 1SE9A 2C7HA 5E6OA 2KOXA 2M0XA 2CS4A 4EOYA 4NPNA 2BKRB 2GBJA 3AU5A 4BFRA 5IAAC 1IYFA 2CHWA 4KIKB 4ICVA 3IFWB 1KOTA 1P9DU 2BPSA 1WGYA 4LDTD 1UZXB 2EMTA 3HIZA 1E8YA 3Q3FA 2FCNA 2KC2A 3QA8A 4MEMA 3ZLZA 2CR5A 2XK5A 4K7WA 2JZZA 1V2YA 2DZJA 2HJ8A 3DPDA 4B6WA 3QWZB 3VDZA 4FN2A 3NOBA 4LJPB 5D2MB 3H6NA 3ZNID 2BGFA 2GBRA 2KKCA 3PHXB 3H7SA 4GOCA 3QC8B 1K8RB 3PRPB 3VUWA 1A5RA 2L3ZA 1YD8U 2PPHA 4WJQA 4MELA 4HPMB 3VH4B 4MSMB 3OLMD 4B95A 4WJPA 3EFUA 3B1LX 3APDA 3ZO5B 4FULA 1GC7A 3KUCB 5GMVA 3Q3JA 3UGBB 1EF1A 2L7RA 1WH3A 2IYDB 3KW5B 2HE7A 1OEYJ 4EFOA 3ZDMC 4N9F4 2LWPA 5G55A 1RRBA 1YX6B 3DVNU 3D32A 1WJNA 3KUZA 2KD0A 2DENB 3W1SC 2N7DA 2KDEB 2KDIA 4W9KA 4EZKA 2HTHA 2CU1A 1WIAA 3UIOB 3AI5A 2NBUA 3EHVA 2IBIB 2BYFA 3DBHI 3W1SA 1WM3A 2LGXA 3ZTCA 4NAWA 1I42A 4X57B 4A3PA 3DBRI 4IC7B 1P0RA 2LJ5A 1ZKHA 4OVVA 3WAPA 4DHJD 2LASA 2RGFA 4G11A 2GOWA 1YJ1A 5CHWA 1WGGA 3HM6X 1EO6A 1OGWA 4I6PA 4DHZB 3ENEA 3ZVVA 5DCNA 5IA7A 2MBBB 4FA6A 4JGHB 3QQ8B 2L0TA 2DYOA 2MA9B 1H8CA 2R2OA 4FHJA 3K9OB 4KZ0A 5DPSA 2BWES 1XT9B 1KM7A 2FAZA 2KLGA 1KJTA 3A1QA 1E7VA 4HDOA 5J2RA 4AJWA 3OJ3A 3PPAA 2AWTA 3SDLC 2JZ3B 3H7PA 3V61A 2KFKB 2KN5A 2KWCA 4W9CA 3A9JA 2KVRA 4WWNA 5CX3A 4TQ1A 4LJOB 3OAWA 2O6VB 3M63B 2K8HA 2IO0B 2KJ6A 2RR9A 2K1FA 2ZVNA 2D07B 3RZWC 2BYVE 5JH5C 4GN1A 1PQSA 2LVOA 2M17A 2MRPA 1TZ1A 1YIWA 1ZGUB 4K1RB 1TGZB 1TBEA 3W1YA 4NNJB 3U30A 3UINB 3KUDB 2YLMA 3JSVA 3H1UA 1GC6A 2AYOB 2JUOA 2RD0A 1BT0A 2RPQA 2BWFA 4MJSA 3DBSA 1Q1OA 3ML9A 2IO1B 2GBMA 1L7YA 2MX2A 4KSKC 4E3CA 3NZSA 2AL3A 2ASQA 2CHZA 4KDLB 2D3GA 2B3AA 4EKUA 4G0NB 3QK0A 1WXAA 3JVZX 3UIPB 5D94A 2L76A 1T0YA 2MW5A 2V4LA 4FJYA 2KTRA 3TMPB 1P98A 2XBBC 3MTNB 3EECA 4DHZE 2KTFA 2KLCA 2WWZA 5JHBA 4IW0A 1YQBA 2FCQA 3R66C 3L08A 3LDZE 3TL5A 2MWSB 4GIVA 2ZNVC 3PLVA 3U8ZA 4WJOA 4ZDVA 4FHKA 5L95C 5J17A 3JW0X 4GMVA 2KXJA 1EF5A 2DAFA 3A4SC 3N32A 1WFYA 3DBLI 3WAMA 3GOEA 2K8CA 4GDKB 2Y5BB 3PHWB 1NDDA 3ZKJC 2KMCA 2UYZB 4M8NA 2L8JA 4JQWC 2ZEQA 3SHQA 4HPLB 4GDLA 4HCPB 3QHTA 3VXWA 4EUTA 4F1SA 5CTRC 4IM2A 4AJYB 2L0FA 2CKHB 3WA0A 3CF6E 2YVCA 4I6NB 3KH0A 3CSFA 4HK2A 4KIKA 2WYQA 2C5LC 2XK5B 2O6VD 1WXSA 3VUYA 2IZVB 2NCNA 2O2VB 3ML8A 1E90A 3PLUA 1WXMA 2HD5B 4KV2A 3KYDD 1V6EA 2DHZA 2DZMA 2ZPYA 3PS6A 4IWPA 3H9DA 4HJKA 4BKSA 5J18A 4ICUA 3IHPC 4K7SA 4FADA 1C1YB 1AARA 2G3QB 2GMIC 1WMHB 5AZFA 2DYMA 5LXHA 3UQAA 4TV3A 4IG7B 4E71A 5AZHA 2FIDA 2ZCCA 3PVLA 2GBKA 2MQJA 2IY1B 2K6DB 4MGZE 1V86A 2BKFA 3I3TB 1OTRB 4KVGB 5LLIA 4BKTA 3QAQA 5AEKB 4E74A 3RCZA 5L83A 3SD5A 2G4DB 1UBIA 3DDCB 2NBVB 4BKGA 1Z2MA 4K81A 4W9FA 1E8WA 4AUQC 4CHKA 4ZYNA 2KHWB 4DXAB 2C7NB 4BBNF 2MCNB 3S2AA 4AP4C 4DWFA 4PS3A 2A4ZA 3AXCA 2MSED 2MBQA 5JZEB 3A9KB 1RAXA 4GGQA 2C60A 4M0WB 4MM3A 2REXA 5EDSA 3M3JA 4MGIE 4FBJB 2L05A 1F9JA 2J0MA 2WDTB 3TCAA 2LRWA 3ZW3A 4DBGA 1E8ZA 5KHOA 2BF8B 4PS7A 1RLFA 3L16A 4GSWA 4KDIC 4YL8A 4JL9A 3UF8A 5CHFA 4FJZA 4DDGD 3R7RA 1ZW7A 1GJZA 3N3KB 3APFA 1UH6A 1J19A 1V9JA 3A9JB 4BKSD 1XD3B 1I35A 2WX0A 4ZRIA 3X23A 1SGHA 1WXVA 1J8CA 1X1MA 4OVUA 4HVBA 3B08A 4NJ6A 3PT2B 3PGEA 4G3XB 2O6VA 2PJHA 5BO4B 4F7ZA 3L0WB 3NY5A 1JRUA 3ZIMA 4TKNA 2C9WB 2G45B 2KQ7A 1GG3A 2I1JA 2NPTA 3MJWA 4IM0A 2EMSA 5D6JB 5HKHA 4MGKE 4BOSC 2LXCA 1ISNA 2DZKA 1Z5SB 4IUMB 3A33B 1IPGA 4WQOB 3CSTA 2DAJA 3IBEA 2Z0EB 1WF9A 3DVGY 4ZRJA 4W9IA 4WAAA 3RT3B 2M8SA 3DOWA 2JRIB 4GXBA 4K7UA 1WM2A 3M62B 1U4AA 3KYCD 4PYZA 4URKA 5KHQA 4FJVB 4ZRKA 4HCNB 2JRHA 2D11A 2NVUI 2J0JA 2M4NA 3AU4A 3V6EB 1WYWB 1YX5B 3RUIB 1V5TA 1UBQA 2KTRB 4TUUA 4W9EA 2I1KA 2MP2B 3IG3A 4M8MA 1WR1A 4EEWA 3SU8X 2LI5A 1IP9A 1WX9A 1LFDA 3BINA 1P1AA 4J6IA 2KC1A 3L17A 3QX1A 5DPRA 1E7UA 2PE9A 4W9HA 4DDID 2FNJB 3PTFC 4IM3A 4W9GA 1WGDA 4II2B 2KJRA 3QIJA 4PS8A 3RULA 3U7DA 3NHEB 4I6LB 1WX8A 4P7IA 2KDBA 2V1YA 1WI0A 4IWOA 4A3OA 2KJHB 1WE7A 1V81A 5TR5A 3N30A 1SIFA 3L10B 1WY8A 3T8MA 1E5WA 2V3SA 4GDKA 2KX0A 2MBEA 1FXTB 3DQVA 4XX5A 3APCA 3ZTDA 4W9DA 2FIFA 3PRMB 1G6JA 4GDLB 2KZRA 3ZDTA 2KFJA 1KLVA 2LGYA 3VHTC 1Y8RC 2WX1A 1TTNA 4BBNC 2K39A 3NZUA 3ZNGC 1RFAA 2DX5B 3V62A 3WANA 2RSUA 4LCDE 4W9LA 1C3TA 3JYUA 4NQLB 2JXXA 4HDQA 2IO2B 4EZJA 1H4RA 2K25A 3T9LA 4RM9A 2O2VA 2CHXA 4NQKE 3WIMA 3AULA 4KZCA 2OOBB 2ZJDA 3VQIA 3VTVA 2LVQA 2KDFB 1V49A 2N9XA 1LXDA 2LRUA 3VTUA 3ONSA 4G50A 3R3MA 2M1MA 5JHAA 3V6CB 1Q5WB 2ZCBA 3DVGX 3L13A 1WMHA 4W9JA 3WALA 2N7EA 5CHVC 1MG8A 4ANUA 2D2QA 2MLBA 3ZRFA 2LZ6A 5E6NA 1WE6A 3K9PB 3RD2A 1E8XA 3VUXA 2NS5A 3ALBA 1NBFC 2KNBA 2C7MB 2AEHA 3ECIA 2KMAA 4ANWA 5D7GA 2JVCA 2J7QB 4IWQA 4XC2A 4WWOA 2KANA 2QHOA 4NAWB 4XZ4A 4KSLC 2NBWB 4B9KA 1VD2A 4GB9A 2JT4B 1UELA 4CYEA 5E6PA 2LVPA 1D3ZA 4TQ0A 3PV1A 1WJ6A 1R4MI 1LQBA 1QZEA 1M94A 1EUVB 1WZ0A 3VAWA 2GBNA 3R7QA 3HHMA 1P3QU 4WWPA 4BOZB 1V5OA 2UWQA 3X0WA 5C1ZA 2BYEA 4NJ7A 1VCBA 2K6QA 3A9KA 4HLEA 3A1QB 1CMXB 2N1VA 3B0AA 3C0RB 3HM3A 3QARA 3L54A 2W9NA 4AWJA 4RMAA 2LUEA 1UD7A 3H7PB 4ASWC 3VTWA 2FCSA 4WJNA 3WAOA 2L00B 5DPWA 1OQYA 1UGMA 2KFKA 2DYBA 4GU2A 4MSQB 4RM8A 1LM8B 4HWIB 5G2NA 2D10A 4DK5A 2LGDA 4ANVA 2KWUB 3PSEB 5DPTA 1WZ3A 4LDTB 2KQSA 2KWVB 2JWZA 3A4RA 3PRZA 3ZRCA 1L2NA 1J0GA 2G4SA 4MH0E 3PZDA 1S1QB 3LJ3A 1Q0WB 4FLHA 1GNUA 4ANXA 3ZNZB 3VH3B 1OEYA 1V80A 2AL6A 2FUHB 2JY6A 1WGRA 3JSVB 4JLCA 2LXAA 2XEWA 1WJUA 4II3B 2MBOA 3NS8A 3PREA 4CO7A 2NPTB 3TBLD 2LD9A 2JPHA 2KO3A 4MJSB 5LXIB 3V60A 2N9EB 2KK8A 3GZNI 3MHSD 3QJZA 1XQQA 2ZPNA 1NI2A 3VVWB 3DCGA 2NR2A 4BVUC 2JF5A 4AOFA 3UQBA 3RZFA 1WX7A 2Z59B 4PYUA 3BY4B 1GUAB 3KVFB 3TIXA 3OJ4B 2PE6B 2FCMA 3DVNV 2K8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3S G;  1HE8 A;  1WJ4 A;  2IO3 B;  4MDK E;  5FR6 A;  5C23 A;  2N1W A;  5AZG A;  2PEA A;  2R2Q A;  1WRD B;  1WGH A;  2N9P C;  3IVF A;  3VFK A;  2OJR A;  3HK0 A;  2ZZP B;  3EC8 A;  3CMM B;  1R4N I;  2DZI A;  2Z0D B;  2KX3 A;  2MBH A;  2MP2 A;  2N4F A;  2VRR B;  4HXD A;  3RYT A;  4NY0 A;  4F8C B;  3ZUN A;  2IY0 B;  4A20 A;  4DHJ B;  3M95 A;  4EZL A;  2ZNV B;  3O65 B;  4JIO U;  1WR6 E;  2J0K A;  3QCA A;  4MGY E;  2A5U A;  2EKE C;  3ZNH B;  2ZVO A;  3TJP A;  3P2B A;  1SE9 A;  2C7H A;  5E6O A;  2KOX A;  2M0X A;  2CS4 A;  4EOY A;  4NPN A;  2BKR B;  2GBJ A;  3AU5 A;  4BFR A;  5IAA C;  1IYF A;  2CHW A;  4KIK B;  4ICV A;  3IFW B;  1KOT A;  1P9D U;  2BPS A;  1WGY A;  4LDT D;  1UZX B;  2EMT A;  3HIZ A;  1E8Y A;  3Q3F A;  2FCN A;  2KC2 A;  3QA8 A;  4MEM A;  3ZLZ A;  2CR5 A;  2XK5 A;  4K7W A;  2JZZ A;  1V2Y A;  2DZJ A;  2HJ8 A;  3DPD A;  4B6W A;  3QWZ B;  3VDZ A;  4FN2 A;  3NOB A;  4LJP B;  5D2M B;  3H6N A;  3ZNI D;  2BGF A;  2GBR A;  2KKC A;  3PHX B;  3H7S A;  4GOC A;  3QC8 B;  1K8R B;  3PRP B;  3VUW A;  1A5R A;  2L3Z A;  1YD8 U;  2PPH A;  4WJQ A;  4MEL A;  4HPM B;  3VH4 B;  4MSM B;  3OLM D;  4B95 A;  4WJP A;  3EFU A;  3B1L X;  3APD A;  3ZO5 B;  4FUL A;  1GC7 A;  3KUC B;  5GMV A;  3Q3J A;  3UGB B;  1EF1 A;  2L7R A;  1WH3 A;  2IYD B;  3KW5 B;  2HE7 A;  1OEY J;  4EFO A;  3ZDM C;  4N9F 4;  2LWP A;  5G55 A;  1RRB A;  1YX6 B;  3DVN U;  3D32 A;  1WJN A;  3KUZ A;  2KD0 A;  2DEN B;  3W1S C;  2N7D A;  2KDE B;  2KDI A;  4W9K A;  4EZK A;  2HTH A;  2CU1 A;  1WIA A;  3UIO B;  3AI5 A;  2NBU A;  3EHV A;  2IBI B;  2BYF A;  3DBH I;  3W1S A;  1WM3 A;  2LGX A;  3ZTC A;  4NAW A;  1I42 A;  4X57 B;  4A3P A;  3DBR I;  4IC7 B;  1P0R A;  2LJ5 A;  1ZKH A;  4OVV A;  3WAP A;  4DHJ D;  2LAS A;  2RGF A;  4G11 A;  2GOW A;  1YJ1 A;  5CHW A;  1WGG A;  3HM6 X;  1EO6 A;  1OGW A;  4I6P A;  4DHZ B;  3ENE A;  3ZVV A;  5DCN A;  5IA7 A;  2MBB B;  4FA6 A;  4JGH B;  3QQ8 B;  2L0T A;  2DYO A;  2MA9 B;  1H8C A;  2R2O A;  4FHJ A;  3K9O B;  4KZ0 A;  5DPS A;  2BWE S;  1XT9 B;  1KM7 A;  2FAZ A;  2KLG A;  1KJT A;  3A1Q A;  1E7V A;  4HDO A;  5J2R A;  4AJW A;  3OJ3 A;  3PPA A;  2AWT A;  3SDL C;  2JZ3 B;  3H7P A;  3V61 A;  2KFK B;  2KN5 A;  2KWC A;  4W9C A;  3A9J A;  2KVR A;  4WWN A;  5CX3 A;  4TQ1 A;  4LJO B;  3OAW A;  2O6V B;  3M63 B;  2K8H A;  2IO0 B;  2KJ6 A;  2RR9 A;  2K1F A;  2ZVN A;  2D07 B;  3RZW C;  2BYV E;  5JH5 C;  4GN1 A;  1PQS A;  2LVO A;  2M17 A;  2MRP A;  1TZ1 A;  1YIW A;  1ZGU B;  4K1R B;  1TGZ B;  1TBE A;  3W1Y A;  4NNJ B;  3U30 A;  3UIN B;  3KUD B;  2YLM A;  3JSV A;  3H1U A;  1GC6 A;  2AYO B;  2JUO A;  2RD0 A;  1BT0 A;  2RPQ A;  2BWF A;  4MJS A;  3DBS A;  1Q1O A;  3ML9 A;  2IO1 B;  2GBM A;  1L7Y A;  2MX2 A;  4KSK C;  4E3C A;  3NZS A;  2AL3 A;  2ASQ A;  2CHZ A;  4KDL B;  2D3G A;  2B3A A;  4EKU A;  4G0N B;  3QK0 A;  1WXA A;  3JVZ X;  3UIP B;  5D94 A;  2L76 A;  1T0Y A;  2MW5 A;  2V4L A;  4FJY A;  2KTR A;  3TMP B;  1P98 A;  2XBB C;  3MTN B;  3EEC A;  4DHZ E;  2KTF A;  2KLC A;  2WWZ A;  5JHB A;  4IW0 A;  1YQB A;  2FCQ A;  3R66 C;  3L08 A;  3LDZ E;  3TL5 A;  2MWS B;  4GIV A;  2ZNV C;  3PLV A;  3U8Z A;  4WJO A;  4ZDV A;  4FHK A;  5L95 C;  5J17 A;  3JW0 X;  4GMV A;  2KXJ A;  1EF5 A;  2DAF A;  3A4S C;  3N32 A;  1WFY A;  3DBL I;  3WAM A;  3GOE A;  2K8C A;  4GDK B;  2Y5B B;  3PHW B;  1NDD A;  3ZKJ C;  2KMC A;  2UYZ B;  4M8N A;  2L8J A;  4JQW C;  2ZEQ A;  3SHQ A;  4HPL B;  4GDL A;  4HCP B;  3QHT A;  3VXW A;  4EUT A;  4F1S A;  5CTR C;  4IM2 A;  4AJY B;  2L0F A;  2CKH B;  3WA0 A;  3CF6 E;  2YVC A;  4I6N B;  3KH0 A;  3CSF A;  4HK2 A;  4KIK A;  2WYQ A;  2C5L C;  2XK5 B;  2O6V D;  1WXS A;  3VUY A;  2IZV B;  2NCN A;  2O2V B;  3ML8 A;  1E90 A;  3PLU A;  1WXM A;  2HD5 B;  4KV2 A;  3KYD D;  1V6E A;  2DHZ A;  2DZM A;  2ZPY A;  3PS6 A;  4IWP A;  3H9D A;  4HJK A;  4BKS A;  5J18 A;  4ICU A;  3IHP C;  4K7S A;  4FAD A;  1C1Y B;  1AAR A;  2G3Q B;  2GMI C;  1WMH B;  5AZF A;  2DYM A;  5LXH A;  3UQA A;  4TV3 A;  4IG7 B;  4E71 A;  5AZH A;  2FID A;  2ZCC A;  3PVL A;  2GBK A;  2MQJ A;  2IY1 B;  2K6D B;  4MGZ E;  1V86 A;  2BKF A;  3I3T B;  1OTR B;  4KVG B;  5LLI A;  4BKT A;  3QAQ A;  5AEK B;  4E74 A;  3RCZ A;  5L83 A;  3SD5 A;  2G4D B;  1UBI A;  3DDC B;  2NBV B;  4BKG A;  1Z2M A;  4K81 A;  4W9F A;  1E8W A;  4AUQ C;  4CHK A;  4ZYN A;  2KHW B;  4DXA B;  2C7N B;  4BBN F;  2MCN B;  3S2A A;  4AP4 C;  4DWF A;  4PS3 A;  2A4Z A;  3AXC A;  2MSE D;  2MBQ A;  5JZE B;  3A9K B;  1RAX A;  4GGQ A;  2C60 A;  4M0W B;  4MM3 A;  2REX A;  5EDS A;  3M3J A;  4MGI E;  4FBJ B;  2L05 A;  1F9J A;  2J0M A;  2WDT B;  3TCA A;  2LRW A;  3ZW3 A;  4DBG A;  1E8Z A;  5KHO A;  2BF8 B;  4PS7 A;  1RLF A;  3L16 A;  4GSW A;  4KDI C;  4YL8 A;  4JL9 A;  3UF8 A;  5CHF A;  4FJZ A;  4DDG D;  3R7R A;  1ZW7 A;  1GJZ A;  3N3K B;  3APF A;  1UH6 A;  1J19 A;  1V9J A;  3A9J B;  4BKS D;  1XD3 B;  1I35 A;  2WX0 A;  4ZRI A;  3X23 A;  1SGH A;  1WXV A;  1J8C A;  1X1M A;  4OVU A;  4HVB A;  3B08 A;  4NJ6 A;  3PT2 B;  3PGE A;  4G3X B;  2O6V A;  2PJH A;  5BO4 B;  4F7Z A;  3L0W B;  3NY5 A;  1JRU A;  3ZIM A;  4TKN A;  2C9W B;  2G45 B;  2KQ7 A;  1GG3 A;  2I1J A;  2NPT A;  3MJW A;  4IM0 A;  2EMS A;  5D6J B;  5HKH A;  4MGK E;  4BOS C;  2LXC A;  1ISN A;  2DZK A;  1Z5S B;  4IUM B;  3A33 B;  1IPG A;  4WQO B;  3CST A;  2DAJ A;  3IBE A;  2Z0E B;  1WF9 A;  3DVG Y;  4ZRJ A;  4W9I A;  4WAA A;  3RT3 B;  2M8S A;  3DOW A;  2JRI B;  4GXB A;  4K7U A;  1WM2 A;  3M62 B;  1U4A A;  3KYC D;  4PYZ A;  4URK A;  5KHQ A;  4FJV B;  4ZRK A;  4HCN B;  2JRH A;  2D11 A;  2NVU I;  2J0J A;  2M4N A;  3AU4 A;  3V6E B;  1WYW B;  1YX5 B;  3RUI B;  1V5T A;  1UBQ A;  2KTR B;  4TUU A;  4W9E A;  2I1K A;  2MP2 B;  3IG3 A;  4M8M A;  1WR1 A;  4EEW A;  3SU8 X;  2LI5 A;  1IP9 A;  1WX9 A;  1LFD A;  3BIN A;  1P1A A;  4J6I A;  2KC1 A;  3L17 A;  3QX1 A;  5DPR A;  1E7U A;  2PE9 A;  4W9H A;  4DDI D;  2FNJ B;  3PTF C;  4IM3 A;  4W9G A;  1WGD A;  4II2 B;  2KJR A;  3QIJ A;  4PS8 A;  3RUL A;  3U7D A;  3NHE B;  4I6L B;  1WX8 A;  4P7I A;  2KDB A;  2V1Y A;  1WI0 A;  4IWO A;  4A3O A;  2KJH B;  1WE7 A;  1V81 A;  5TR5 A;  3N30 A;  1SIF A;  3L10 B;  1WY8 A;  3T8M A;  1E5W A;  2V3S A;  4GDK A;  2KX0 A;  2MBE A;  1FXT B;  3DQV A;  4XX5 A;  3APC A;  3ZTD A;  4W9D A;  2FIF A;  3PRM B;  1G6J A;  4GDL B;  2KZR A;  3ZDT A;  2KFJ A;  1KLV A;  2LGY A;  3VHT C;  1Y8R C;  2WX1 A;  1TTN A;  4BBN C;  2K39 A;  3NZU A;  3ZNG C;  1RFA A;  2DX5 B;  3V62 A;  3WAN A;  2RSU A;  4LCD E;  4W9L A;  1C3T A;  3JYU A;  4NQL B;  2JXX A;  4HDQ A;  2IO2 B;  4EZJ A;  1H4R A;  2K25 A;  3T9L A;  4RM9 A;  2O2V A;  2CHX A;  4NQK E;  3WIM A;  3AUL A;  4KZC A;  2OOB B;  2ZJD A;  3VQI A;  3VTV A;  2LVQ A;  2KDF B;  1V49 A;  2N9X A;  1LXD A;  2LRU A;  3VTU A;  3ONS A;  4G50 A;  3R3M A;  2M1M A;  5JHA A;  3V6C B;  1Q5W B;  2ZCB A;  3DVG X;  3L13 A;  1WMH A;  4W9J A;  3WAL A;  2N7E A;  5CHV C;  1MG8 A;  4ANU A;  2D2Q A;  2MLB A;  3ZRF A;  2LZ6 A;  5E6N A;  1WE6 A;  3K9P B;  3RD2 A;  1E8X A;  3VUX A;  2NS5 A;  3ALB A;  1NBF C;  2KNB A;  2C7M B;  2AEH A;  3ECI A;  2KMA A;  4ANW A;  5D7G A;  2JVC A;  2J7Q B;  4IWQ A;  4XC2 A;  4WWO A;  2KAN A;  2QHO A;  4NAW B;  4XZ4 A;  4KSL C;  2NBW B;  4B9K A;  1VD2 A;  4GB9 A;  2JT4 B;  1UEL A;  4CYE A;  5E6P A;  2LVP A;  1D3Z A;  4TQ0 A;  3PV1 A;  1WJ6 A;  1R4M I;  1LQB A;  1QZE A;  1M94 A;  1EUV B;  1WZ0 A;  3VAW A;  2GBN A;  3R7Q A;  3HHM A;  1P3Q U;  4WWP A;  4BOZ B;  1V5O A;  2UWQ A;  3X0W A;  5C1Z A;  2BYE A;  4NJ7 A;  1VCB A;  2K6Q A;  3A9K A;  4HLE A;  3A1Q B;  1CMX B;  2N1V A;  3B0A A;  3C0R B;  3HM3 A;  3QAR A;  3L54 A;  2W9N A;  4AWJ A;  4RMA A;  2LUE A;  1UD7 A;  3H7P B;  4ASW C;  3VTW A;  2FCS A;  4WJN A;  3WAO A;  2L00 B;  5DPW A;  1OQY A;  1UGM A;  2KFK A;  2DYB A;  4GU2 A;  4MSQ B;  4RM8 A;  1LM8 B;  4HWI B;  5G2N A;  2D10 A;  4DK5 A;  2LGD A;  4ANV A;  2KWU B;  3PSE B;  5DPT A;  1WZ3 A;  4LDT B;  2KQS A;  2KWV B;  2JWZ A;  3A4R A;  3PRZ A;  3ZRC A;  1L2N A;  1J0G A;  2G4S A;  4MH0 E;  3PZD A;  1S1Q B;  3LJ3 A;  1Q0W B;  4FLH A;  1GNU A;  4ANX A;  3ZNZ B;  3VH3 B;  1OEY A;  1V80 A;  2AL6 A;  2FUH B;  2JY6 A;  1WGR A;  3JSV B;  4JLC A;  2LXA A;  2XEW A;  1WJU A;  4II3 B;  2MBO A;  3NS8 A;  3PRE A;  4CO7 A;  2NPT B;  3TBL D;  2LD9 A;  2JPH A;  2KO3 A;  4MJS B;  5LXI B;  3V60 A;  2N9E B;  2KK8 A;  3GZN I;  3MHS D;  3QJZ A;  1XQQ A;  2ZPN A;  1NI2 A;  3VVW B;  3DCG A;  2NR2 A;  4BVU C;  2JF5 A;  4AOF A;  3UQB A;  3RZF A;  1WX7 A;  2Z59 B;  4PYU A;  3BY4 B;  1GUA B;  3KVF B;  3TIX A;  3OJ4 B;  2PE6 B;  2FCM A;  3DVN V;  2K8B A; 
#chains in the Genus database with same CATH topology
 2W55 A;  1S3S G;  1WJ4 A;  2N1W A;  2R2Q A;  2N9P C;  3HK0 A;  3EC8 A;  5HFY A;  2KX3 A;  2N4F A;  4NY0 A;  3P42 A;  2OED A;  1FEH A;  2ACZ B;  2I2Y A;  3QCA A;  1I4P A;  4O1N A;  2C7H A;  2KOX A;  2M0X A;  4EOY A;  2GBJ A;  1QQR A;  2CHW A;  2BPS A;  4LDT D;  3QA8 A;  1E8Y A;  2KC2 A;  2XK5 A;  2JZZ A;  3LXF A;  3VDZ A;  3P63 A;  4LJP B;  4NJC A;  3H6N A;  2BGF A;  1P7E A;  3QC8 B;  3PRP B;  3VUW A;  2L3Z A;  4WJQ A;  4MEL A;  4HPM B;  3VH4 B;  2NTT A;  4WJP A;  4EE2 A;  4C00 A;  1JCK B;  5GMV A;  3UGB B;  2D3A A;  1WH3 A;  3J9C A;  2IYD B;  1SIJ A;  4EFO A;  1D4B A;  4N9F 4;  2LWP A;  5G55 A;  1TS2 A;  3DVN U;  1WJN A;  2N7D A;  4WQM A;  3BYY B;  3UIO B;  2IBI B;  1D5M C;  2BBC A;  1I42 A;  4A3P A;  1TZO A;  5BYQ A;  4DHJ D;  2LAS A;  2PMV A;  3RNF C;  2MH7 A;  2GOW A;  1F0Z A;  1WGG A;  3HM6 X;  1SEB D;  4NAM A;  3BZD B;  1EWC A;  4FA6 A;  3QQ8 B;  2R2O A;  2M0A A;  1IUE A;  4RFB A;  2WXQ A;  2M56 B;  5J2R A;  4WWM A;  3OJ3 A;  3SDL C;  2L83 A;  2KN5 A;  3BVM A;  3U7Z A;  3A9J A;  4WWN A;  5CX3 A;  3FIL A;  3OAW A;  2IDY A;  2O6V B;  2JSV X;  4KX6 B;  2W3S A;  3KWL A;  2LVO A;  2M17 A;  2MRP A;  1FNV A;  1ZGU B;  1FNW A;  1TGZ B;  3W1Y A;  1T0Q C;  4DXF A;  3JSV A;  1XEE A;  2QDF A;  2WXL A;  5C3J B;  1V1P B;  2BWF A;  2LEK A;  2I38 A;  4A8X C;  3I57 A;  3DBS A;  2MX2 A;  2GBM A;  1L7Y A;  4KSK C;  1KFY B;  4KDL B;  2CHZ A;  2J53 A;  4EKU A;  1TKY A;  3QK0 A;  3JVZ X;  2L76 A;  1T0R C;  1PFD A;  2V4L A;  1V97 A;  3TUO A;  1I7H A;  3Q8E A;  2Q5W D;  3TEZ A;  2WWZ A;  3KWV A;  4DXG A;  2MWS B;  5EE9 A;  3U8Z A;  4WJO A;  2RDG A;  2WXR A;  2DAF A;  2BB6 A;  4GDK B;  3C19 A;  1NDD A;  2UYZ B;  2PW9 A;  1JWA D;  3GS2 A;  4JQW C;  2G1E A;  2FUG 1;  4HCP B;  2BQQ A;  2CKH B;  3R8B A;  4I6N B;  2CU3 A;  3AM9 A;  2IZV B;  2NCN A;  1BML C;  4P16 A;  4YTP B;  3W5U B;  4MAC A;  1WXM A;  4KV2 A;  2AQ3 B;  5TSS A;  3H9D A;  4HJK A;  3MC8 A;  2G3Q B;  4IDI A;  1WMH B;  1FRD A;  4KGS A;  4IG7 B;  1FRR A;  4ITK A;  4N6E B;  5AZH A;  3RNG C;  2GBK A;  3OWE B;  1HTQ A;  2GB1 A;  3QAQ A;  2AX5 A;  5AEK B;  3EA6 A;  5L83 A;  3T3O A;  3P1M A;  1AN8 A;  4K81 A;  2PLP A;  5H92 C;  4ZYN A;  2HTM E;  1TS4 A;  3S2A A;  4PS3 A;  1NEK B;  5JZE B;  1RAX A;  4GGQ A;  2REX A;  3MJ5 A;  1F9J A;  5D3I B;  2BB5 A;  2LRW A;  2WDQ B;  1E8Z A;  1KTK A;  1FNU A;  2ONQ A;  3Q3O C;  3HVD A;  5CHF A;  4DDG D;  4A90 A;  2R61 A;  3N3K B;  3N20 C;  4OW0 A;  4BKS D;  3X23 A;  4NJ6 A;  1SXT A;  3PT2 B;  1JRU A;  1FCL A;  2G45 B;  1GG3 A;  2J42 A;  2NPT A;  3MJW A;  5D6J B;  4C7Z A;  4BOS C;  1KF6 B;  2LXC A;  3AED B;  4WIP A;  1D6E C;  3A33 B;  4WQO B;  3CST A;  4ARC A;  3DVG Y;  3DOW A;  2JRI B;  4K7U A;  2WLB A;  3KYC D;  3RMK C;  4HCN B;  1PDX A;  3V6E B;  5BMI A;  4C80 A;  1SE4 A;  3IG3 A;  1WX9 A;  2WXI A;  1E7U A;  4LK0 M;  3PTF C;  2INN E;  4YTM B;  3RUL A;  1SE3 A;  4P7I A;  2KDB A;  2V1Y A;  4A3O A;  2WXJ A;  1E5W A;  5IN7 A;  2V3S A;  4WAF A;  1FXT B;  1UWM A;  1G6J A;  3APC A;  2FIF A;  3PRM B;  4GDL B;  3DHG C;  2KFJ A;  3VHT C;  2PIA A;  3ZNG C;  1RFA A;  3NZ3 A;  3V62 A;  2RSU A;  4W9L A;  1C3T A;  1LGR A;  4HDQ A;  2IO2 B;  3T3N A;  2E3T A;  4RM9 A;  1FIQ A;  4KZC A;  3VQI A;  2KDF B;  2N9X A;  1LXD A;  3P4P B;  3ONS A;  4AQ7 A;  5JHA A;  4L2Y A;  1JW9 D;  2N9L A;  1VZ7 A;  2WS3 B;  3NVV A;  4LNK A;  2N7E A;  2LZ6 A;  3VUX A;  1P7F A;  3ALB A;  1NBF C;  2KNB A;  4ANW A;  5D7G A;  2JVC A;  2J7Q B;  4XC2 A;  2KAN A;  4XZ4 A;  1VD2 A;  4GB9 A;  4RF1 A;  5E6P A;  2J52 A;  1HTO A;  2X38 A;  2WDR B;  4M01 A;  1P3Q U;  4S0R A;  3AB5 A;  1BUI C;  3A9K A;  2N1V A;  1CK1 A;  3QAR A;  3L54 A;  1TY2 A;  4RF0 A;  2N9K A;  4UDU C;  3W2D A;  2L00 B;  1L0X B;  1UGM A;  2DYB A;  4DK5 A;  1I4R A;  2LGD A;  1UF0 A;  3PSE B;  1V1O A;  3FIL B;  1YMH E;  4LDT B;  4PT5 A;  1J0G A;  2PVO D;  1YQ4 B;  2DNF A;  3ZNZ B;  3KQ4 A;  3JSV B;  1V80 A;  2AL6 A;  1WGR A;  1WJU A;  2AQ1 B;  3NS8 A;  1V1P A;  3ETR A;  2JPH A;  4DQO C;  2N9E B;  5MPO A;  3GZN I;  1M4V A;  4XWW A;  2ZPN A;  1NI2 A;  3BY4 B;  2Y5P A;  3TIX A;  4A6Q A;  1FPY A;  3DVN V;  1OQQ A;  4MDK E;  5FR6 A;  1WGH A;  2ZZP B;  3CMM B;  4ZRQ A;  2DZI A;  5IKC M;  1L6V A;  2V4I B;  4LNF A;  4DHJ B;  3ZJU A;  1RWS A;  4JIO U;  1WR6 E;  5HI1 A;  3CWI A;  1ZE3 D;  3TJP A;  3P2B A;  3V3X A;  1NYR A;  1SE9 A;  5E6O A;  5I4D A;  3IT6 B;  1IYF A;  4A9A A;  2K3U A;  1UZX B;  1T3Q A;  1V2Y A;  2DZJ A;  2D5G A;  5C2T B;  2OHF A;  4C4V A;  2KKC A;  1YD8 U;  3NVW A;  3MHZ A;  1D5Z C;  1GC7 A;  3Q3J A;  3AE1 B;  2L7R A;  1N60 A;  1OEY J;  1YX6 B;  3D32 A;  1DOI A;  4B0E A;  2KDE B;  2KDI A;  2BVC A;  4EZK A;  1T5X D;  2CU1 A;  3AI5 A;  2NBU A;  3EHV A;  1L5P A;  3P4S B;  2BYF A;  3DBH I;  1XXG A;  3ZTC A;  2LJ5 A;  4G11 A;  1ET6 A;  5LNK 1;  3ZVV A;  5IA7 A;  2PKO A;  4L23 A;  2DYO A;  4FHJ A;  3K9O B;  5DPS A;  3SR6 A;  3BK1 A;  1ROE A;  2FAZ A;  4NZL B;  1V8C A;  3H7P A;  3V61 A;  1QLB B;  3SFE B;  1AYF A;  4GLS C;  2L32 A;  2K8H A;  1TS5 A;  2RR9 A;  2K1F A;  3RZW C;  2BYV E;  1PQS A;  1FCC C;  3BVZ A;  3O13 A;  1YIW A;  2NTS A;  4K1R B;  1TBE A;  1Y56 A;  3KUD B;  1L4Z B;  3C8Y A;  1SB3 C;  1MHX A;  3RNA C;  1D5X C;  4E3C A;  3NZS A;  2B3A A;  2DLB A;  2MW5 A;  3AE9 B;  4XE0 A;  4US9 A;  4FJY A;  1E6E B;  1P98 A;  2XBB C;  3GE8 C;  4DHZ E;  2M19 A;  3HRD D;  2KTF A;  2CJO A;  5JHB A;  1NEN B;  4IW0 A;  1CJE A;  3L08 A;  4LNO A;  2ZNV C;  3PLV A;  3HUI A;  2QIL A;  5J17 A;  4GMV A;  4ACF A;  1WFY A;  3DBL I;  3WAM A;  3GOE A;  1AWD A;  1ENF A;  2JWU A;  2Y5B B;  5BMH A;  3ZKJ C;  2L8J A;  2VZK B;  3PZ8 A;  4GDL A;  3VXW A;  1HEZ E;  1J7C A;  2YVC A;  1QIL A;  2JQR B;  3KH0 A;  3CSF A;  1CZP A;  4KIK A;  2WYQ A;  2E6X A;  2C5L C;  1L6U A;  4N58 A;  1WXS A;  2LGS A;  2W3R A;  3VUY A;  1E90 A;  1MG4 A;  3KYD D;  1MI0 A;  2WXH A;  3RN9 C;  2DZM A;  1QOA A;  2ZPY A;  4M00 A;  3PS6 A;  5J18 A;  2D3C A;  3IHP C;  2KWD A;  1C1Y B;  1DYQ A;  3UQA A;  1ZDX A;  1QF6 A;  3H8H A;  3AMZ A;  4JE3 B;  2ZCC A;  3PVL A;  2IY1 B;  5HG2 A;  4MGZ E;  1V86 A;  1TT5 B;  2BKF A;  1OTR B;  1HA5 A;  2KN4 A;  3CIR B;  4E74 A;  3SD5 A;  4W9F A;  4AUQ C;  3AE8 B;  2C7N B;  4AP4 C;  2MJD A;  2A4Z A;  1YN5 A;  2MBQ A;  2MSE D;  3A9K B;  4YSX B;  4FBJ B;  4Q2J A;  1QOB A;  2J0M A;  2X8X X;  1L0V B;  4KDI C;  4YL8 A;  1GJZ A;  1UH6 A;  1V9J A;  1WGK A;  1XD3 B;  1I35 A;  2WX0 A;  1SGH A;  4HVB A;  3PGE A;  4G3X B;  1IBX A;  2PJH A;  5BO4 B;  5E6J A;  4IM0 A;  5HKH A;  1VLB A;  2MJ3 A;  4IUM B;  2QJL A;  3P4Q B;  2DAJ A;  2IJ0 A;  3IBE A;  4WAA A;  3RT3 B;  2M8S A;  3U52 E;  1WM2 A;  1XF5 L;  1C78 A;  2JRH A;  2NVU I;  3EUB 2;  5HHD G;  2J0J A;  1V5T A;  1OQR A;  2FE8 A;  2I1K A;  4M8M A;  1EWY C;  1ZOY B;  3GZN B;  1IP9 A;  3BIN A;  1P1A A;  4J6I A;  2KC1 A;  2KT7 A;  3L17 A;  4W9H A;  2WXN A;  3DHH C;  4IM3 A;  1WGD A;  3Q8F A;  3LB8 C;  4I6L B;  1FO4 A;  1B1Z A;  3FC4 A;  2KJH B;  2L1A A;  1WY8 A;  3T8M A;  3RNE C;  1LO5 D;  3DQV A;  3AE2 B;  4XX5 A;  4S17 A;  4W9D A;  1AW7 A;  1UGJ A;  4ZOH C;  4C4V B;  2LHD A;  4YT0 B;  4EZJ A;  3VRA B;  2K25 A;  3WCQ A;  2O2V A;  2CHX A;  3AEE B;  3AUL A;  3VTV A;  2LGI A;  2EEL A;  1V49 A;  3NUH B;  2Z8L A;  1F52 A;  5AUK A;  2TSS A;  2ZCB A;  3DVG X;  2W54 A;  3L13 A;  1YOV B;  5CHV C;  4ANU A;  2MLB A;  5E6N A;  1XCT L;  3K9P B;  2C7M B;  2KMA A;  4HKZ E;  4IWQ A;  2MHJ A;  4B9K A;  3ZGZ A;  1UEL A;  3P4R B;  1R4M I;  1QZE A;  1EUV B;  3VAW A;  1VR9 A;  4BOZ B;  1V5O A;  2UWQ A;  2VZK D;  4NJ7 A;  1VCB A;  4MM3 B;  5IOI A;  1MVK A;  4M0W A;  1XLQ A;  3H7P B;  3B2G A;  3WAO A;  5DPW A;  4GU2 A;  4HWI B;  2KWU B;  5DPT A;  1WZ3 A;  4JWU C;  3ZRC A;  3W9C B;  2L52 A;  3PZD A;  3TEY A;  4FLH A;  1L4D B;  4ANX A;  3AEF B;  4JLC A;  1K51 A;  3GP7 A;  1F2R C;  4H2A A;  2XEW A;  2MBO A;  1E10 A;  1HQR D;  3IAM 1;  4P1C C;  5JXV A;  3VVW B;  3DCG A;  3MC9 A;  1WX7 A;  2Z59 B;  2SAK A;  2VH2 A;  1FXA A;  2IO3 B;  5C23 A;  3NRZ A;  3IVF A;  3VFK A;  2OJR A;  2RPV A;  3DHI C;  3GB1 A;  1SJH D;  4HXD A;  3B2F A;  4F8C B;  2IY0 B;  1UNS A;  3M95 A;  4EZL A;  3AEB B;  1N62 A;  2ZNV B;  2J0K A;  1A70 A;  1GPX A;  2QCZ A;  1UWX A;  4MGY E;  2A5U A;  2EKE C;  4L1B A;  3ZNH B;  3AV8 A;  4BFR A;  2BKR B;  3AU5 A;  1XCQ L;  4KIK B;  1KOT A;  1P9D U;  4XDD A;  4USA A;  2EMT A;  4K7W A;  4B6W A;  3DPD A;  2HJ8 A;  3Q3M C;  2BS3 B;  3NOB A;  4US8 A;  4YSZ B;  3ZNI D;  2K5P A;  3RFZ B;  3H7S A;  2PPH A;  3AH7 A;  4MSM B;  3OLM D;  1L0Y B;  3TEW A;  3EFU A;  4BZA A;  3IT4 B;  3B1L X;  3BYT B;  1C79 A;  4FUL A;  1HZ6 A;  1EF1 A;  3KW5 B;  2HE7 A;  5BYS A;  1E9M A;  4REZ A;  2V3P A;  3KUZ A;  2KD0 A;  4W9K A;  1K52 A;  1B9R A;  3VR8 B;  2LJI A;  2ON8 A;  2LGX A;  2JYE A;  3AEC B;  4NAW A;  4X57 B;  3DBR I;  4IC7 B;  1P0R A;  4OVV A;  4QAY A;  1SE2 A;  3WAP A;  2RGF A;  2PTL A;  5CHW A;  4DHZ B;  2GRI A;  1EO6 A;  1OGW A;  2BW2 A;  1YNT E;  2L0T A;  1PGX A;  2N0S B;  2BWE S;  1XT9 B;  1KM7 A;  3A1Q A;  1KJT A;  4HDO A;  2H89 B;  1XLO A;  3PPA A;  2AWT A;  2XNA C;  4P1B C;  2JZ3 B;  2QSD A;  1IGD A;  2KWC A;  4W9C A;  2KVR A;  1IBX B;  3M63 B;  2IO0 B;  2KJ6 A;  2ZVN A;  2D07 B;  3MC0 B;  5JH5 C;  1JRO A;  1TZ1 A;  4HEA 1;  4NNJ B;  3U30 A;  1JML A;  3MP9 A;  2WQY B;  3H1U A;  2AYO B;  2RD0 A;  3AN1 A;  2IGH A;  4MJS A;  4XDC A;  4KGR A;  2AL3 A;  4N59 A;  1T6B X;  1F1H A;  1WXA A;  5D94 A;  3N1Z C;  2W82 A;  3TMP B;  2WHI A;  3Q6B A;  3MTN B;  3EEC A;  1VJK A;  1E0Z A;  3BK2 A;  2KLC A;  3RI7 C;  3BWU D;  3R66 C;  3LDZ E;  4ZDV A;  4RCO A;  5L95 C;  4FXC A;  4HRO A;  2KXJ A;  1FMA D;  2K8C A;  1J7A A;  3PHW B;  3PZ7 A;  2KMC A;  4M8N A;  4LLG M;  2ZEQ A;  3SHQ A;  4C7Y A;  3AE5 B;  4HPL B;  3ZXR A;  3QHT A;  4EUT A;  2IND C;  4IM2 A;  2L0F A;  3WA0 A;  3W5V B;  1EU3 A;  4HK2 A;  3GE3 C;  2O2V B;  2HD5 B;  2NMQ A;  4OHJ A;  2YEP B;  4RGT A;  4C56 C;  4IWP A;  2BYT A;  4ICU A;  4K7S A;  5LXH A;  2DYM A;  4TV3 A;  4E71 A;  2IGD A;  4OZB A;  1C4P A;  2JYT A;  3I3T B;  4KVG B;  5LLI A;  1ZXI A;  1YN4 A;  3RCZ A;  2G4D B;  2HJ1 A;  4BKG A;  1QT9 A;  3HVZ A;  3ZQ4 A;  1E8W A;  2KVZ A;  4CHK A;  4K3C A;  3FKY A;  2KHW B;  4DXA B;  2WXP A;  2MCN B;  5D3D A;  4BAX A;  2C60 A;  4M0W B;  4MM3 A;  4KKJ A;  2XN9 C;  2L05 A;  3TCA A;  4DBG A;  1FXI A;  3EGR A;  4ARI A;  3L16 A;  5BMG A;  4ZRP A;  1R4M B;  3R7R A;  1ZW7 A;  4RH6 A;  3APF A;  3L4P A;  5G5G A;  2AQ2 B;  1X1M A;  4OVU A;  1RFK A;  3V05 A;  4F7Z A;  3NY5 A;  1DOX A;  4TKN A;  1C4C A;  2KQ7 A;  1C4A A;  2BT6 A;  1ZDV A;  4MGK E;  2WU2 B;  5EE1 A;  1ISN A;  2DZK A;  1Z5S B;  1WSP A;  1TKE A;  1WF9 A;  4ZRJ A;  4W9I A;  3SEB A;  5FK9 C;  1U4A A;  3LYY A;  4URK A;  4FJV B;  4ZHO A;  4ZRK A;  2D11 A;  2M4N A;  2RMM A;  3AU4 A;  1WYW B;  3RUI B;  1UBQ A;  2KTR B;  4EEW A;  4HKQ A;  2WXM A;  1LFD A;  2PE9 A;  4DDI D;  2FNJ B;  1FFV A;  3AEA B;  1I4G A;  4W9G A;  4II2 B;  4PS8 A;  3QIJ A;  3U7D A;  1I4X A;  1WX8 A;  1GB1 A;  1ZUD 2;  2N7J A;  2G9H D;  2MBE A;  1ZP0 B;  3Q3N C;  4J3O D;  2K39 A;  1E7P B;  2V3N A;  5AUI A;  1JWM D;  4LCD E;  5H8Y E;  1KLG D;  1H4R A;  3WIM A;  2ZJD A;  2LVQ A;  1N63 A;  5GXG B;  3I63 C;  4G50 A;  2M1M A;  3V6C B;  1Q5W B;  2KMM A;  3N1Y C;  4RNA A;  2QIE B;  1MG8 A;  4LTU A;  2D2Q A;  3ZRF A;  4TMA B;  5IO9 A;  1WE6 A;  1C76 A;  3RD2 A;  1E8X A;  4YSY B;  4WWO A;  2QHO A;  4NAW B;  4OZC A;  4OVZ A;  1MJD A;  2JT4 B;  4D2K A;  4CYE A;  1D3Z A;  4TQ0 A;  1FFU A;  2BS2 B;  3PV1 A;  4RGN A;  3HHM A;  2YEP F;  1YQ3 B;  1GAQ B;  3X0W A;  1JRP A;  1TS3 A;  3AE4 B;  1N61 A;  4HLE A;  3A1Q B;  3C0R B;  3HM3 A;  4AS1 A;  4AWJ A;  2H88 B;  4RMA A;  1C77 A;  2FCS A;  4WJN A;  3U2S C;  1YJJ A;  3DBR B;  4MSQ B;  5EE3 A;  5G2N A;  1CQV A;  4ANV A;  2WNM A;  1K53 A;  2KWV B;  3DWM A;  3PRZ A;  1SF0 A;  3AE6 B;  1WWT A;  3Q8A A;  3VR9 B;  2G4S A;  4MH0 E;  2GI9 A;  5BYR A;  3LJ3 A;  1Q0W B;  2V9H A;  3VH3 B;  1OEY A;  1DGJ A;  4R3D A;  1VRA B;  2K9X A;  4CO7 A;  3TBL D;  2IGG A;  4RGO S;  4LNN A;  2KO3 A;  4KKI A;  4MJS B;  4IOI E;  2OJW A;  1DOY A;  2KK8 A;  3MHS D;  3QJZ A;  1TY0 A;  4HPP A;  3UQB A;  1NYQ A;  4AOF A;  3RZF A;  1ET9 A;  4PYU A;  2JXT A;  1GOZ A;  3KVF B;  1XO3 A;  2K8B A;  1HE8 A;  1PUT A;  4HRS A;  5AZG A;  2PEA A;  1WRD B;  2EKI A;  2QMT A;  3E56 A;  1R4N I;  2Z0D B;  1K50 A;  2MP2 A;  2MBH A;  2VRR B;  3RYT A;  3B9J A;  3ZUN A;  4A20 A;  1YN3 A;  3O65 B;  2ZVO A;  2D3B A;  2JU6 X;  3AEG B;  1SBB B;  1XLP A;  2CS4 A;  4NPN A;  5IAA C;  4ICV A;  3IFW B;  1WGY A;  2CJN A;  3HIZ A;  4MEM A;  3Q3F A;  2FCN A;  3ZLZ A;  2CR5 A;  4JPS A;  3QWZ B;  4FN2 A;  5D2M B;  1RM6 C;  2GBR A;  2LHE A;  3PHX B;  4GOC A;  1A5R A;  1K8R B;  1ACC A;  4B95 A;  2J4X A;  1TIF A;  3APD A;  3ZO5 B;  3KUC B;  2BTE A;  1I4H A;  4LNI A;  1EU4 A;  3ZDM C;  1RRB A;  1NI3 A;  2LFI A;  3N1X C;  2DEN B;  1QOF A;  3W1S C;  2HTH A;  1WIA A;  4HJG E;  3FAH A;  4MT5 A;  2DBY A;  2ZW1 A;  3ABV B;  1MPE A;  4JX1 C;  3W1S A;  4WH4 A;  1WM3 A;  1PGA A;  2WXG A;  1ZKH A;  2UU7 A;  1R7S A;  1YJ1 A;  4I6P A;  3DBH B;  3ENE A;  1TKG A;  5DCN A;  1F77 A;  2MBB B;  4RGM A;  4JGH B;  3Q69 A;  2MA9 B;  1H8C A;  2JZP A;  4KZ0 A;  2KLG A;  3BII D;  1E7V A;  4AJW A;  1C9F A;  3I5J C;  4YXD B;  2KFK B;  1OFF A;  1YJI A;  3ZXV A;  2QC8 A;  4TQ1 A;  4LJO B;  3N9Y C;  2KAC A;  1N6Z A;  4GN1 A;  1F2R I;  1I4Q A;  3UIN B;  2BS4 B;  3NVY A;  2YLM A;  1GC6 A;  2JUO A;  1BT0 A;  2RPQ A;  2QEJ C;  1KH0 A;  1FD6 A;  1Q1O A;  3ML9 A;  2IO1 B;  2ASQ A;  2D3G A;  3U4E G;  1EM7 A;  1JWU D;  1XLN A;  4G0N B;  3UIP B;  1UUP A;  1T0Y A;  3EFC A;  2KTR A;  1N5W A;  2INP E;  1ESF A;  2WXF A;  1YQB A;  2FCQ A;  2KQ4 X;  3TL5 A;  4GIV A;  4FHK A;  3NVZ A;  1JWB D;  3JW0 X;  2MJE A;  1STE A;  1EF5 A;  3A4S C;  3N32 A;  1VDV A;  3NG0 A;  2IPK D;  1IGC A;  2KAJ A;  2WXK A;  2V0G A;  3DBL B;  4F1S A;  5CTR C;  3Q14 C;  4AJY B;  3CF6 E;  1NVI D;  3KLS X;  2XK5 B;  2O6V D;  2K22 A;  3ML8 A;  3PLU A;  3R2I A;  1V6E A;  2DHZ A;  3ZJT A;  2KDM A;  4BKS A;  3DWG C;  4FAD A;  1PGB A;  3MFG A;  1AAR A;  2GMI C;  5AZF A;  3OG5 A;  2FID A;  3TEX A;  2MQJ A;  2K6D B;  3RNC C;  1KRH A;  4BKT A;  3Q8B A;  2WXO A;  3DDC B;  1UBI A;  2NBV B;  2FBW B;  1Z2M A;  4JWS C;  1BXT A;  4B0M A;  2WGS A;  4BBN F;  4DWF A;  3IXS A;  3AXC A;  3RPF C;  2RDB C;  3IAS 1;  2LUM A;  4WUR A;  5EDS A;  3M3J A;  4MGI E;  1SSN A;  4A55 A;  3I9V 1;  2WDT B;  3ZW3 A;  1FM0 D;  2BF8 B;  5KHO A;  4PS7 A;  1RLF A;  4GSW A;  4P6V F;  4JL9 A;  3UF8 A;  2B76 B;  1J7B A;  4FJZ A;  1J19 A;  1T0S C;  4XYC A;  2GLS A;  1MFW A;  2WU5 B;  3A9J B;  2Y5C A;  4ZRI A;  1WXV A;  1J8C A;  3B08 A;  1HZ5 A;  2O6V A;  3UI3 A;  3L0W B;  3ZIM A;  2C9W B;  2I1J A;  1N5X A;  2EMS A;  1ZPS A;  2Y3A A;  3AE3 B;  2K0P A;  1JQ4 A;  2RDH A;  4KGT A;  1IPG A;  3PO0 A;  3BVG A;  2ZW0 A;  2Z0E B;  5FKA C;  4GXB A;  1GB4 A;  3M62 B;  4PYZ A;  5KHQ A;  1JWS D;  2KYW A;  1YX5 B;  3R2T A;  4TUU A;  2DWQ A;  3NJT A;  4W9E A;  5G5H A;  2MP2 B;  4ZYS A;  5FR3 A;  1WR1 A;  3SU8 X;  2LI5 A;  3QX1 A;  5DPR A;  1QKZ A;  2KJR A;  1WXQ A;  3NHE B;  5T8I A;  1WI0 A;  4IWO A;  1WE7 A;  1V81 A;  4YWG G;  5TR5 A;  3N30 A;  1SIF A;  3L10 B;  4GDK A;  2KX0 A;  3ZTD A;  3Q2A C;  4OZA A;  1R4N B;  2KZR A;  3ZDT A;  1KLV A;  2LGY A;  1Y8R C;  2WX1 A;  1TTN A;  1ZXH A;  4BBN C;  1QOG A;  2LMC A;  3NZU A;  1WYG A;  2ICI A;  1MHH E;  2DX5 B;  3WAN A;  4K3B A;  3JYU A;  4NQL B;  2JXX A;  2VH1 A;  3T9L A;  4NQK E;  2OOB B;  1PYW D;  1SJE D;  2LRU A;  3VTU A;  3R3M A;  3AE7 B;  2WDV B;  4XGA B;  4YTN B;  2MEK A;  1WMH A;  4W9J A;  3WAL A;  3TSS A;  3URY A;  3RNB C;  2NS5 A;  2AEH A;  3ECI A;  5EE0 A;  4KSL C;  2NBW B;  3NS1 A;  1VZ6 A;  2LVP A;  2HDE A;  1WJ6 A;  1LQB A;  1M94 A;  1WZ0 A;  4XWT A;  2GBN A;  3R7Q A;  1Q10 A;  4IKG A;  4WWP A;  5C1Z A;  5IP4 D;  2BYE A;  2K6Q A;  2INC C;  1VZ8 A;  1CMX B;  3B0A A;  2W9N A;  1WRI A;  2LUE A;  1UD7 A;  4ASW C;  3VTW A;  3VRB B;  3SFD B;  1OQY A;  2KFK A;  4RM8 A;  2JX5 A;  1LM8 B;  2D10 A;  2PVG C;  2KQS A;  2JWZ A;  3A4R A;  1L2N A;  1S1Q B;  1GNU A;  3E9S A;  4MH8 A;  4M02 A;  1TJE A;  1TYG B;  1KLU D;  2FUH B;  2JY6 A;  2LXA A;  3ZJV A;  4TSS A;  4CQN A;  4II3 B;  3PRE A;  2NPT B;  3ZYY X;  2LD9 A;  5LXI B;  1HXY D;  3V60 A;  3Q8C A;  1JAL A;  1XQQ A;  2NR2 A;  4BVU C;  2JF5 A;  4PK1 A;  2WP9 B;  1GUA B;  4ZHP A;  3OJ4 B;  2PE6 B;  1RYJ A;  2SEB D;  2FCM A; 
#chains in the Genus database with same CATH homology
 1S3S G;  1HE8 A;  1WJ4 A;  2IO3 B;  4MDK E;  5FR6 A;  5C23 A;  2N1W A;  5AZG A;  2PEA A;  2R2Q A;  1WRD B;  1WGH A;  2N9P C;  3IVF A;  3VFK A;  2OJR A;  3HK0 A;  2ZZP B;  3EC8 A;  3CMM B;  1R4N I;  2DZI A;  2Z0D B;  2KX3 A;  2MBH A;  2MP2 A;  2N4F A;  2VRR B;  4HXD A;  3RYT A;  4NY0 A;  4F8C B;  3ZUN A;  2IY0 B;  4A20 A;  4DHJ B;  3M95 A;  4EZL A;  2ZNV B;  3O65 B;  4JIO U;  1WR6 E;  2J0K A;  3QCA A;  4MGY E;  2A5U A;  2EKE C;  3ZNH B;  2ZVO A;  3TJP A;  3P2B A;  1SE9 A;  2C7H A;  5E6O A;  2KOX A;  2M0X A;  2CS4 A;  4EOY A;  4NPN A;  2BKR B;  2GBJ A;  3AU5 A;  4BFR A;  5IAA C;  1IYF A;  2CHW A;  4KIK B;  4ICV A;  3IFW B;  1KOT A;  1P9D U;  2BPS A;  1WGY A;  4LDT D;  1UZX B;  2EMT A;  3HIZ A;  1E8Y A;  3Q3F A;  2FCN A;  2KC2 A;  3QA8 A;  4MEM A;  3ZLZ A;  2CR5 A;  2XK5 A;  4K7W A;  2JZZ A;  1V2Y A;  2DZJ A;  2HJ8 A;  3DPD A;  4B6W A;  3QWZ B;  3VDZ A;  4FN2 A;  3NOB A;  4LJP B;  5D2M B;  3H6N A;  3ZNI D;  2BGF A;  2GBR A;  2KKC A;  3PHX B;  3H7S A;  4GOC A;  3QC8 B;  1K8R B;  3PRP B;  3VUW A;  1A5R A;  2L3Z A;  1YD8 U;  2PPH A;  4WJQ A;  4MEL A;  4HPM B;  3VH4 B;  4MSM B;  3OLM D;  4B95 A;  4WJP A;  3EFU A;  3B1L X;  3APD A;  3ZO5 B;  4FUL A;  1GC7 A;  3KUC B;  5GMV A;  3Q3J A;  3UGB B;  1EF1 A;  2L7R A;  1WH3 A;  2IYD B;  3KW5 B;  2HE7 A;  1OEY J;  4EFO A;  3ZDM C;  4N9F 4;  2LWP A;  5G55 A;  1RRB A;  1YX6 B;  3DVN U;  3D32 A;  1WJN A;  3KUZ A;  2KD0 A;  2DEN B;  3W1S C;  2N7D A;  2KDE B;  2KDI A;  4W9K A;  4EZK A;  2HTH A;  2CU1 A;  1WIA A;  3UIO B;  3AI5 A;  2NBU A;  3EHV A;  2IBI B;  2BYF A;  3DBH I;  3W1S A;  1WM3 A;  2LGX A;  3ZTC A;  4NAW A;  1I42 A;  4X57 B;  4A3P A;  3DBR I;  4IC7 B;  1P0R A;  2LJ5 A;  1ZKH A;  4OVV A;  3WAP A;  4DHJ D;  2LAS A;  2RGF A;  4G11 A;  2GOW A;  1YJ1 A;  5CHW A;  1WGG A;  3HM6 X;  1EO6 A;  1OGW A;  4I6P A;  4DHZ B;  3ENE A;  3ZVV A;  5DCN A;  5IA7 A;  2MBB B;  4FA6 A;  4JGH B;  3QQ8 B;  2L0T A;  2DYO A;  2MA9 B;  1H8C A;  2R2O A;  4FHJ A;  3K9O B;  4KZ0 A;  5DPS A;  2BWE S;  1XT9 B;  1KM7 A;  2FAZ A;  2KLG A;  1KJT A;  3A1Q A;  1E7V A;  4HDO A;  5J2R A;  4AJW A;  3OJ3 A;  3PPA A;  2AWT A;  3SDL C;  2JZ3 B;  3H7P A;  3V61 A;  2KFK B;  2KN5 A;  2KWC A;  4W9C A;  3A9J A;  2KVR A;  4WWN A;  5CX3 A;  4TQ1 A;  4LJO B;  3OAW A;  2O6V B;  3M63 B;  2K8H A;  2IO0 B;  2KJ6 A;  2RR9 A;  2K1F A;  2ZVN A;  2D07 B;  3RZW C;  2BYV E;  5JH5 C;  4GN1 A;  1PQS A;  2LVO A;  2M17 A;  2MRP A;  1TZ1 A;  1YIW A;  1ZGU B;  4K1R B;  1TGZ B;  1TBE A;  3W1Y A;  4NNJ B;  3U30 A;  3UIN B;  3KUD B;  2YLM A;  3JSV A;  3H1U A;  1GC6 A;  2AYO B;  2JUO A;  2RD0 A;  1BT0 A;  2RPQ A;  2BWF A;  4MJS A;  3DBS A;  1Q1O A;  3ML9 A;  2IO1 B;  2GBM A;  1L7Y A;  2MX2 A;  4KSK C;  4E3C A;  3NZS A;  2AL3 A;  2ASQ A;  2CHZ A;  4KDL B;  2D3G A;  2B3A A;  4EKU A;  4G0N B;  3QK0 A;  1WXA A;  3JVZ X;  3UIP B;  5D94 A;  2L76 A;  1T0Y A;  2MW5 A;  2V4L A;  4FJY A;  2KTR A;  3TMP B;  1P98 A;  2XBB C;  3MTN B;  3EEC A;  4DHZ E;  2KTF A;  2KLC A;  2WWZ A;  5JHB A;  4IW0 A;  1YQB A;  2FCQ A;  3R66 C;  3L08 A;  3LDZ E;  3TL5 A;  2MWS B;  4GIV A;  2ZNV C;  3PLV A;  3U8Z A;  4WJO A;  4ZDV A;  4FHK A;  5L95 C;  5J17 A;  3JW0 X;  4GMV A;  2KXJ A;  1EF5 A;  2DAF A;  3A4S C;  3N32 A;  1WFY A;  3DBL I;  3WAM A;  3GOE A;  2K8C A;  4GDK B;  2Y5B B;  3PHW B;  1NDD A;  3ZKJ C;  2KMC A;  2UYZ B;  4M8N A;  2L8J A;  4JQW C;  2ZEQ A;  3SHQ A;  4HPL B;  4GDL A;  4HCP B;  3QHT A;  3VXW A;  4EUT A;  4F1S A;  5CTR C;  4IM2 A;  4AJY B;  2L0F A;  2CKH B;  3WA0 A;  3CF6 E;  2YVC A;  4I6N B;  3KH0 A;  3CSF A;  4HK2 A;  4KIK A;  2WYQ A;  2C5L C;  2XK5 B;  2O6V D;  1WXS A;  3VUY A;  2IZV B;  2NCN A;  2O2V B;  3ML8 A;  1E90 A;  3PLU A;  1WXM A;  2HD5 B;  4KV2 A;  3KYD D;  1V6E A;  2DHZ A;  2DZM A;  2ZPY A;  3PS6 A;  4IWP A;  3H9D A;  4HJK A;  4BKS A;  5J18 A;  4ICU A;  3IHP C;  4K7S A;  4FAD A;  1C1Y B;  1AAR A;  2G3Q B;  2GMI C;  1WMH B;  5AZF A;  2DYM A;  5LXH A;  3UQA A;  4TV3 A;  4IG7 B;  4E71 A;  5AZH A;  2FID A;  2ZCC A;  3PVL A;  2GBK A;  2MQJ A;  2IY1 B;  2K6D B;  4MGZ E;  1V86 A;  2BKF A;  3I3T B;  1OTR B;  4KVG B;  5LLI A;  4BKT A;  3QAQ A;  5AEK B;  4E74 A;  3RCZ A;  5L83 A;  3SD5 A;  2G4D B;  1UBI A;  3DDC B;  2NBV B;  4BKG A;  1Z2M A;  4K81 A;  4W9F A;  1E8W A;  4AUQ C;  4CHK A;  4ZYN A;  2KHW B;  4DXA B;  2C7N B;  4BBN F;  2MCN B;  3S2A A;  4AP4 C;  4DWF A;  4PS3 A;  2A4Z A;  3AXC A;  2MSE D;  2MBQ A;  5JZE B;  3A9K B;  1RAX A;  4GGQ A;  2C60 A;  4M0W B;  4MM3 A;  2REX A;  5EDS A;  3M3J A;  4MGI E;  4FBJ B;  2L05 A;  1F9J A;  2J0M A;  2WDT B;  3TCA A;  2LRW A;  3ZW3 A;  4DBG A;  1E8Z A;  5KHO A;  2BF8 B;  4PS7 A;  1RLF A;  3L16 A;  4GSW A;  4KDI C;  4YL8 A;  4JL9 A;  3UF8 A;  5CHF A;  4FJZ A;  4DDG D;  3R7R A;  1ZW7 A;  1GJZ A;  3N3K B;  3APF A;  1UH6 A;  1J19 A;  1V9J A;  3A9J B;  4BKS D;  1XD3 B;  1I35 A;  2WX0 A;  4ZRI A;  3X23 A;  1SGH A;  1WXV A;  1J8C A;  1X1M A;  4OVU A;  4HVB A;  3B08 A;  4NJ6 A;  3PT2 B;  3PGE A;  4G3X B;  2O6V A;  2PJH A;  5BO4 B;  4F7Z A;  3L0W B;  3NY5 A;  1JRU A;  3ZIM A;  4TKN A;  2C9W B;  2G45 B;  2KQ7 A;  1GG3 A;  2I1J A;  2NPT A;  3MJW A;  4IM0 A;  2EMS A;  5D6J B;  5HKH A;  4MGK E;  4BOS C;  2LXC A;  1ISN A;  2DZK A;  1Z5S B;  4IUM B;  3A33 B;  1IPG A;  4WQO B;  3CST A;  2DAJ A;  3IBE A;  2Z0E B;  1WF9 A;  3DVG Y;  4ZRJ A;  4W9I A;  4WAA A;  3RT3 B;  2M8S A;  3DOW A;  2JRI B;  4GXB A;  4K7U A;  1WM2 A;  3M62 B;  1U4A A;  3KYC D;  4PYZ A;  4URK A;  5KHQ A;  4FJV B;  4ZRK A;  4HCN B;  2JRH A;  2D11 A;  2NVU I;  2J0J A;  2M4N A;  3AU4 A;  3V6E B;  1WYW B;  1YX5 B;  3RUI B;  1V5T A;  1UBQ A;  2KTR B;  4TUU A;  4W9E A;  2I1K A;  2MP2 B;  3IG3 A;  4M8M A;  1WR1 A;  4EEW A;  3SU8 X;  2LI5 A;  1IP9 A;  1WX9 A;  1LFD A;  3BIN A;  1P1A A;  4J6I A;  2KC1 A;  3L17 A;  3QX1 A;  5DPR A;  1E7U A;  2PE9 A;  4W9H A;  4DDI D;  2FNJ B;  3PTF C;  4IM3 A;  4W9G A;  1WGD A;  4II2 B;  2KJR A;  3QIJ A;  4PS8 A;  3RUL A;  3U7D A;  3NHE B;  4I6L B;  1WX8 A;  4P7I A;  2KDB A;  2V1Y A;  1WI0 A;  4IWO A;  4A3O A;  2KJH B;  1WE7 A;  1V81 A;  5TR5 A;  3N30 A;  1SIF A;  3L10 B;  1WY8 A;  3T8M A;  1E5W A;  2V3S A;  4GDK A;  2KX0 A;  2MBE A;  1FXT B;  3DQV A;  4XX5 A;  3APC A;  3ZTD A;  4W9D A;  2FIF A;  3PRM B;  1G6J A;  4GDL B;  2KZR A;  3ZDT A;  2KFJ A;  1KLV A;  2LGY A;  3VHT C;  1Y8R C;  2WX1 A;  1TTN A;  4BBN C;  2K39 A;  3NZU A;  3ZNG C;  1RFA A;  2DX5 B;  3V62 A;  3WAN A;  2RSU A;  4LCD E;  4W9L A;  1C3T A;  3JYU A;  4NQL B;  2JXX A;  4HDQ A;  2IO2 B;  4EZJ A;  1H4R A;  2K25 A;  3T9L A;  4RM9 A;  2O2V A;  2CHX A;  4NQK E;  3WIM A;  3AUL A;  4KZC A;  2OOB B;  2ZJD A;  3VQI A;  3VTV A;  2LVQ A;  2KDF B;  1V49 A;  2N9X A;  1LXD A;  2LRU A;  3VTU A;  3ONS A;  4G50 A;  3R3M A;  2M1M A;  5JHA A;  3V6C B;  1Q5W B;  2ZCB A;  3DVG X;  3L13 A;  1WMH A;  4W9J A;  3WAL A;  2N7E A;  5CHV C;  1MG8 A;  4ANU A;  2D2Q A;  2MLB A;  3ZRF A;  2LZ6 A;  5E6N A;  1WE6 A;  3K9P B;  3RD2 A;  1E8X A;  3VUX A;  2NS5 A;  3ALB A;  1NBF C;  2KNB A;  2C7M B;  2AEH A;  3ECI A;  2KMA A;  4ANW A;  5D7G A;  2JVC A;  2J7Q B;  4IWQ A;  4XC2 A;  4WWO A;  2KAN A;  2QHO A;  4NAW B;  4XZ4 A;  4KSL C;  2NBW B;  4B9K A;  1VD2 A;  4GB9 A;  2JT4 B;  1UEL A;  4CYE A;  5E6P A;  2LVP A;  1D3Z A;  4TQ0 A;  3PV1 A;  1WJ6 A;  1R4M I;  1LQB A;  1QZE A;  1M94 A;  1EUV B;  1WZ0 A;  3VAW A;  2GBN A;  3R7Q A;  3HHM A;  1P3Q U;  4WWP A;  4BOZ B;  1V5O A;  2UWQ A;  3X0W A;  5C1Z A;  2BYE A;  4NJ7 A;  1VCB A;  2K6Q A;  3A9K A;  4HLE A;  3A1Q B;  1CMX B;  2N1V A;  3B0A A;  3C0R B;  3HM3 A;  3QAR A;  3L54 A;  2W9N A;  4AWJ A;  4RMA A;  2LUE A;  1UD7 A;  3H7P B;  4ASW C;  3VTW A;  2FCS A;  4WJN A;  3WAO A;  2L00 B;  5DPW A;  1OQY A;  1UGM A;  2KFK A;  2DYB A;  4GU2 A;  4MSQ B;  4RM8 A;  1LM8 B;  4HWI B;  5G2N A;  2D10 A;  4DK5 A;  2LGD A;  4ANV A;  2KWU B;  3PSE B;  5DPT A;  1WZ3 A;  4LDT B;  2KQS A;  2KWV B;  2JWZ A;  3A4R A;  3PRZ A;  3ZRC A;  1L2N A;  1J0G A;  2G4S A;  4MH0 E;  3PZD A;  1S1Q B;  3LJ3 A;  1Q0W B;  4FLH A;  1GNU A;  4ANX A;  3ZNZ B;  3VH3 B;  1OEY A;  1V80 A;  2AL6 A;  2FUH B;  2JY6 A;  1WGR A;  3JSV B;  4JLC A;  2LXA A;  2XEW A;  1WJU A;  4II3 B;  2MBO A;  3NS8 A;  3PRE A;  4CO7 A;  2NPT B;  3TBL D;  2LD9 A;  2JPH A;  2KO3 A;  4MJS B;  5LXI B;  3V60 A;  2N9E B;  2KK8 A;  3GZN I;  3MHS D;  3QJZ A;  1XQQ A;  2ZPN A;  1NI2 A;  3VVW B;  3DCG A;  2NR2 A;  4BVU C;  2JF5 A;  4AOF A;  3UQB A;  3RZF A;  1WX7 A;  2Z59 B;  4PYU A;  3BY4 B;  1GUA B;  3KVF B;  3TIX A;  3OJ4 B;  2PE6 B;  2FCM A;  3DVN V;  2K8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...