2MQJA

Solution structure of ubiquitin-like protein from caldiarchaeum subterraneum
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'MKIKIVPAVGGGSPLELEVAPNATVGAVRTKVCAMKKLPPDTTRLTYKGRALKDTETLESLGVADGDKFVLITRTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein
publication title Solution structure of ubiquitin-like protein from Caldiarchaeum subterraneum
rcsb
source organism Candidatus caldiarchaeum subterraneum
molecule tags Ligase
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mqjA00
4BKSA 1RFAA 2ZZPB 4W9LA 3M63B 4MSQB 2IBIB 1WJ4A 3CSFA 3NHEB 4WWNA 5GMVA 2LVQA 3T8MA 3DOWA 3U7DA 4KSKC 1WM3A 4OVUA 4W9KA 5LXIB 1WE7A 3DVNV 4GXBA 1WGDA 2JZZA 2RR9A 4FULA 1LQBA 2AEHA 3ZO5B 4CYEA 4EFOA 3L10B 4NAWA 2Z0DB 3BINA 4A3OA 4ANVA 3PS6A 3GOEA 1QZEA 3NZSA 2O6VD 5IAAC 3APFA 3ZTCA 2GMIC 2LVOA 1OQYA 1KJTA 2FIFA 3SHQA 4EKUA 2KC1A 3WIMA 1I35A 1E8WA 1WX7A 3KUDB 2KQ7A 3HK0A 1OGWA 4EZJA 3RCZA 3PRMB 4PS7A 2G4SA 2KJHB 3QC8B 5AZGA 2GBKA 4ANXA 3RULA 4K7UA 4AWJA 2FCSA 3QIJA 3RUIB 2DYMA 4WAAA 2O6VB 4WWPA 1S1QB 1AARA 1UELA 2K6DB 3ZKJC 4AJYB 3ZLZA 4KZ0A 2KMAA 4LJPB 2KKCA 2RPQA 3IHPC 1WXAA 2MWSB 2KOXA 2REXA 4WJOA 3OAWA 1IYFA 1XQQA 4KDLB 3SD5A 3PGEA 5EDSA 2LGXA 5E6NA 1WX9A 4MM3A 4PS8A 3M62B 2AL3A 2LZ6A 4WQOB 4DHJB 1C1YB 2AL6A 3ENEA 5JZEB 2MBOA 4LDTD 2GBRA 3UQAA 4F1SA 2DYOA 3IFWB 4BKSD 5J18A 2BYEA 2Y5BB 4RM9A 2BKFA 4K1RB 1V86A 4XZ4A 3CSTA 3JVZX 3MTNB 4W9JA 1WM2A 1U4AA 1GUAB 1M94A 1GNUA 2L00B 2Z59B 3JYUA 4WJPA 5E6OA 2UYZB 2N7EA 2XK5B 3H6NA 1D3ZA 3DDCB 3EECA 1J8CA 3O65B 1ZW7A 1GC7A 3PLUA 2MCNB 4LDTB 3ZNID 2KX0A 1WZ3A 3DBRI 3RYTA 1E7VA 3VUXA 1Z5SB 4J6IA 4KIKA 3WANA 3PTFC 1EUVB 4K7WA 4MGZE 3UGBB 5DPSA 5LLIA 1WMHA 1SIFA 4NQLB 1WXVA 2W9NA 3VTWA 4BFRA 1TBEA 4IM2A 4JQWC 3EHVA 3ZRFA 3A4SC 3V6EB 2KDFB 2M4NA 3EFUA 2HJ8A 4HK2A 4NAWB 3WAMA 5C1ZA 1YIWA 3ZNHB 3QQ8B 4FLHA 4A20A 3TCAA 3C0RB 3EC8A 2MSED 3DVNU 4MJSA 4FJYA 2HTHA 5CTRC 3ZTDA 2FCNA 4II3B 4FA6A 3AXCA 1OEYA 3QAQA 5JHBA 2KTRA 2DZJA 3KYDD 2KLCA 3PHWB 3VTUA 2KZRA 5D94A 5DPRA 4HDQA 2FUHB 3ZVVA 1JRUA 5CX3A 4FHKA 2N1WA 3IG3A 2LVPA 2DX5B 4BBNC 2XEWA 2BKRB 3PPAA 2FNJB 4ZYNA 3TJPA 3DBLI 2J7QB 2KWUB 3M95A 3N32A 4G11A 1J0GA 2N1VA 2PE9A 2V1YA 4GIVA 3DVGX 3IBEA 3QCAA 4K7SA 3PHXB 4TUUA 1NDDA 4HCNB 2YVCA 2L8JA 2AYOB 3D32A 2ZCCA 2C5LC 3LDZE 2DZKA 2NPTA 3QHTA 1GJZA 1WR1A 2CHWA 2EMTA 4FJZA 3OLMD 3KW5B 3WAOA 4GDKB 1PQSA 2MBHA 2D2QA 5D2MB 2DZIA 2K1FA 3SDLC 2LXCA 5AZFA 3VUWA 3UIOB 2G3QB 1F9JA 3QX1A 4EZKA 1OEYJ 1WY8A 4MDKE 5L95C 3DBSA 2IO3B 4A3PA 4WWOA 4DWFA 1WX8A 1E5WA 1K8RB 2ASQA 3DVGY 1WGRA 3P2BA 3A33B 2C7HA 1Q5WB 2LJ5A 1WGYA 2G45B 4NNJB 3ZIMA 2MRPA 2DAFA 3ZRCA 2CHXA 2AWTA 3ALBA 3APCA 2PEAA 4I6PA 4E71A 4DHJD 3APDA 4ICVA 4KIKB 3OJ4B 2J0KA 2LUEA 4IWQA 3VFKA 3WAPA 3NOBA 4BBNF 1YD8U 4AJWA 5CHVC 3BY4B 3QWZB 1V81A 2N9PC 4EUTA 3CMMB 3DPDA 2I1JA 4K81A 1WMHB 1UH6A 2I1KA 4PYZA 3N30A 3W1SA 1EO6A 1WF9A 1WRDB 2K6QA 1MG8A 2KLGA 4MGIE 2CU1A 1WJ6A 3VXWA 3A9JA 4W9FA 1GC6A 4AOFA 3PV1A 1VD2A 2IY0B 1UBIA 2C60A 1YX6B 2WX0A 2C9WB 1XT9B 4MGYE 4G50A 2BYFA 1H8CA 3PLVA 4ANUA 1WGHA 2CKHB 4MJSB 2K8BA 4GDKA 3PSEB 1YX5B 2KTRB 1L2NA 2MA9B 2J0JA 3KH0A 1R4MI 4HWIB 3VDZA 2KC2A 3TL5A 3A4RA 1ZGUB 3VUYA 2NCNA 3ZDMC 1S3SG 4X57B 5KHQA 2BWFA 2KANA 3VTVA 4EZLA 4HDOA 2GBNA 2BGFA 1V80A 2IYDB 1WGGA 4WJNA 3HM6X 1YQBA 2BPSA 2EKEC 4IM0A 2LGDA 3UF8A 4P7IA 3MHSD 2LRWA 1T0YA 2MP2A 3ZUNA 4AP4C 2KHWB 2JPHA 2KWVB 4FHJA 2EMSA 1E8XA 4AUQC 3AU5A 3Q3FA 4IW0A 3A1QA 5BO4B 3WALA 2ZNVB 4FN2A 3JSVB 2NPTB 3DBHI 3B0AA 1E90A 4W9EA 4BOZB 2R2QA 4FADA 2KJ6A 4I6LB 2MBQA 3V61A 3V60A 2Z0EB 4GMVA 3NZUA 1TTNA 3B08A 2FCMA 1NBFC 1L7YA 2NR2A 1V49A 2D10A 3L54A 5TR5A 1Z2MA 4GU2A 2KFJA 3AI5A 4II2B 2CS4A 1E8ZA 1V5TA 2KFKA 3H1UA 4DHZE 4ANWA 5G2NA 3HM3A 1A5RA 4MGKE 3W1YA 2K8HA 1UZXB 4ICUA 2J0MA 4G3XB 3VVWB 4HLEA 3X23A 2NS5A 3A9KB 2IZVB 3LJ3A 5E6PA 3PREA 4JGHB 3ZDTA 4KSLC 3SU8X 1G6JA 3ECIA 4JIOU 2D07B 3ML8A 3QA8A 3PT2B 4HPMB 4IC7B 2HD5B 2N7DA 1P3QU 4NY0A 1ISNA 3V62A 2HE7A 2KJRA 2M8SA 2RSUA 2ZVNA 2KVRA 3H9DA 3L17A 3UIPB 3ONSA 3L0WB 3CF6E 5LXHA 3TBLD 3H7SA 3A9JB 2BYVE 2IO2B 4CO7A 4ZRIA 1LM8B 2LGYA 3K9PB 2MW5A 1CMXB 2MX2A 3OJ3A 3JSVA 4F7ZA 2L0FA 2ZCBA 1KM7A 2JRHA 2DHZA 2MBBB 2RD0A 2XBBC 2IO1B 2ZPNA 5AZHA 1WE6A 3VAWA 1UBQA 4CHKA 4HJKA 1TGZB 4E3CA 2JZ3B 2KDBA 2LASA 2WYQA 5J17A 2WX1A 3VHTC 4OVVA 2LWPA 3W1SC 1TZ1A 4IWPA 4HVBA 1R4NI 2LI5A 2N4FA 4YL8A 2K39A 2O2VB 3L16A 3QJZA 4IM3A 3WA0A 4BVUC 2KMCA 3H7PA 5DPWA 1V9JA 2CR5A 1VCBA 2D11A 3DQVA 4HXDA 2MP2B 4PS3A 1I42A 1WJUA 1SGHA 3ZNGC 1RAXA 2C7NB 3QK0A 3PZDA 3A9KA 5CHFA 2DENB 2M17A 2BWES 3A1QB 3KUCB 3TMPB 4ZDVA 4LJOB 3RD2A 2JVCA 4B6WA 4BKGA 4EEWA 2N9EB 2M1MA 3B1LX 4W9HA 5DPTA 5CHWA 1SE9A 2KQSA 4DHZB 4DK5A 4KZCA 2KN5A 2MQJA 2L0TA 1E8YA 3QARA 2L7RA 2NBUA 4IG7B 4TQ1A 4B95A 2YLMA 4B9KA 2G4DB 2A4ZA 3HHMA 4IUMB 4HPLB 2FCQA 2MLBA 4G0NB 5G55A 2M0XA 1P9DU 2KFKB 2LD9A 4GOCA 4URKA 3M3JA 3U8ZA 2D3GA 2JF5A 4MEMA 2WWZA 1WI0A 1X1MA 2OOBB 4MELA 1V2YA 2NVUI 5C23A 4DBGA 2IO0B 4FBJB 2GBMA 1V6EA 4GDLA 2V4LA 5AEKB 2GOWA 3PRPB 2KD0A 2KNBA 3N3KB 1E7UA 3X0WA 2L3ZA 1LXDA 3S2AA 1RRBA 3PVLA 1XD3B 4W9GA 3RZWC 1V5OA 3KUZA 3NS8A 2O2VA 2K8CA 3VQIA 2IY1B 5JHAA 3R7QA 2KDIA 3GZNI 3HIZA 1J19A 4LCDE 4PYUA 4RM8A 2GBJA 3TIXA 4BOSC 3RZFA 3JW0X 5L83A 2PJHA 1ZKHA 2N9XA 1RLFA 3IVFA 3R7RA 1HE8A 4DDID 1P98A 4ZRKA 3MJWA 3VH4B 4EOYA 5J2RA 4WJQA 2UWQA 4I6NB 4JLCA 4KDIC 4KVGB 4TQ0A 3L13A 4MSMB 3KYCD 5JH5C 2ZJDA 2RGFA 1P0RA 4GB9A 1UGMA 1P1AA 4XC2A 1WH3A 2JXXA 2KO3A 5DCNA 2KDEB 4NQKE 1WXSA 4M8NA 1IP9A 1Y8RC 5IA7A 1C3TA 2ZNVC 4MH0E 4JL9A 3NY5A 2V3SA 3AU4A 3H7PB 3PRZA 2R2OA 1WFYA 2FIDA 4ASWC 4W9IA 4TKNA 4ZRJA 2KX3A 2LXAA 4DXAB 4NJ6A 1LFDA 2JUOA 2KK8A 2KXJA 2NBVB 2OJRA 2PPHA 4NJ7A 2O6VA 1IPGA 5D6JB 2L76A 2A5UA 2FAZA 2LRUA 4HCPB 3U30A 4KV2A 1H4RA 5FR6A 1UD7A 2ZPYA 4RMAA 1WR6E 3UQBA 2L05A 3ZW3A 1WXMA 4BKTA 4E74A 3ML9A 4GSWA 1WYWB 2WDTB 1WJNA 3UINB 1YJ1A 1OTRB 4NPNA 3V6CB 2KWCA 5HKHA 2VRRB 3Q3JA 1FXTB 2BF8B 4N9F4 4F8CB 1KOTA 1NI2A 3R66C 2ZEQA 3AULA 1BT0A 3VH3B 4W9CA 4GGQA 3KVFB 2KTFA 4DDGD 1GG3A 2DYBA 4M0WB 3ZNZB 4GDLB 5D7GA 1Q0WB 4FJVB 2JWZA 2DAJA 2ZVOA 3T9LA 4IWOA 5KHOA 2B3AA 1WZ0A 2CHZA 2PE6B 3L08A 1KLVA 2JY6A 2MBEA 3DCGA 2XK5A 3K9OB 2QHOA 4M8MA 4XX5A 1Q1OA 4W9DA 1EF1A 1WIAA 2NBWB 1EF5A 2JT4B 2JRIB 2K25A 3R3MA 4GN1A 4TV3A 3RT3B 3I3TB 2C7MB 2DZMA
chains in the Genus database with same CATH superfamily
1N6ZA 3AE8B 1RFAA 2ZZPB 4MSQB 4O1NA 1HTOA 3HRDD 4OVUA 4CYEA 5LNK1 1L0VB 1STEA 5IN7A 4M02A 4ANVA 1EWYC 4RFBA 3GOEA 4HPPA 1XXGA 1WWTA 2GMIC 1OQYA 1KJTA 3AEBB 4XE0A 4EKUA 2KC1A 2MHJA 1WX7A 3HK0A 3AEAB 1OGWA 3PRMB 2QCZA 4ANXA 2FUG1 4K7UA 4ARIA 1SE3A 1IBXB 3QIJA 1Y56A 4S0RA 1FCLA 2BW2A 4N6EB 4AJYB 2KDMA 3R2TA 1WXAA 3PGEA 2LGXA 1WX9A 4PS8A 3M62B 3AE2B 3ENEA 2MBOA 4LDTD 2CJOA 4F1SA 2X38A 2Y5BB 2BKFA 3JVZX 2LUMA 2D5GA 2QMTA 5E6OA 2XK5B 1D3ZA 3B2FA 3EECA 1J8CA 2V3PA 1GC7A 3PZ7A 2MCNB 3ZNID 2KX0A 1WZ3A 3DBRI 4XWTA 1Z5SB 4KIKA 4DXFA 3MC8A 1FEHA 3KQ4A 3HUIA 1JCKB 5T8IA 2W9NA 5I4DA 1TBEA 2D3BA 2PW9A 3V6EB 2KDFB 2M4NA 2UU7A 4HK2A 1YIWA 3ZNHB 1SJHD 2LEKA 4FLHA 4A20A 2AX5A 3TCAA 2MSED 4C7ZA 3IXSA 4MJSA 4FJYA 2HTHA 5CTRC 2WLBA 4FA6A 3AXCA 3UI3A 3QAQA 5JHBA 2DZJA 5BYQA 3CWIA 3AE4B 5D94A 1Q10A 4FHKA 3IT6B 1PGAA 1NYQA 2V1YA 3V3XA 3IBEA 4K7SA 4KX6B 1NDDA 2BQQA 1J7AA 2YVCA 3D32A 1YNTE 2NPTA 2KACA 2CHWA 1JWAD 4D2KA 1T3QA 2N9LA 3KW5B 2DWQA 4XDCA 2G3QB 1WY8A 5L95C 4WWOA 4DWFA 2INPE 1WGRA 4ZOHC 1EM7A 4K3BA 3P4QB 1FXAA 2MRPA 5HFYA 4I6PA 4WAFA 3I9V1 4KIKB 1K52A 3BY4B 3RN9C 3TEWA 1UH6A 2G9HD 4PYZA 3N30A 4YSXB 3I5JC 2KLGA 1MG8A 1OFFA 3KLSX 3E9SA 2WHIA 1UBIA 1YX6B 1XT9B 1H8CA 2CKHB 4MJSB 1YMHE 2K8BA 1WXQA 1L2NA 2WXNA 3KH0A 4OHJA 1ZXHA 2NCNA 3ZDMC 1S3SG 1P7FA 3VTVA 3U2SC 3PO0A 1V80A 2EKIA 4A6QA 1F77A 2D3CA 4R3DA 4P7IA 2MP2A 2GRIA 2RDHA 1AYFA 3JSVB 2NPTB 2NMQA 5AUKA 4W9EA 2R2QA 3BVZA 2MBQA 3IT4B 1KTKA 1T0SC 1R4MB 4USAA 2D10A 3L54A 1Z2MA 1T0QC 4GU2A 2KFJA 4II2B 1J7CA 2CS4A 4DHZE 1ZOYB 2JQRB 2ZW1A 3BYTB 1A5RA 3AH7A 2WXRA 2AQ1B 1FNUA 4OW0A 1VR9A 1L6VA 3X23A 3A9KB 1HZ6A 2IDYA 3ECIA 1G6JA 3ML8A 4HPMB 2L83A 3V62A 2RSUA 2ZVNA 4OZBA 3DHIC 4KKIA 4P1CC 4CO7A 4ZRIA 2MW5A 4F7ZA 2ZCBA 1KM7A 2DHZA 4RF1A 3GE3C 1I4RA 4HJKA 2YEPF 2WYQA 5J17A 2J42A 2LWPA 1TZ1A 4IWPA 4L1BA 2LI5A 5IOIA 4IM3A 4REZA 5DPWA 1V9JA 4HXDA 2D11A 3VR9B 2MP2B 3DWMA 3DWGC 2SAKA 2JVCA 3Q3MC 2GI9A 4BKGA 2M1MA 3B1LX 4W9HA 1SE9A 4KZCA 1FM0D 2L0TA 3EA6A 3Q69A 4TQ1A 2YLMA 2G4DB 2A4ZA 3HHMA 2FCQA 1R4NB 2N0SB 3M3JA 4XGAB 2OOBB 1V2YA 5C23A 2KNBA 1E7UA 1XCTL 2WXQA 1RRBA 3PVLA 2KMMA 3NS8A 4HRSA 2KYWA 5JHAA 2IY1B 3N9YC 3GZNI 3HIZA 2WGSA 2H89B 1HA5A 2LMCA 3AEFB 1EU4A 2R61A 5H8YE 3TIXA 4BOSC 1C78A 5EE1A 3RZFA 2PJHA 3H8HA 1F1HA 3N20C 2QDFA 2JXTA 5J2RA 2WXPA 1VZ6A 4JLCA 2G1EA 3ZXRA 4KVGB 4TQ0A 1MI0A 3I57A 1KFYB 1VLBA 1CQVA 2IGDA 1QLBB 1P1AA 1WH3A 4IKGA 4WURA 3MHZA 2B76B 1C3TA 1XCQL 3AU4A 2DNFA 4WIPA 1WFYA 1N5XA 1NYRA 4ASWC 4ZRJA 1C77A 2OJRA 2KK8A 4IDIA 2E3TA 5D6JB 3I63C 2ZPYA 4RMAA 2RPVA 1VZ7A 3RI7C 2WDTB 1C4CA 1WJNA 1YJ1A 3E56A 5HKHA 1FXTB 1NI2A 2IPKD 3ZXVA 3C8YA 5D7GA 3AE3B 4TMAB 1FO4A 5KHOA 1V1OA 2M56B 4YTMB 3K9OB 4XX5A 3RNFC 1EWCA 3M63B 1WJ4A 3NHEB 3T8MA 3DOWA 1JQ4A 2K9XA 4W9KA 1WE7A 2WDRB 2AEHA 1L5PA 4EFOA 4NAWA 3DBLB 2Z0DB 4UDUC 4A3OA 3PS6A 2O6VD 2WXOA 3APFA 2LVOA 2FIFA 2K0PA 1FRDA 4ZRQA 3FKYA 3BYYB 2W3SA 1GB4A 2KQ4X 2KQ7A 4EZJA 2KJHB 5AZGA 1C9FA 1QOBA 1JRPA 1SE2A 2OHFA 2OEDA 1M4VA 3ZJVA 2FCSA 3RUIB 3O13A 2DYMA 1GAQB 1AARA 1UELA 3FILA 3TEXA 3ZLZA 2KMAA 3IHPC 4YWGG 3TSSA 2REXA 5IP4D 1IYFA 1XQQA 4KDLB 3SD5A 5E6NA 3AEDB 1ZDXA 4ZRPA 1SIJA 4BKSD 5J18A 2TSSA 1ZDVA 1FIQA 3R8BA 2XNAC 3N1ZC 2Z59B 1M94A 2L00B 3URYA 3JYUA 3BVGA 2YEPB 3B9JA 2N7EA 1I4XA 3Q2AC 1C76A 4H2AA 4LDTB 3RFZB 3RYTA 1E7VA 3ZJTA 4K7WA 3UGBB 1SB3C 1C4PA 4PT5A 1SIFA 2WXLA 3LXFA 4NQLB 4BFRA 3A4SC 3MC9A 3EFUA 3P63A 4NAWB 5C1ZA 1TKEA 2DLBA 3QQ8B 1K51A 1DOXA 3C0RB 3EC8A 4P6VF 2FCNA 1N62A 1RYJA 1E6EB 2KTRA 3KYDD 3DBRB 2LGIA 3VTUA 2FUHB 5CX3A 2DX5B 3TJPA 2PVOD 3DBLI 4JPSA 2KWUB 3MJ5A 3N32A 1MHXA 3Q3NC 4XWWA 4EE2A 1OQRA 4OZCA 4BZAA 3T3NA 2AYOB 2ZCCA 3LDZE 2DZKA 3QHTA 1GJZA 4YTNB 3N1YC 3OLMD 1PQSA 2M0AA 3AE9B 4XDDA 2K1FA 2Z8LA 3SDLC 1NENB 1F9JA 3QX1A 5BMIA 2IO3B 4A3PA 1WX8A 4JX1C 1E5WA 2ASQA 2Y5PA 3P2BA 3IAS1 3A33B 2C7HA 1Q5WB 2IGHA 1WGYA 1N5WA 5C3JB 2G45B 4NNJB 3ZRCA 2AWTA 3ALBA 3P4SB 4E71A 2D3AA 1IUEA 2RMMA 4BBNF 1YD8U 4WQMA 2I2YA 1V81A 2N9PC 3U4EG 2N7JA 3DPDA 1EO6A 1WF9A 1WJ6A 1GC6A 2C60A 3PLVA 4ANUA 4ITKA 3PSEB 2KTRB 3LYYA 1OQQA 2MA9B 2J0JA 1JMLA 5G5HA 3TL5A 3A4RA 4WJNA 3HM6X 1YQBA 4IM0A 3UF8A 3MHSD 2KHWB 2INNE 2EMSA 1E8XA 4AUQC 2JZPA 3AU5A 3Q3FA 4IW0A 3A1QA 3WALA 2OJWA 2NTTA 1XLPA 2KJ6A 4FADA 3B08A 3KWLA 1NBFC 1L7YA 2NR2A 4L23A 2WXFA 3ETRA 5TR5A 3KWVA 1ZXIA 3H1UA 4A55A 1K53A 3AE6B 1QOGA 5TSSA 3W5VB 2J0MA 4HLEA 2NS5A 2MJ3A 3LJ3A 2K5PA 3ZDTA 3QA8A 3PT2B 1N63A 4IC7B 2N7DA 1DOIA 1V97A 3RNEC 4NY0A 1TKGA 2KJRA 4MH8A 3TEZA 2KVRA 3L17A 4WH4A 5LXHA 3TBLD 2BYVE 1LM8B 3OJ3A 3JSVA 3MC0B 2L0FA 1QOFA 2XBBC 1SXTA 5AZHA 5IKCM 1LGRA 1E10A 4E3CA 2JZ3B 2LASA 2AQ3B 2WXHA 2WX1A 2V4IB 1VJKA 4P16A 4BVUC 2CR5A 1VCBA 4PS3A 3PZDA 3A9KA 3KUCB 3A1QB 2BWES 4ZDVA 1WRIA 1MJDA 4EEWA 1BMLC 1FFUA 5CHWA 4DK5A 3J9CA 4RF0A 1FRRA 4B95A 2JX5A 4HPLB 5G55A 4B0MA 2M0XA 4AS1A 5H92C 1N60A 4MEMA 3VRAB 1WGKA 2WWZA 1N61A 1WI0A 2HDEA 4M0WA 2IO0B 2EELA 2GBMA 1V6EA 1ET9A 4NJCA 2WXMA 3N3KB 2N9KA 2BS4B 2L3ZA 1L6UA 1RWSA 5EE0A 3VQIA 3HVDA 1J19A 3P4PB 2MJDA 4RM8A 1UGJA 3AN1A 3NVYA 3JW0X 1ZKHA 2N9XA 4DDID 3AEGB 1P98A 3TEYA 3SFEB 4C56C 4WJQA 3U52E 4LNFA 3L13A 1J7BA 4ACFA 4OZAA 3RNCC 3KYCD 5JH5C 2RGFA 4LLGM 1I7HA 4XC2A 5DCNA 2ICIA 1WXSA 4M8NA 3NUHB 1Y8RC 5IA7A 3GZNB 1HXYD 3RMKC 2R2OA 4HKZE 3BVMA 1ROEA 4W9IA 1F2RC 2LXAA 2JUOA 4NJ7A 2O6VA 3Q8AA 4KGSA 3GP7A 2L76A 4P1BC 4KV2A 5FR6A 1UD7A 3UQBA 4BKTA 3ZJUA 1FCCC 4B0EA 2PVGC 2LHDA 2BF8B 1CZPA 5BMGA 1BT0A 4GGQA 1DOYA 1KLGD 1GB1A 1GG3A 4HJGE 4M0WB 1GPXA 3ZNZB 2W82A 3T9LA 2JU6X 1MG4A 1WZ0A 3L08A 2QJLA 3OG5A 1Q1OA 1YN5A 4W9DA 4HKQA 3R3MA 2AQ2B 2K25A 1FPYA 1LO5D 2C7MB 3HVZA 2DZMA 4BKSA 2IBIB 1TYGB 4WWNA 1JWUD 5GMVA 3U7DA 1UWMA 1WGDA 2JZZA 2RR9A 4FULA 3NZSA 5IAAC 2LFIA 3LB8C 3W9CB 3ZTCA 2V3NA 3WIMA 3NG0A 1HEZE 3ZQ4A 3RCZA 2W55A 3QC8B 1I4GA 2GBKA 5HI1A 2E6XA 2WDQB 4C4VB 1QT9A 1ZUD2 4NZLB 3NRZA 1MHHE 4M01A 4WWPA 2O6VB 3Q3OC 2K6DB 2WS3B 4KZ0A 4LJPB 2KKCA 2RPQA 2MWSB 4WJOA 1IGCA 2AL3A 2AL6A 3N1XC 3UQAA 2J53A 2DYOA 3IFWB 3VR8B 1TKYA 1AWDA 2WDVB 3CSTA 1QOAA 2INCC 2PMVA 1WM2A 1U4AA 4WJPA 1GNUA 3GE8C 2W3RA 2UYZB 3DDCB 4US9A 1SBBB 3NJTA 3VUXA 4J6IA 2QSDA 4ARCA 1BXTA 2FE8A 5LLIA 1YJJA 4LNOA 3VTWA 3EGRA 4HROA 4C7YA 1HTQA 2HJ8A 3WAMA 3Q8FA 2PLPA 4ZYSA 4RGTA 1F0ZA 3BK2A 5DPRA 3ZVVA 1JRUA 4RGMA 3AMZA 4RCOA 2LVPA 2XEWA 2BKRB 2J7QB 3SR6A 2MJEA 3M95A 4G11A 1J0GA 2N1VA 2PE9A 3Q8EA 1TZOA 2CU3A 3QCAA 3PHXB 1PYWD 5MPOA 2L8JA 2C5LC 1JWBD 5D3DA 1WR1A 1FNVA 4GDKB 4OVZA 2DZIA 2LXCA 3UIOB 1JROA 4EZKA 1OEYJ 1C79A 3EFCA 2IGGA 2WXKA 3AEEB 4ZHOA 4WWMA 4AQ7A 3ZIMA 3BK1A 2DAFA 2CHXA 3APCA 5E6JA 2H88B 4ICVA 3OJ4B 3VFKA 3W2DA 3WAPA 1P7EA 4AJWA 5CHVC 4RNAA 3CMMB 2I1JA 4K81A 4MACA 1V1PA 3W1SA 4N59A 2VZKD 2CU1A 3A9JA 4AOFA 3PV1A 1VD2A 2IY0B 2WX0A 2C9WB 2KAJA 1SJED 2JYEA 3C19A 5KHQA 4EZLA 2GBNA 2IYDB 1WGGA 4AP4C 3ZUNA 3T3OA 2JPHA 2KWVB 5BO4B 2ZNVB 3DBHI 3B0AA 1KLUD 1E90A 4BOZB 3V61A 3V60A 4GMVA 3NZUA 2FCMA 1V49A 2Q5WD 4RH6A 2KFKA 4YXDB 2BS3B 3VRBB 1T5XD 4TSSA 4FXCA 1MPEA 3W1YA 1MFWA 2K8HA 1UZXB 2HTME 4G3XB 3VVWB 3ABVB 1XLNA 2IZVB 4JGHB 2GB1A 3AB5A 2JSVX 2D07B 3SEBA 3RNGC 1SE4A 1P3QU 1ISNA 1L0XB 2HE7A 2WNMA 1V1PB 2K3UA 3H9DA 2WQYB 1FMAD 3H7SA 3A9JB 4NAMA 5EE9A 2KVZA 3K9PB 3FAHA 1PGBA 1XLOA 1FFVA 2MBBB 2RD0A 1TY2A 2ZPNA 1T6BX 1UUPA 1VZ8A 1B1ZA 4CHKA 1TS2A 2KDBA 3VHTC 1BUIC 4OVVA 5FKAC 3W1SC 3SFDB 1TIFA 4K3CA 4YL8A 2K39A 2O2VB 3L16A 3Q8CA 2W54A 3H7PA 3DQVA 1I4QA 5FR3A 1T0RC 3R2IA 5BMHA 4A8XC 2DENB 1PGXA 5GXGB 4LJOB 4B6WA 2FBWB 2N9EB 3GS2A 2KQSA 2BT6A 2KN5A 1E8YA 2L7RA 2NBUA 4IG7B 4B9KA 4IUMB 1ZPSA 2MLBA 4G0NB 1P9DU 2KFKB 4GOCA 3U8ZA 2MH7A 2D3GA 2INDC 1X1MA 4MELA 3V05A 2NVUI 3AE5B 2V4LA 3PZ8A 2GOWA 2ONQA 4KGTA 3NVWA 3B2GA 1LXDA 4RGNA 2MEKA 2RDBC 4W9GA 1V5OA 3KUZA 3RNAC 1SEBD 4LNNA 2KDIA 3AV8A 4LCDE 3BWUD 2QIEB 2GBJA 2BBCA 5L83A 3IVFA 3R7RA 1HE8A 4ZRKA 3VH4B 1NVID 4I6NB 2IJ0A 4KDIC 4MSMB 2ZJDA 1P0RA 4J3OD 5IO9A 3P4RB 2JXXA 2KDEB 1NEKB 1PDXA 2Y5CA 3AM9A 3NY5A 3H7PB 2FIDA 4TKNA 2KX3A 1YOVB 2KXJA 2NBVB 1KF6B 2WU2B 4N58A 1SF0A 2LRUA 4HCPB 3U30A 5G5GA 1WR6E 4LNIA 2L05A 4GSWA 1WYWB 3UINB 3WCQA 1OTRB 4NPNA 3V6CB 1I4PA 3Q3JA 1QKZA 4F8CB 4YSZB 3R66C 2ZEQA 3VH3B 4W9CA 3Q8BA 2VH2A 2WP9B 2DYBA 2KT7A 4KGRA 4FJVB 2JWZA 2DAJA 2ZVOA 4IWOA 4DQOC 2JY6A 2MBEA 3DCGA 2QHOA 3MFGA 5JXVA 1EF1A 2NBWB 1EF5A 4TV3A 3RT3B 4W9LA 1YN3A 5EE3A 3CSFA 4L2YA 2LVQA 2K22A 1WM3A 4KSKC 2J52A 1IGDA 5LXIB 3DVNV 4GXBA 1LQBA 3ZO5B 2SEBD 1TJEA 3L10B 3BINA 3OWEB 1QZEA 4LNKA 5AUIA 5C2TB 3SHQA 1I35A 1E8WA 3KUDB 4PS7A 2G4SA 3RULA 4AWJA 1HQRD 2BS2B 4WAAA 1S1QB 3NVVA 1L4DB 3ZKJC 1F52A 1YQ4B 2KOXA 5EDSA 2QC8A 4MM3A 4DHJB 2LZ6A 1WYGA 4WQOB 1C1YB 5JZEB 2I38A 2WU5B 2JWUA 4LTUA 2GBRA 2LGSA 4ZHPA 3RPFC 2BYEA 4LK0M 4RM9A 4K1RB 1V86A 4XZ4A 1D5XC 3MTNB 4W9JA 1UWXA 1GUAB 1SSNA 3H6NA 3O65B 1ZW7A 3PLUA 2PIAA 1D4BA 3TUOA 3WANA 3PTFC 1EUVB 2J4XA 4C4VA 2KWDA 4MGZE 5DPSA 1WMHA 4PK1A 1WXVA 4IM2A 4JQWC 3EHVA 3ZRFA 1E9MA 1D5ZC 2L32A 1PUTA 1UF0A 2VH1A 1I4HA 3DVNU 1ZP0B 3ZTDA 4II3B 2V9HA 1OEYA 2KLCA 3PHWB 2KZRA 1YN4A 2QILA 4HDQA 2BTEA 4MT5A 2RDGA 3U7ZA 2JYTA 2N1WA 3IG3A 4BBNC 3PPAA 4ZYNA 2FNJB 3IAM1 2L52A 4GIVA 3DVGX 1L0YB 1TS4A 3FC4A 4TUUA 4HCNB 2LHEA 3BZDB 4MM3B 1CJEA 2EMTA 4FJZA 4JE3B 3RNBC 3WAOA 2MBHA 2D2QA 5D2MB 5AZFA 3VUWA 4MDKE 3DBSA 1QQRA 1YJIA 3AECB 2WXGA 1K8RB 1RFKA 3DVGY 1YQ3B 2LJ5A 1ACCA 2PEAA 4DHJD 3APDA 2ACZB 4DXGA 2J0KA 2LUEA 4IWQA 5FK9C 1ESFA 3NOBA 3BIID 3NS1A 3QWZB 4EUTA 1PFDA 4S17A 1WMHB 1D6EC 2I1KA 4C80A 1WRDB 4BAXA 2K6QA 4MGIE 5HHDG 3VXWA 4W9FA 3NVZA 1FNWA 2BB5A 4MGYE 4G50A 2BYFA 1WGHA 1QF6A 4GDKA 1YX5B 1L4ZB 1R4MI 4HWIB 3VDZA 2KC2A 1F2RI 1ZGUB 3VUYA 4X57B 4GLSC 2BWFA 2KANA 1ENFA 4JWUC 4HDOA 1TT5B 2VZKB 2BGFA 3MP9A 2BPSA 2EKEC 2LGDA 2LRWA 1T0YA 2XN9C 4Q2JA 4FHJA 1A70A 3ZGZA 1XF5L 1FD6A 4FN2A 3ZYYX 2BYTA 1ET6A 3L4PA 2V0GA 4I6LB 2ON8A 1XO3A 2Z0EB 1TTNA 2BVCA 1JWMD 3AI5A 1E8ZA 1V5TA 4ANWA 1VDVA 2L1AA 5G2NA 3HM3A 4MGKE 2CJNA 2NTSA 2WXJA 4ICUA 2PKOA 2GLSA 1HZ5A 5E6PA 3PREA 1V8CA 4KSLC 3DBHB 3SU8X 1WSPA 4JIOU 2HD5B 1QILA 4KKJA 4QAYA 1DYQA 1ZE3D 2M8SA 3UIPB 1XLQA 3ONSA 3L0WB 3CF6E 2IO2B 3Q14C 2Y3AA 2LGYA 2MX2A 1CMXB 3CIRB 2BB6A 2JRHA 1JWSD 3AE7B 2IO1B 1WE6A 1AN8A 3VAWA 1UBQA 1TGZB 4HEA1 4HVBA 1R4NI 2N4FA 2KN4A 3QJZA 3WA0A 2KMCA 2QEJC 1I42A 1WJUA 1SGHA 3ZNGC 1RAXA 2C7NB 3QK0A 1VRAB 5CHFA 2M17A 3TMPB 1KH0A 3RD2A 1C4AA 4US8A 2ZW0A 5DPTA 4DHZB 4IOIE 2MQJA 3QARA 1NI3A 4C00A 4M00A 4A9AA 1B9RA 1XEEA 5D3IB 2LD9A 4URKA 1D5MC 3GB1A 2JF5A 5BYRA 4DBGA 4FBJB 4GDLA 5AEKB 3PRPB 2KD0A 3X0WA 1TS3A 3S2AA 3W5UB 1XD3B 3RZWC 2O2VA 2K8CA 1GOZA 1E0ZA 3R7QA 1K50A 4PYUA 1TS5A 3EUB2 1RLFA 1JW9D 2DBYA 3MJWA 4EOYA 2UWQA 1R7SA 1AW7A 2HJ1A 2WXIA 4GB9A 1UGMA 2KO3A 1CK1A 4NQKE 4YSYB 4JWSC 4RGOS 1IP9A 1TY0A 2ZNVC 4MH0E 4JL9A 2V3SA 3P42A 3PRZA 1IBXA 3AE1B 4DXAB 4NJ6A 1LFDA 3P1MA 2PPHA 5BYSA 1IPGA 2A5UA 2FAZA 2X8XX 1H4RA 4YT0B 3ZW3A 1WXMA 4E74A 2M19A 3ML9A 1FXIA 1KRHA 2KWCA 1EU3A 2VRRB 4XYCA 4N9F4 1KOTA 4YTPB 3AULA 3DHGC 4A90A 3KVFB 2KTFA 4DDGD 1MVKA 1JALA 4GDLB 1Q0WB 3DHHC 2PTLA 2B3AA 2CHZA 2PE6B 1KLVA 1RM6C 2XK5A 5HG2A 4CQNA 1E7PB 4M8MA 1UNSA 3FILB 3Q6BA 1WIAA 2LJIA 3NZ3A 2JT4B 2JRIB 4GN1A 1DGJA 3I3TB 3OAWA
chains in the Genus database with same CATH topology
4BKSA 1RFAA 2ZZPB 4W9LA 3M63B 4MSQB 2IBIB 1WJ4A 3CSFA 3NHEB 4WWNA 5GMVA 2LVQA 3T8MA 3DOWA 3U7DA 4KSKC 1WM3A 4OVUA 4W9KA 5LXIB 1WE7A 3DVNV 4GXBA 1WGDA 2JZZA 2RR9A 4FULA 1LQBA 2AEHA 3ZO5B 4CYEA 4EFOA 3L10B 4NAWA 2Z0DB 3BINA 4A3OA 4ANVA 3PS6A 3GOEA 1QZEA 3NZSA 2O6VD 5IAAC 3APFA 3ZTCA 2GMIC 2LVOA 1OQYA 1KJTA 2FIFA 3SHQA 4EKUA 2KC1A 3WIMA 1I35A 1E8WA 1WX7A 3KUDB 2KQ7A 3HK0A 1OGWA 4EZJA 3RCZA 3PRMB 4PS7A 2G4SA 2KJHB 3QC8B 5AZGA 2GBKA 4ANXA 3RULA 4K7UA 4AWJA 2FCSA 3QIJA 3RUIB 2DYMA 4WAAA 2O6VB 4WWPA 1S1QB 1AARA 1UELA 2K6DB 3ZKJC 4AJYB 3ZLZA 4KZ0A 2KMAA 4LJPB 2KKCA 2RPQA 3IHPC 1WXAA 2MWSB 2KOXA 2REXA 4WJOA 3OAWA 1IYFA 1XQQA 4KDLB 3SD5A 3PGEA 5EDSA 2LGXA 5E6NA 1WX9A 4MM3A 4PS8A 3M62B 2AL3A 2LZ6A 4WQOB 4DHJB 1C1YB 2AL6A 3ENEA 5JZEB 2MBOA 4LDTD 2GBRA 3UQAA 4F1SA 2DYOA 3IFWB 4BKSD 5J18A 2BYEA 2Y5BB 4RM9A 2BKFA 4K1RB 1V86A 4XZ4A 3CSTA 3JVZX 3MTNB 4W9JA 1WM2A 1U4AA 1GUAB 1M94A 1GNUA 2L00B 2Z59B 3JYUA 4WJPA 5E6OA 2UYZB 2N7EA 2XK5B 3H6NA 1D3ZA 3DDCB 3EECA 1J8CA 3O65B 1ZW7A 1GC7A 3PLUA 2MCNB 4LDTB 3ZNID 2KX0A 1WZ3A 3DBRI 3RYTA 1E7VA 3VUXA 1Z5SB 4J6IA 4KIKA 3WANA 3PTFC 1EUVB 4K7WA 4MGZE 3UGBB 5DPSA 5LLIA 1WMHA 1SIFA 4NQLB 1WXVA 2W9NA 3VTWA 4BFRA 1TBEA 4IM2A 4JQWC 3EHVA 3ZRFA 3A4SC 3V6EB 2KDFB 2M4NA 3EFUA 2HJ8A 4HK2A 4NAWB 3WAMA 5C1ZA 1YIWA 3ZNHB 3QQ8B 4FLHA 4A20A 3TCAA 3C0RB 3EC8A 2MSED 3DVNU 4MJSA 4FJYA 2HTHA 5CTRC 3ZTDA 2FCNA 4II3B 4FA6A 3AXCA 1OEYA 3QAQA 5JHBA 2KTRA 2DZJA 3KYDD 2KLCA 3PHWB 3VTUA 2KZRA 5D94A 5DPRA 4HDQA 2FUHB 3ZVVA 1JRUA 5CX3A 4FHKA 2N1WA 3IG3A 2LVPA 2DX5B 4BBNC 2XEWA 2BKRB 3PPAA 2FNJB 4ZYNA 3TJPA 3DBLI 2J7QB 2KWUB 3M95A 3N32A 4G11A 1J0GA 2N1VA 2PE9A 2V1YA 4GIVA 3DVGX 3IBEA 3QCAA 4K7SA 3PHXB 4TUUA 1NDDA 4HCNB 2YVCA 2L8JA 2AYOB 3D32A 2ZCCA 2C5LC 3LDZE 2DZKA 2NPTA 3QHTA 1GJZA 1WR1A 2CHWA 2EMTA 4FJZA 3OLMD 3KW5B 3WAOA 4GDKB 1PQSA 2MBHA 2D2QA 5D2MB 2DZIA 2K1FA 3SDLC 2LXCA 5AZFA 3VUWA 3UIOB 2G3QB 1F9JA 3QX1A 4EZKA 1OEYJ 1WY8A 4MDKE 5L95C 3DBSA 2IO3B 4A3PA 4WWOA 4DWFA 1WX8A 1E5WA 1K8RB 2ASQA 3DVGY 1WGRA 3P2BA 3A33B 2C7HA 1Q5WB 2LJ5A 1WGYA 2G45B 4NNJB 3ZIMA 2MRPA 2DAFA 3ZRCA 2CHXA 2AWTA 3ALBA 3APCA 2PEAA 4I6PA 4E71A 4DHJD 3APDA 4ICVA 4KIKB 3OJ4B 2J0KA 2LUEA 4IWQA 3VFKA 3WAPA 3NOBA 4BBNF 1YD8U 4AJWA 5CHVC 3BY4B 3QWZB 1V81A 2N9PC 4EUTA 3CMMB 3DPDA 2I1JA 4K81A 1WMHB 1UH6A 2I1KA 4PYZA 3N30A 3W1SA 1EO6A 1WF9A 1WRDB 2K6QA 1MG8A 2KLGA 4MGIE 2CU1A 1WJ6A 3VXWA 3A9JA 4W9FA 1GC6A 4AOFA 3PV1A 1VD2A 2IY0B 1UBIA 2C60A 1YX6B 2WX0A 2C9WB 1XT9B 4MGYE 4G50A 2BYFA 1H8CA 3PLVA 4ANUA 1WGHA 2CKHB 4MJSB 2K8BA 4GDKA 3PSEB 1YX5B 2KTRB 1L2NA 2MA9B 2J0JA 3KH0A 1R4MI 4HWIB 3VDZA 2KC2A 3TL5A 3A4RA 1ZGUB 3VUYA 2NCNA 3ZDMC 1S3SG 4X57B 5KHQA 2BWFA 2KANA 3VTVA 4EZLA 4HDOA 2GBNA 2BGFA 1V80A 2IYDB 1WGGA 4WJNA 3HM6X 1YQBA 2BPSA 2EKEC 4IM0A 2LGDA 3UF8A 4P7IA 3MHSD 2LRWA 1T0YA 2MP2A 3ZUNA 4AP4C 2KHWB 2JPHA 2KWVB 4FHJA 2EMSA 1E8XA 4AUQC 3AU5A 3Q3FA 4IW0A 3A1QA 5BO4B 3WALA 2ZNVB 4FN2A 3JSVB 2NPTB 3DBHI 3B0AA 1E90A 4W9EA 4BOZB 2R2QA 4FADA 2KJ6A 4I6LB 2MBQA 3V61A 3V60A 2Z0EB 4GMVA 3NZUA 1TTNA 3B08A 2FCMA 1NBFC 1L7YA 2NR2A 1V49A 2D10A 3L54A 5TR5A 1Z2MA 4GU2A 2KFJA 3AI5A 4II2B 2CS4A 1E8ZA 1V5TA 2KFKA 3H1UA 4DHZE 4ANWA 5G2NA 3HM3A 1A5RA 4MGKE 3W1YA 2K8HA 1UZXB 4ICUA 2J0MA 4G3XB 3VVWB 4HLEA 3X23A 2NS5A 3A9KB 2IZVB 3LJ3A 5E6PA 3PREA 4JGHB 3ZDTA 4KSLC 3SU8X 1G6JA 3ECIA 4JIOU 2D07B 3ML8A 3QA8A 3PT2B 4HPMB 4IC7B 2HD5B 2N7DA 1P3QU 4NY0A 1ISNA 3V62A 2HE7A 2KJRA 2M8SA 2RSUA 2ZVNA 2KVRA 3H9DA 3L17A 3UIPB 3ONSA 3L0WB 3CF6E 5LXHA 3TBLD 3H7SA 3A9JB 2BYVE 2IO2B 4CO7A 4ZRIA 1LM8B 2LGYA 3K9PB 2MW5A 1CMXB 2MX2A 3OJ3A 3JSVA 4F7ZA 2L0FA 2ZCBA 1KM7A 2JRHA 2DHZA 2MBBB 2RD0A 2XBBC 2IO1B 2ZPNA 5AZHA 1WE6A 3VAWA 1UBQA 4CHKA 4HJKA 1TGZB 4E3CA 2JZ3B 2KDBA 2LASA 2WYQA 5J17A 2WX1A 3VHTC 4OVVA 2LWPA 3W1SC 1TZ1A 4IWPA 4HVBA 1R4NI 2LI5A 2N4FA 4YL8A 2K39A 2O2VB 3L16A 3QJZA 4IM3A 3WA0A 4BVUC 2KMCA 3H7PA 5DPWA 1V9JA 2CR5A 1VCBA 2D11A 3DQVA 4HXDA 2MP2B 4PS3A 1I42A 1WJUA 1SGHA 3ZNGC 1RAXA 2C7NB 3QK0A 3PZDA 3A9KA 5CHFA 2DENB 2M17A 2BWES 3A1QB 3KUCB 3TMPB 4ZDVA 4LJOB 3RD2A 2JVCA 4B6WA 4BKGA 4EEWA 2N9EB 2M1MA 3B1LX 4W9HA 5DPTA 5CHWA 1SE9A 2KQSA 4DHZB 4DK5A 4KZCA 2KN5A 2MQJA 2L0TA 1E8YA 3QARA 2L7RA 2NBUA 4IG7B 4TQ1A 4B95A 2YLMA 4B9KA 2G4DB 2A4ZA 3HHMA 4IUMB 4HPLB 2FCQA 2MLBA 4G0NB 5G55A 2M0XA 1P9DU 2KFKB 2LD9A 4GOCA 4URKA 3M3JA 3U8ZA 2D3GA 2JF5A 4MEMA 2WWZA 1WI0A 1X1MA 2OOBB 4MELA 1V2YA 2NVUI 5C23A 4DBGA 2IO0B 4FBJB 2GBMA 1V6EA 4GDLA 2V4LA 5AEKB 2GOWA 3PRPB 2KD0A 2KNBA 3N3KB 1E7UA 3X0WA 2L3ZA 1LXDA 3S2AA 1RRBA 3PVLA 1XD3B 4W9GA 3RZWC 1V5OA 3KUZA 3NS8A 2O2VA 2K8CA 3VQIA 2IY1B 5JHAA 3R7QA 2KDIA 3GZNI 3HIZA 1J19A 4LCDE 4PYUA 4RM8A 2GBJA 3TIXA 4BOSC 3RZFA 3JW0X 5L83A 2PJHA 1ZKHA 2N9XA 1RLFA 3IVFA 3R7RA 1HE8A 4DDID 1P98A 4ZRKA 3MJWA 3VH4B 4EOYA 5J2RA 4WJQA 2UWQA 4I6NB 4JLCA 4KDIC 4KVGB 4TQ0A 3L13A 4MSMB 3KYCD 5JH5C 2ZJDA 2RGFA 1P0RA 4GB9A 1UGMA 1P1AA 4XC2A 1WH3A 2JXXA 2KO3A 5DCNA 2KDEB 4NQKE 1WXSA 4M8NA 1IP9A 1Y8RC 5IA7A 1C3TA 2ZNVC 4MH0E 4JL9A 3NY5A 2V3SA 3AU4A 3H7PB 3PRZA 2R2OA 1WFYA 2FIDA 4ASWC 4W9IA 4TKNA 4ZRJA 2KX3A 2LXAA 4DXAB 4NJ6A 1LFDA 2JUOA 2KK8A 2KXJA 2NBVB 2OJRA 2PPHA 4NJ7A 2O6VA 1IPGA 5D6JB 2L76A 2A5UA 2FAZA 2LRUA 4HCPB 3U30A 4KV2A 1H4RA 5FR6A 1UD7A 2ZPYA 4RMAA 1WR6E 3UQBA 2L05A 3ZW3A 1WXMA 4BKTA 4E74A 3ML9A 4GSWA 1WYWB 2WDTB 1WJNA 3UINB 1YJ1A 1OTRB 4NPNA 3V6CB 2KWCA 5HKHA 2VRRB 3Q3JA 1FXTB 2BF8B 4N9F4 4F8CB 1KOTA 1NI2A 3R66C 2ZEQA 3AULA 1BT0A 3VH3B 4W9CA 4GGQA 3KVFB 2KTFA 4DDGD 1GG3A 2DYBA 4M0WB 3ZNZB 4GDLB 5D7GA 1Q0WB 4FJVB 2JWZA 2DAJA 2ZVOA 3T9LA 4IWOA 5KHOA 2B3AA 1WZ0A 2CHZA 2PE6B 3L08A 1KLVA 2JY6A 2MBEA 3DCGA 2XK5A 3K9OB 2QHOA 4M8MA 4XX5A 1Q1OA 4W9DA 1EF1A 1WIAA 2NBWB 1EF5A 2JT4B 2JRIB 2K25A 3R3MA 4GN1A 4TV3A 3RT3B 3I3TB 2C7MB 2DZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BKS A;  1RFA A;  2ZZP B;  4W9L A;  3M63 B;  4MSQ B;  2IBI B;  1WJ4 A;  3CSF A;  3NHE B;  4WWN A;  5GMV A;  2LVQ A;  3T8M A;  3DOW A;  3U7D A;  4KSK C;  1WM3 A;  4OVU A;  4W9K A;  5LXI B;  1WE7 A;  3DVN V;  4GXB A;  1WGD A;  2JZZ A;  2RR9 A;  4FUL A;  1LQB A;  2AEH A;  3ZO5 B;  4CYE A;  4EFO A;  3L10 B;  4NAW A;  2Z0D B;  3BIN A;  4A3O A;  4ANV A;  3PS6 A;  3GOE A;  1QZE A;  3NZS A;  2O6V D;  5IAA C;  3APF A;  3ZTC A;  2GMI C;  2LVO A;  1OQY A;  1KJT A;  2FIF A;  3SHQ A;  4EKU A;  2KC1 A;  3WIM A;  1I35 A;  1E8W A;  1WX7 A;  3KUD B;  2KQ7 A;  3HK0 A;  1OGW A;  4EZJ A;  3RCZ A;  3PRM B;  4PS7 A;  2G4S A;  2KJH B;  3QC8 B;  5AZG A;  2GBK A;  4ANX A;  3RUL A;  4K7U A;  4AWJ A;  2FCS A;  3QIJ A;  3RUI B;  2DYM A;  4WAA A;  2O6V B;  4WWP A;  1S1Q B;  1AAR A;  1UEL A;  2K6D B;  3ZKJ C;  4AJY B;  3ZLZ A;  4KZ0 A;  2KMA A;  4LJP B;  2KKC A;  2RPQ A;  3IHP C;  1WXA A;  2MWS B;  2KOX A;  2REX A;  4WJO A;  3OAW A;  1IYF A;  1XQQ A;  4KDL B;  3SD5 A;  3PGE A;  5EDS A;  2LGX A;  5E6N A;  1WX9 A;  4MM3 A;  4PS8 A;  3M62 B;  2AL3 A;  2LZ6 A;  4WQO B;  4DHJ B;  1C1Y B;  2AL6 A;  3ENE A;  5JZE B;  2MBO A;  4LDT D;  2GBR A;  3UQA A;  4F1S A;  2DYO A;  3IFW B;  4BKS D;  5J18 A;  2BYE A;  2Y5B B;  4RM9 A;  2BKF A;  4K1R B;  1V86 A;  4XZ4 A;  3CST A;  3JVZ X;  3MTN B;  4W9J A;  1WM2 A;  1U4A A;  1GUA B;  1M94 A;  1GNU A;  2L00 B;  2Z59 B;  3JYU A;  4WJP A;  5E6O A;  2UYZ B;  2N7E A;  2XK5 B;  3H6N A;  1D3Z A;  3DDC B;  3EEC A;  1J8C A;  3O65 B;  1ZW7 A;  1GC7 A;  3PLU A;  2MCN B;  4LDT B;  3ZNI D;  2KX0 A;  1WZ3 A;  3DBR I;  3RYT A;  1E7V A;  3VUX A;  1Z5S B;  4J6I A;  4KIK A;  3WAN A;  3PTF C;  1EUV B;  4K7W A;  4MGZ E;  3UGB B;  5DPS A;  5LLI A;  1WMH A;  1SIF A;  4NQL B;  1WXV A;  2W9N A;  3VTW A;  4BFR A;  1TBE A;  4IM2 A;  4JQW C;  3EHV A;  3ZRF A;  3A4S C;  3V6E B;  2KDF B;  2M4N A;  3EFU A;  2HJ8 A;  4HK2 A;  4NAW B;  3WAM A;  5C1Z A;  1YIW A;  3ZNH B;  3QQ8 B;  4FLH A;  4A20 A;  3TCA A;  3C0R B;  3EC8 A;  2MSE D;  3DVN U;  4MJS A;  4FJY A;  2HTH A;  5CTR C;  3ZTD A;  2FCN A;  4II3 B;  4FA6 A;  3AXC A;  1OEY A;  3QAQ A;  5JHB A;  2KTR A;  2DZJ A;  3KYD D;  2KLC A;  3PHW B;  3VTU A;  2KZR A;  5D94 A;  5DPR A;  4HDQ A;  2FUH B;  3ZVV A;  1JRU A;  5CX3 A;  4FHK A;  2N1W A;  3IG3 A;  2LVP A;  2DX5 B;  4BBN C;  2XEW A;  2BKR B;  3PPA A;  2FNJ B;  4ZYN A;  3TJP A;  3DBL I;  2J7Q B;  2KWU B;  3M95 A;  3N32 A;  4G11 A;  1J0G A;  2N1V A;  2PE9 A;  2V1Y A;  4GIV A;  3DVG X;  3IBE A;  3QCA A;  4K7S A;  3PHX B;  4TUU A;  1NDD A;  4HCN B;  2YVC A;  2L8J A;  2AYO B;  3D32 A;  2ZCC A;  2C5L C;  3LDZ E;  2DZK A;  2NPT A;  3QHT A;  1GJZ A;  1WR1 A;  2CHW A;  2EMT A;  4FJZ A;  3OLM D;  3KW5 B;  3WAO A;  4GDK B;  1PQS A;  2MBH A;  2D2Q A;  5D2M B;  2DZI A;  2K1F A;  3SDL C;  2LXC A;  5AZF A;  3VUW A;  3UIO B;  2G3Q B;  1F9J A;  3QX1 A;  4EZK A;  1OEY J;  1WY8 A;  4MDK E;  5L95 C;  3DBS A;  2IO3 B;  4A3P A;  4WWO A;  4DWF A;  1WX8 A;  1E5W A;  1K8R B;  2ASQ A;  3DVG Y;  1WGR A;  3P2B A;  3A33 B;  2C7H A;  1Q5W B;  2LJ5 A;  1WGY A;  2G45 B;  4NNJ B;  3ZIM A;  2MRP A;  2DAF A;  3ZRC A;  2CHX A;  2AWT A;  3ALB A;  3APC A;  2PEA A;  4I6P A;  4E71 A;  4DHJ D;  3APD A;  4ICV A;  4KIK B;  3OJ4 B;  2J0K A;  2LUE A;  4IWQ A;  3VFK A;  3WAP A;  3NOB A;  4BBN F;  1YD8 U;  4AJW A;  5CHV C;  3BY4 B;  3QWZ B;  1V81 A;  2N9P C;  4EUT A;  3CMM B;  3DPD A;  2I1J A;  4K81 A;  1WMH B;  1UH6 A;  2I1K A;  4PYZ A;  3N30 A;  3W1S A;  1EO6 A;  1WF9 A;  1WRD B;  2K6Q A;  1MG8 A;  2KLG A;  4MGI E;  2CU1 A;  1WJ6 A;  3VXW A;  3A9J A;  4W9F A;  1GC6 A;  4AOF A;  3PV1 A;  1VD2 A;  2IY0 B;  1UBI A;  2C60 A;  1YX6 B;  2WX0 A;  2C9W B;  1XT9 B;  4MGY E;  4G50 A;  2BYF A;  1H8C A;  3PLV A;  4ANU A;  1WGH A;  2CKH B;  4MJS B;  2K8B A;  4GDK A;  3PSE B;  1YX5 B;  2KTR B;  1L2N A;  2MA9 B;  2J0J A;  3KH0 A;  1R4M I;  4HWI B;  3VDZ A;  2KC2 A;  3TL5 A;  3A4R A;  1ZGU B;  3VUY A;  2NCN A;  3ZDM C;  1S3S G;  4X57 B;  5KHQ A;  2BWF A;  2KAN A;  3VTV A;  4EZL A;  4HDO A;  2GBN A;  2BGF A;  1V80 A;  2IYD B;  1WGG A;  4WJN A;  3HM6 X;  1YQB A;  2BPS A;  2EKE C;  4IM0 A;  2LGD A;  3UF8 A;  4P7I A;  3MHS D;  2LRW A;  1T0Y A;  2MP2 A;  3ZUN A;  4AP4 C;  2KHW B;  2JPH A;  2KWV B;  4FHJ A;  2EMS A;  1E8X A;  4AUQ C;  3AU5 A;  3Q3F A;  4IW0 A;  3A1Q A;  5BO4 B;  3WAL A;  2ZNV B;  4FN2 A;  3JSV B;  2NPT B;  3DBH I;  3B0A A;  1E90 A;  4W9E A;  4BOZ B;  2R2Q A;  4FAD A;  2KJ6 A;  4I6L B;  2MBQ A;  3V61 A;  3V60 A;  2Z0E B;  4GMV A;  3NZU A;  1TTN A;  3B08 A;  2FCM A;  1NBF C;  1L7Y A;  2NR2 A;  1V49 A;  2D10 A;  3L54 A;  5TR5 A;  1Z2M A;  4GU2 A;  2KFJ A;  3AI5 A;  4II2 B;  2CS4 A;  1E8Z A;  1V5T A;  2KFK A;  3H1U A;  4DHZ E;  4ANW A;  5G2N A;  3HM3 A;  1A5R A;  4MGK E;  3W1Y A;  2K8H A;  1UZX B;  4ICU A;  2J0M A;  4G3X B;  3VVW B;  4HLE A;  3X23 A;  2NS5 A;  3A9K B;  2IZV B;  3LJ3 A;  5E6P A;  3PRE A;  4JGH B;  3ZDT A;  4KSL C;  3SU8 X;  1G6J A;  3ECI A;  4JIO U;  2D07 B;  3ML8 A;  3QA8 A;  3PT2 B;  4HPM B;  4IC7 B;  2HD5 B;  2N7D A;  1P3Q U;  4NY0 A;  1ISN A;  3V62 A;  2HE7 A;  2KJR A;  2M8S A;  2RSU A;  2ZVN A;  2KVR A;  3H9D A;  3L17 A;  3UIP B;  3ONS A;  3L0W B;  3CF6 E;  5LXH A;  3TBL D;  3H7S A;  3A9J B;  2BYV E;  2IO2 B;  4CO7 A;  4ZRI A;  1LM8 B;  2LGY A;  3K9P B;  2MW5 A;  1CMX B;  2MX2 A;  3OJ3 A;  3JSV A;  4F7Z A;  2L0F A;  2ZCB A;  1KM7 A;  2JRH A;  2DHZ A;  2MBB B;  2RD0 A;  2XBB C;  2IO1 B;  2ZPN A;  5AZH A;  1WE6 A;  3VAW A;  1UBQ A;  4CHK A;  4HJK A;  1TGZ B;  4E3C A;  2JZ3 B;  2KDB A;  2LAS A;  2WYQ A;  5J17 A;  2WX1 A;  3VHT C;  4OVV A;  2LWP A;  3W1S C;  1TZ1 A;  4IWP A;  4HVB A;  1R4N I;  2LI5 A;  2N4F A;  4YL8 A;  2K39 A;  2O2V B;  3L16 A;  3QJZ A;  4IM3 A;  3WA0 A;  4BVU C;  2KMC A;  3H7P A;  5DPW A;  1V9J A;  2CR5 A;  1VCB A;  2D11 A;  3DQV A;  4HXD A;  2MP2 B;  4PS3 A;  1I42 A;  1WJU A;  1SGH A;  3ZNG C;  1RAX A;  2C7N B;  3QK0 A;  3PZD A;  3A9K A;  5CHF A;  2DEN B;  2M17 A;  2BWE S;  3A1Q B;  3KUC B;  3TMP B;  4ZDV A;  4LJO B;  3RD2 A;  2JVC A;  4B6W A;  4BKG A;  4EEW A;  2N9E B;  2M1M A;  3B1L X;  4W9H A;  5DPT A;  5CHW A;  1SE9 A;  2KQS A;  4DHZ B;  4DK5 A;  4KZC A;  2KN5 A;  2MQJ A;  2L0T A;  1E8Y A;  3QAR A;  2L7R A;  2NBU A;  4IG7 B;  4TQ1 A;  4B95 A;  2YLM A;  4B9K A;  2G4D B;  2A4Z A;  3HHM A;  4IUM B;  4HPL B;  2FCQ A;  2MLB A;  4G0N B;  5G55 A;  2M0X A;  1P9D U;  2KFK B;  2LD9 A;  4GOC A;  4URK A;  3M3J A;  3U8Z A;  2D3G A;  2JF5 A;  4MEM A;  2WWZ A;  1WI0 A;  1X1M A;  2OOB B;  4MEL A;  1V2Y A;  2NVU I;  5C23 A;  4DBG A;  2IO0 B;  4FBJ B;  2GBM A;  1V6E A;  4GDL A;  2V4L A;  5AEK B;  2GOW A;  3PRP B;  2KD0 A;  2KNB A;  3N3K B;  1E7U A;  3X0W A;  2L3Z A;  1LXD A;  3S2A A;  1RRB A;  3PVL A;  1XD3 B;  4W9G A;  3RZW C;  1V5O A;  3KUZ A;  3NS8 A;  2O2V A;  2K8C A;  3VQI A;  2IY1 B;  5JHA A;  3R7Q A;  2KDI A;  3GZN I;  3HIZ A;  1J19 A;  4LCD E;  4PYU A;  4RM8 A;  2GBJ A;  3TIX A;  4BOS C;  3RZF A;  3JW0 X;  5L83 A;  2PJH A;  1ZKH A;  2N9X A;  1RLF A;  3IVF A;  3R7R A;  1HE8 A;  4DDI D;  1P98 A;  4ZRK A;  3MJW A;  3VH4 B;  4EOY A;  5J2R A;  4WJQ A;  2UWQ A;  4I6N B;  4JLC A;  4KDI C;  4KVG B;  4TQ0 A;  3L13 A;  4MSM B;  3KYC D;  5JH5 C;  2ZJD A;  2RGF A;  1P0R A;  4GB9 A;  1UGM A;  1P1A A;  4XC2 A;  1WH3 A;  2JXX A;  2KO3 A;  5DCN A;  2KDE B;  4NQK E;  1WXS A;  4M8N A;  1IP9 A;  1Y8R C;  5IA7 A;  1C3T A;  2ZNV C;  4MH0 E;  4JL9 A;  3NY5 A;  2V3S A;  3AU4 A;  3H7P B;  3PRZ A;  2R2O A;  1WFY A;  2FID A;  4ASW C;  4W9I A;  4TKN A;  4ZRJ A;  2KX3 A;  2LXA A;  4DXA B;  4NJ6 A;  1LFD A;  2JUO A;  2KK8 A;  2KXJ A;  2NBV B;  2OJR A;  2PPH A;  4NJ7 A;  2O6V A;  1IPG A;  5D6J B;  2L76 A;  2A5U A;  2FAZ A;  2LRU A;  4HCP B;  3U30 A;  4KV2 A;  1H4R A;  5FR6 A;  1UD7 A;  2ZPY A;  4RMA A;  1WR6 E;  3UQB A;  2L05 A;  3ZW3 A;  1WXM A;  4BKT A;  4E74 A;  3ML9 A;  4GSW A;  1WYW B;  2WDT B;  1WJN A;  3UIN B;  1YJ1 A;  1OTR B;  4NPN A;  3V6C B;  2KWC A;  5HKH A;  2VRR B;  3Q3J A;  1FXT B;  2BF8 B;  4N9F 4;  4F8C B;  1KOT A;  1NI2 A;  3R66 C;  2ZEQ A;  3AUL A;  1BT0 A;  3VH3 B;  4W9C A;  4GGQ A;  3KVF B;  2KTF A;  4DDG D;  1GG3 A;  2DYB A;  4M0W B;  3ZNZ B;  4GDL B;  5D7G A;  1Q0W B;  4FJV B;  2JWZ A;  2DAJ A;  2ZVO A;  3T9L A;  4IWO A;  5KHO A;  2B3A A;  1WZ0 A;  2CHZ A;  2PE6 B;  3L08 A;  1KLV A;  2JY6 A;  2MBE A;  3DCG A;  2XK5 A;  3K9O B;  2QHO A;  4M8M A;  4XX5 A;  1Q1O A;  4W9D A;  1EF1 A;  1WIA A;  2NBW B;  1EF5 A;  2JT4 B;  2JRI B;  2K25 A;  3R3M A;  4GN1 A;  4TV3 A;  3RT3 B;  3I3T B;  2C7M B;  2DZM A; 
#chains in the Genus database with same CATH topology
 1N6Z A;  3AE8 B;  1RFA A;  2ZZP B;  4MSQ B;  4O1N A;  1HTO A;  3HRD D;  4OVU A;  4CYE A;  5LNK 1;  1L0V B;  1STE A;  5IN7 A;  4M02 A;  4ANV A;  1EWY C;  4RFB A;  3GOE A;  4HPP A;  1XXG A;  1WWT A;  2GMI C;  1OQY A;  1KJT A;  3AEB B;  4XE0 A;  4EKU A;  2KC1 A;  2MHJ A;  1WX7 A;  3HK0 A;  3AEA B;  1OGW A;  3PRM B;  2QCZ A;  4ANX A;  2FUG 1;  4K7U A;  4ARI A;  1SE3 A;  1IBX B;  3QIJ A;  1Y56 A;  4S0R A;  1FCL A;  2BW2 A;  4N6E B;  4AJY B;  2KDM A;  3R2T A;  1WXA A;  3PGE A;  2LGX A;  1WX9 A;  4PS8 A;  3M62 B;  3AE2 B;  3ENE A;  2MBO A;  4LDT D;  2CJO A;  4F1S A;  2X38 A;  2Y5B B;  2BKF A;  3JVZ X;  2LUM A;  2D5G A;  2QMT A;  5E6O A;  2XK5 B;  1D3Z A;  3B2F A;  3EEC A;  1J8C A;  2V3P A;  1GC7 A;  3PZ7 A;  2MCN B;  3ZNI D;  2KX0 A;  1WZ3 A;  3DBR I;  4XWT A;  1Z5S B;  4KIK A;  4DXF A;  3MC8 A;  1FEH A;  3KQ4 A;  3HUI A;  1JCK B;  5T8I A;  2W9N A;  5I4D A;  1TBE A;  2D3B A;  2PW9 A;  3V6E B;  2KDF B;  2M4N A;  2UU7 A;  4HK2 A;  1YIW A;  3ZNH B;  1SJH D;  2LEK A;  4FLH A;  4A20 A;  2AX5 A;  3TCA A;  2MSE D;  4C7Z A;  3IXS A;  4MJS A;  4FJY A;  2HTH A;  5CTR C;  2WLB A;  4FA6 A;  3AXC A;  3UI3 A;  3QAQ A;  5JHB A;  2DZJ A;  5BYQ A;  3CWI A;  3AE4 B;  5D94 A;  1Q10 A;  4FHK A;  3IT6 B;  1PGA A;  1NYQ A;  2V1Y A;  3V3X A;  3IBE A;  4K7S A;  4KX6 B;  1NDD A;  2BQQ A;  1J7A A;  2YVC A;  3D32 A;  1YNT E;  2NPT A;  2KAC A;  2CHW A;  1JWA D;  4D2K A;  1T3Q A;  2N9L A;  3KW5 B;  2DWQ A;  4XDC A;  2G3Q B;  1WY8 A;  5L95 C;  4WWO A;  4DWF A;  2INP E;  1WGR A;  4ZOH C;  1EM7 A;  4K3B A;  3P4Q B;  1FXA A;  2MRP A;  5HFY A;  4I6P A;  4WAF A;  3I9V 1;  4KIK B;  1K52 A;  3BY4 B;  3RN9 C;  3TEW A;  1UH6 A;  2G9H D;  4PYZ A;  3N30 A;  4YSX B;  3I5J C;  2KLG A;  1MG8 A;  1OFF A;  3KLS X;  3E9S A;  2WHI A;  1UBI A;  1YX6 B;  1XT9 B;  1H8C A;  2CKH B;  4MJS B;  1YMH E;  2K8B A;  1WXQ A;  1L2N A;  2WXN A;  3KH0 A;  4OHJ A;  1ZXH A;  2NCN A;  3ZDM C;  1S3S G;  1P7F A;  3VTV A;  3U2S C;  3PO0 A;  1V80 A;  2EKI A;  4A6Q A;  1F77 A;  2D3C A;  4R3D A;  4P7I A;  2MP2 A;  2GRI A;  2RDH A;  1AYF A;  3JSV B;  2NPT B;  2NMQ A;  5AUK A;  4W9E A;  2R2Q A;  3BVZ A;  2MBQ A;  3IT4 B;  1KTK A;  1T0S C;  1R4M B;  4USA A;  2D10 A;  3L54 A;  1Z2M A;  1T0Q C;  4GU2 A;  2KFJ A;  4II2 B;  1J7C A;  2CS4 A;  4DHZ E;  1ZOY B;  2JQR B;  2ZW1 A;  3BYT B;  1A5R A;  3AH7 A;  2WXR A;  2AQ1 B;  1FNU A;  4OW0 A;  1VR9 A;  1L6V A;  3X23 A;  3A9K B;  1HZ6 A;  2IDY A;  3ECI A;  1G6J A;  3ML8 A;  4HPM B;  2L83 A;  3V62 A;  2RSU A;  2ZVN A;  4OZB A;  3DHI C;  4KKI A;  4P1C C;  4CO7 A;  4ZRI A;  2MW5 A;  4F7Z A;  2ZCB A;  1KM7 A;  2DHZ A;  4RF1 A;  3GE3 C;  1I4R A;  4HJK A;  2YEP F;  2WYQ A;  5J17 A;  2J42 A;  2LWP A;  1TZ1 A;  4IWP A;  4L1B A;  2LI5 A;  5IOI A;  4IM3 A;  4REZ A;  5DPW A;  1V9J A;  4HXD A;  2D11 A;  3VR9 B;  2MP2 B;  3DWM A;  3DWG C;  2SAK A;  2JVC A;  3Q3M C;  2GI9 A;  4BKG A;  2M1M A;  3B1L X;  4W9H A;  1SE9 A;  4KZC A;  1FM0 D;  2L0T A;  3EA6 A;  3Q69 A;  4TQ1 A;  2YLM A;  2G4D B;  2A4Z A;  3HHM A;  2FCQ A;  1R4N B;  2N0S B;  3M3J A;  4XGA B;  2OOB B;  1V2Y A;  5C23 A;  2KNB A;  1E7U A;  1XCT L;  2WXQ A;  1RRB A;  3PVL A;  2KMM A;  3NS8 A;  4HRS A;  2KYW A;  5JHA A;  2IY1 B;  3N9Y C;  3GZN I;  3HIZ A;  2WGS A;  2H89 B;  1HA5 A;  2LMC A;  3AEF B;  1EU4 A;  2R61 A;  5H8Y E;  3TIX A;  4BOS C;  1C78 A;  5EE1 A;  3RZF A;  2PJH A;  3H8H A;  1F1H A;  3N20 C;  2QDF A;  2JXT A;  5J2R A;  2WXP A;  1VZ6 A;  4JLC A;  2G1E A;  3ZXR A;  4KVG B;  4TQ0 A;  1MI0 A;  3I57 A;  1KFY B;  1VLB A;  1CQV A;  2IGD A;  1QLB B;  1P1A A;  1WH3 A;  4IKG A;  4WUR A;  3MHZ A;  2B76 B;  1C3T A;  1XCQ L;  3AU4 A;  2DNF A;  4WIP A;  1WFY A;  1N5X A;  1NYR A;  4ASW C;  4ZRJ A;  1C77 A;  2OJR A;  2KK8 A;  4IDI A;  2E3T A;  5D6J B;  3I63 C;  2ZPY A;  4RMA A;  2RPV A;  1VZ7 A;  3RI7 C;  2WDT B;  1C4C A;  1WJN A;  1YJ1 A;  3E56 A;  5HKH A;  1FXT B;  1NI2 A;  2IPK D;  3ZXV A;  3C8Y A;  5D7G A;  3AE3 B;  4TMA B;  1FO4 A;  5KHO A;  1V1O A;  2M56 B;  4YTM B;  3K9O B;  4XX5 A;  3RNF C;  1EWC A;  3M63 B;  1WJ4 A;  3NHE B;  3T8M A;  3DOW A;  1JQ4 A;  2K9X A;  4W9K A;  1WE7 A;  2WDR B;  2AEH A;  1L5P A;  4EFO A;  4NAW A;  3DBL B;  2Z0D B;  4UDU C;  4A3O A;  3PS6 A;  2O6V D;  2WXO A;  3APF A;  2LVO A;  2FIF A;  2K0P A;  1FRD A;  4ZRQ A;  3FKY A;  3BYY B;  2W3S A;  1GB4 A;  2KQ4 X;  2KQ7 A;  4EZJ A;  2KJH B;  5AZG A;  1C9F A;  1QOB A;  1JRP A;  1SE2 A;  2OHF A;  2OED A;  1M4V A;  3ZJV A;  2FCS A;  3RUI B;  3O13 A;  2DYM A;  1GAQ B;  1AAR A;  1UEL A;  3FIL A;  3TEX A;  3ZLZ A;  2KMA A;  3IHP C;  4YWG G;  3TSS A;  2REX A;  5IP4 D;  1IYF A;  1XQQ A;  4KDL B;  3SD5 A;  5E6N A;  3AED B;  1ZDX A;  4ZRP A;  1SIJ A;  4BKS D;  5J18 A;  2TSS A;  1ZDV A;  1FIQ A;  3R8B A;  2XNA C;  3N1Z C;  2Z59 B;  1M94 A;  2L00 B;  3URY A;  3JYU A;  3BVG A;  2YEP B;  3B9J A;  2N7E A;  1I4X A;  3Q2A C;  1C76 A;  4H2A A;  4LDT B;  3RFZ B;  3RYT A;  1E7V A;  3ZJT A;  4K7W A;  3UGB B;  1SB3 C;  1C4P A;  4PT5 A;  1SIF A;  2WXL A;  3LXF A;  4NQL B;  4BFR A;  3A4S C;  3MC9 A;  3EFU A;  3P63 A;  4NAW B;  5C1Z A;  1TKE A;  2DLB A;  3QQ8 B;  1K51 A;  1DOX A;  3C0R B;  3EC8 A;  4P6V F;  2FCN A;  1N62 A;  1RYJ A;  1E6E B;  2KTR A;  3KYD D;  3DBR B;  2LGI A;  3VTU A;  2FUH B;  5CX3 A;  2DX5 B;  3TJP A;  2PVO D;  3DBL I;  4JPS A;  2KWU B;  3MJ5 A;  3N32 A;  1MHX A;  3Q3N C;  4XWW A;  4EE2 A;  1OQR A;  4OZC A;  4BZA A;  3T3N A;  2AYO B;  2ZCC A;  3LDZ E;  2DZK A;  3QHT A;  1GJZ A;  4YTN B;  3N1Y C;  3OLM D;  1PQS A;  2M0A A;  3AE9 B;  4XDD A;  2K1F A;  2Z8L A;  3SDL C;  1NEN B;  1F9J A;  3QX1 A;  5BMI A;  2IO3 B;  4A3P A;  1WX8 A;  4JX1 C;  1E5W A;  2ASQ A;  2Y5P A;  3P2B A;  3IAS 1;  3A33 B;  2C7H A;  1Q5W B;  2IGH A;  1WGY A;  1N5W A;  5C3J B;  2G45 B;  4NNJ B;  3ZRC A;  2AWT A;  3ALB A;  3P4S B;  4E71 A;  2D3A A;  1IUE A;  2RMM A;  4BBN F;  1YD8 U;  4WQM A;  2I2Y A;  1V81 A;  2N9P C;  3U4E G;  2N7J A;  3DPD A;  1EO6 A;  1WF9 A;  1WJ6 A;  1GC6 A;  2C60 A;  3PLV A;  4ANU A;  4ITK A;  3PSE B;  2KTR B;  3LYY A;  1OQQ A;  2MA9 B;  2J0J A;  1JML A;  5G5H A;  3TL5 A;  3A4R A;  4WJN A;  3HM6 X;  1YQB A;  4IM0 A;  3UF8 A;  3MHS D;  2KHW B;  2INN E;  2EMS A;  1E8X A;  4AUQ C;  2JZP A;  3AU5 A;  3Q3F A;  4IW0 A;  3A1Q A;  3WAL A;  2OJW A;  2NTT A;  1XLP A;  2KJ6 A;  4FAD A;  3B08 A;  3KWL A;  1NBF C;  1L7Y A;  2NR2 A;  4L23 A;  2WXF A;  3ETR A;  5TR5 A;  3KWV A;  1ZXI A;  3H1U A;  4A55 A;  1K53 A;  3AE6 B;  1QOG A;  5TSS A;  3W5V B;  2J0M A;  4HLE A;  2NS5 A;  2MJ3 A;  3LJ3 A;  2K5P A;  3ZDT A;  3QA8 A;  3PT2 B;  1N63 A;  4IC7 B;  2N7D A;  1DOI A;  1V97 A;  3RNE C;  4NY0 A;  1TKG A;  2KJR A;  4MH8 A;  3TEZ A;  2KVR A;  3L17 A;  4WH4 A;  5LXH A;  3TBL D;  2BYV E;  1LM8 B;  3OJ3 A;  3JSV A;  3MC0 B;  2L0F A;  1QOF A;  2XBB C;  1SXT A;  5AZH A;  5IKC M;  1LGR A;  1E10 A;  4E3C A;  2JZ3 B;  2LAS A;  2AQ3 B;  2WXH A;  2WX1 A;  2V4I B;  1VJK A;  4P16 A;  4BVU C;  2CR5 A;  1VCB A;  4PS3 A;  3PZD A;  3A9K A;  3KUC B;  3A1Q B;  2BWE S;  4ZDV A;  1WRI A;  1MJD A;  4EEW A;  1BML C;  1FFU A;  5CHW A;  4DK5 A;  3J9C A;  4RF0 A;  1FRR A;  4B95 A;  2JX5 A;  4HPL B;  5G55 A;  4B0M A;  2M0X A;  4AS1 A;  5H92 C;  1N60 A;  4MEM A;  3VRA B;  1WGK A;  2WWZ A;  1N61 A;  1WI0 A;  2HDE A;  4M0W A;  2IO0 B;  2EEL A;  2GBM A;  1V6E A;  1ET9 A;  4NJC A;  2WXM A;  3N3K B;  2N9K A;  2BS4 B;  2L3Z A;  1L6U A;  1RWS A;  5EE0 A;  3VQI A;  3HVD A;  1J19 A;  3P4P B;  2MJD A;  4RM8 A;  1UGJ A;  3AN1 A;  3NVY A;  3JW0 X;  1ZKH A;  2N9X A;  4DDI D;  3AEG B;  1P98 A;  3TEY A;  3SFE B;  4C56 C;  4WJQ A;  3U52 E;  4LNF A;  3L13 A;  1J7B A;  4ACF A;  4OZA A;  3RNC C;  3KYC D;  5JH5 C;  2RGF A;  4LLG M;  1I7H A;  4XC2 A;  5DCN A;  2ICI A;  1WXS A;  4M8N A;  3NUH B;  1Y8R C;  5IA7 A;  3GZN B;  1HXY D;  3RMK C;  2R2O A;  4HKZ E;  3BVM A;  1ROE A;  4W9I A;  1F2R C;  2LXA A;  2JUO A;  4NJ7 A;  2O6V A;  3Q8A A;  4KGS A;  3GP7 A;  2L76 A;  4P1B C;  4KV2 A;  5FR6 A;  1UD7 A;  3UQB A;  4BKT A;  3ZJU A;  1FCC C;  4B0E A;  2PVG C;  2LHD A;  2BF8 B;  1CZP A;  5BMG A;  1BT0 A;  4GGQ A;  1DOY A;  1KLG D;  1GB1 A;  1GG3 A;  4HJG E;  4M0W B;  1GPX A;  3ZNZ B;  2W82 A;  3T9L A;  2JU6 X;  1MG4 A;  1WZ0 A;  3L08 A;  2QJL A;  3OG5 A;  1Q1O A;  1YN5 A;  4W9D A;  4HKQ A;  3R3M A;  2AQ2 B;  2K25 A;  1FPY A;  1LO5 D;  2C7M B;  3HVZ A;  2DZM A;  4BKS A;  2IBI B;  1TYG B;  4WWN A;  1JWU D;  5GMV A;  3U7D A;  1UWM A;  1WGD A;  2JZZ A;  2RR9 A;  4FUL A;  3NZS A;  5IAA C;  2LFI A;  3LB8 C;  3W9C B;  3ZTC A;  2V3N A;  3WIM A;  3NG0 A;  1HEZ E;  3ZQ4 A;  3RCZ A;  2W55 A;  3QC8 B;  1I4G A;  2GBK A;  5HI1 A;  2E6X A;  2WDQ B;  4C4V B;  1QT9 A;  1ZUD 2;  4NZL B;  3NRZ A;  1MHH E;  4M01 A;  4WWP A;  2O6V B;  3Q3O C;  2K6D B;  2WS3 B;  4KZ0 A;  4LJP B;  2KKC A;  2RPQ A;  2MWS B;  4WJO A;  1IGC A;  2AL3 A;  2AL6 A;  3N1X C;  3UQA A;  2J53 A;  2DYO A;  3IFW B;  3VR8 B;  1TKY A;  1AWD A;  2WDV B;  3CST A;  1QOA A;  2INC C;  2PMV A;  1WM2 A;  1U4A A;  4WJP A;  1GNU A;  3GE8 C;  2W3R A;  2UYZ B;  3DDC B;  4US9 A;  1SBB B;  3NJT A;  3VUX A;  4J6I A;  2QSD A;  4ARC A;  1BXT A;  2FE8 A;  5LLI A;  1YJJ A;  4LNO A;  3VTW A;  3EGR A;  4HRO A;  4C7Y A;  1HTQ A;  2HJ8 A;  3WAM A;  3Q8F A;  2PLP A;  4ZYS A;  4RGT A;  1F0Z A;  3BK2 A;  5DPR A;  3ZVV A;  1JRU A;  4RGM A;  3AMZ A;  4RCO A;  2LVP A;  2XEW A;  2BKR B;  2J7Q B;  3SR6 A;  2MJE A;  3M95 A;  4G11 A;  1J0G A;  2N1V A;  2PE9 A;  3Q8E A;  1TZO A;  2CU3 A;  3QCA A;  3PHX B;  1PYW D;  5MPO A;  2L8J A;  2C5L C;  1JWB D;  5D3D A;  1WR1 A;  1FNV A;  4GDK B;  4OVZ A;  2DZI A;  2LXC A;  3UIO B;  1JRO A;  4EZK A;  1OEY J;  1C79 A;  3EFC A;  2IGG A;  2WXK A;  3AEE B;  4ZHO A;  4WWM A;  4AQ7 A;  3ZIM A;  3BK1 A;  2DAF A;  2CHX A;  3APC A;  5E6J A;  2H88 B;  4ICV A;  3OJ4 B;  3VFK A;  3W2D A;  3WAP A;  1P7E A;  4AJW A;  5CHV C;  4RNA A;  3CMM B;  2I1J A;  4K81 A;  4MAC A;  1V1P A;  3W1S A;  4N59 A;  2VZK D;  2CU1 A;  3A9J A;  4AOF A;  3PV1 A;  1VD2 A;  2IY0 B;  2WX0 A;  2C9W B;  2KAJ A;  1SJE D;  2JYE A;  3C19 A;  5KHQ A;  4EZL A;  2GBN A;  2IYD B;  1WGG A;  4AP4 C;  3ZUN A;  3T3O A;  2JPH A;  2KWV B;  5BO4 B;  2ZNV B;  3DBH I;  3B0A A;  1KLU D;  1E90 A;  4BOZ B;  3V61 A;  3V60 A;  4GMV A;  3NZU A;  2FCM A;  1V49 A;  2Q5W D;  4RH6 A;  2KFK A;  4YXD B;  2BS3 B;  3VRB B;  1T5X D;  4TSS A;  4FXC A;  1MPE A;  3W1Y A;  1MFW A;  2K8H A;  1UZX B;  2HTM E;  4G3X B;  3VVW B;  3ABV B;  1XLN A;  2IZV B;  4JGH B;  2GB1 A;  3AB5 A;  2JSV X;  2D07 B;  3SEB A;  3RNG C;  1SE4 A;  1P3Q U;  1ISN A;  1L0X B;  2HE7 A;  2WNM A;  1V1P B;  2K3U A;  3H9D A;  2WQY B;  1FMA D;  3H7S A;  3A9J B;  4NAM A;  5EE9 A;  2KVZ A;  3K9P B;  3FAH A;  1PGB A;  1XLO A;  1FFV A;  2MBB B;  2RD0 A;  1TY2 A;  2ZPN A;  1T6B X;  1UUP A;  1VZ8 A;  1B1Z A;  4CHK A;  1TS2 A;  2KDB A;  3VHT C;  1BUI C;  4OVV A;  5FKA C;  3W1S C;  3SFD B;  1TIF A;  4K3C A;  4YL8 A;  2K39 A;  2O2V B;  3L16 A;  3Q8C A;  2W54 A;  3H7P A;  3DQV A;  1I4Q A;  5FR3 A;  1T0R C;  3R2I A;  5BMH A;  4A8X C;  2DEN B;  1PGX A;  5GXG B;  4LJO B;  4B6W A;  2FBW B;  2N9E B;  3GS2 A;  2KQS A;  2BT6 A;  2KN5 A;  1E8Y A;  2L7R A;  2NBU A;  4IG7 B;  4B9K A;  4IUM B;  1ZPS A;  2MLB A;  4G0N B;  1P9D U;  2KFK B;  4GOC A;  3U8Z A;  2MH7 A;  2D3G A;  2IND C;  1X1M A;  4MEL A;  3V05 A;  2NVU I;  3AE5 B;  2V4L A;  3PZ8 A;  2GOW A;  2ONQ A;  4KGT A;  3NVW A;  3B2G A;  1LXD A;  4RGN A;  2MEK A;  2RDB C;  4W9G A;  1V5O A;  3KUZ A;  3RNA C;  1SEB D;  4LNN A;  2KDI A;  3AV8 A;  4LCD E;  3BWU D;  2QIE B;  2GBJ A;  2BBC A;  5L83 A;  3IVF A;  3R7R A;  1HE8 A;  4ZRK A;  3VH4 B;  1NVI D;  4I6N B;  2IJ0 A;  4KDI C;  4MSM B;  2ZJD A;  1P0R A;  4J3O D;  5IO9 A;  3P4R B;  2JXX A;  2KDE B;  1NEK B;  1PDX A;  2Y5C A;  3AM9 A;  3NY5 A;  3H7P B;  2FID A;  4TKN A;  2KX3 A;  1YOV B;  2KXJ A;  2NBV B;  1KF6 B;  2WU2 B;  4N58 A;  1SF0 A;  2LRU A;  4HCP B;  3U30 A;  5G5G A;  1WR6 E;  4LNI A;  2L05 A;  4GSW A;  1WYW B;  3UIN B;  3WCQ A;  1OTR B;  4NPN A;  3V6C B;  1I4P A;  3Q3J A;  1QKZ A;  4F8C B;  4YSZ B;  3R66 C;  2ZEQ A;  3VH3 B;  4W9C A;  3Q8B A;  2VH2 A;  2WP9 B;  2DYB A;  2KT7 A;  4KGR A;  4FJV B;  2JWZ A;  2DAJ A;  2ZVO A;  4IWO A;  4DQO C;  2JY6 A;  2MBE A;  3DCG A;  2QHO A;  3MFG A;  5JXV A;  1EF1 A;  2NBW B;  1EF5 A;  4TV3 A;  3RT3 B;  4W9L A;  1YN3 A;  5EE3 A;  3CSF A;  4L2Y A;  2LVQ A;  2K22 A;  1WM3 A;  4KSK C;  2J52 A;  1IGD A;  5LXI B;  3DVN V;  4GXB A;  1LQB A;  3ZO5 B;  2SEB D;  1TJE A;  3L10 B;  3BIN A;  3OWE B;  1QZE A;  4LNK A;  5AUI A;  5C2T B;  3SHQ A;  1I35 A;  1E8W A;  3KUD B;  4PS7 A;  2G4S A;  3RUL A;  4AWJ A;  1HQR D;  2BS2 B;  4WAA A;  1S1Q B;  3NVV A;  1L4D B;  3ZKJ C;  1F52 A;  1YQ4 B;  2KOX A;  5EDS A;  2QC8 A;  4MM3 A;  4DHJ B;  2LZ6 A;  1WYG A;  4WQO B;  1C1Y B;  5JZE B;  2I38 A;  2WU5 B;  2JWU A;  4LTU A;  2GBR A;  2LGS A;  4ZHP A;  3RPF C;  2BYE A;  4LK0 M;  4RM9 A;  4K1R B;  1V86 A;  4XZ4 A;  1D5X C;  3MTN B;  4W9J A;  1UWX A;  1GUA B;  1SSN A;  3H6N A;  3O65 B;  1ZW7 A;  3PLU A;  2PIA A;  1D4B A;  3TUO A;  3WAN A;  3PTF C;  1EUV B;  2J4X A;  4C4V A;  2KWD A;  4MGZ E;  5DPS A;  1WMH A;  4PK1 A;  1WXV A;  4IM2 A;  4JQW C;  3EHV A;  3ZRF A;  1E9M A;  1D5Z C;  2L32 A;  1PUT A;  1UF0 A;  2VH1 A;  1I4H A;  3DVN U;  1ZP0 B;  3ZTD A;  4II3 B;  2V9H A;  1OEY A;  2KLC A;  3PHW B;  2KZR A;  1YN4 A;  2QIL A;  4HDQ A;  2BTE A;  4MT5 A;  2RDG A;  3U7Z A;  2JYT A;  2N1W A;  3IG3 A;  4BBN C;  3PPA A;  4ZYN A;  2FNJ B;  3IAM 1;  2L52 A;  4GIV A;  3DVG X;  1L0Y B;  1TS4 A;  3FC4 A;  4TUU A;  4HCN B;  2LHE A;  3BZD B;  4MM3 B;  1CJE A;  2EMT A;  4FJZ A;  4JE3 B;  3RNB C;  3WAO A;  2MBH A;  2D2Q A;  5D2M B;  5AZF A;  3VUW A;  4MDK E;  3DBS A;  1QQR A;  1YJI A;  3AEC B;  2WXG A;  1K8R B;  1RFK A;  3DVG Y;  1YQ3 B;  2LJ5 A;  1ACC A;  2PEA A;  4DHJ D;  3APD A;  2ACZ B;  4DXG A;  2J0K A;  2LUE A;  4IWQ A;  5FK9 C;  1ESF A;  3NOB A;  3BII D;  3NS1 A;  3QWZ B;  4EUT A;  1PFD A;  4S17 A;  1WMH B;  1D6E C;  2I1K A;  4C80 A;  1WRD B;  4BAX A;  2K6Q A;  4MGI E;  5HHD G;  3VXW A;  4W9F A;  3NVZ A;  1FNW A;  2BB5 A;  4MGY E;  4G50 A;  2BYF A;  1WGH A;  1QF6 A;  4GDK A;  1YX5 B;  1L4Z B;  1R4M I;  4HWI B;  3VDZ A;  2KC2 A;  1F2R I;  1ZGU B;  3VUY A;  4X57 B;  4GLS C;  2BWF A;  2KAN A;  1ENF A;  4JWU C;  4HDO A;  1TT5 B;  2VZK B;  2BGF A;  3MP9 A;  2BPS A;  2EKE C;  2LGD A;  2LRW A;  1T0Y A;  2XN9 C;  4Q2J A;  4FHJ A;  1A70 A;  3ZGZ A;  1XF5 L;  1FD6 A;  4FN2 A;  3ZYY X;  2BYT A;  1ET6 A;  3L4P A;  2V0G A;  4I6L B;  2ON8 A;  1XO3 A;  2Z0E B;  1TTN A;  2BVC A;  1JWM D;  3AI5 A;  1E8Z A;  1V5T A;  4ANW A;  1VDV A;  2L1A A;  5G2N A;  3HM3 A;  4MGK E;  2CJN A;  2NTS A;  2WXJ A;  4ICU A;  2PKO A;  2GLS A;  1HZ5 A;  5E6P A;  3PRE A;  1V8C A;  4KSL C;  3DBH B;  3SU8 X;  1WSP A;  4JIO U;  2HD5 B;  1QIL A;  4KKJ A;  4QAY A;  1DYQ A;  1ZE3 D;  2M8S A;  3UIP B;  1XLQ A;  3ONS A;  3L0W B;  3CF6 E;  2IO2 B;  3Q14 C;  2Y3A A;  2LGY A;  2MX2 A;  1CMX B;  3CIR B;  2BB6 A;  2JRH A;  1JWS D;  3AE7 B;  2IO1 B;  1WE6 A;  1AN8 A;  3VAW A;  1UBQ A;  1TGZ B;  4HEA 1;  4HVB A;  1R4N I;  2N4F A;  2KN4 A;  3QJZ A;  3WA0 A;  2KMC A;  2QEJ C;  1I42 A;  1WJU A;  1SGH A;  3ZNG C;  1RAX A;  2C7N B;  3QK0 A;  1VRA B;  5CHF A;  2M17 A;  3TMP B;  1KH0 A;  3RD2 A;  1C4A A;  4US8 A;  2ZW0 A;  5DPT A;  4DHZ B;  4IOI E;  2MQJ A;  3QAR A;  1NI3 A;  4C00 A;  4M00 A;  4A9A A;  1B9R A;  1XEE A;  5D3I B;  2LD9 A;  4URK A;  1D5M C;  3GB1 A;  2JF5 A;  5BYR A;  4DBG A;  4FBJ B;  4GDL A;  5AEK B;  3PRP B;  2KD0 A;  3X0W A;  1TS3 A;  3S2A A;  3W5U B;  1XD3 B;  3RZW C;  2O2V A;  2K8C A;  1GOZ A;  1E0Z A;  3R7Q A;  1K50 A;  4PYU A;  1TS5 A;  3EUB 2;  1RLF A;  1JW9 D;  2DBY A;  3MJW A;  4EOY A;  2UWQ A;  1R7S A;  1AW7 A;  2HJ1 A;  2WXI A;  4GB9 A;  1UGM A;  2KO3 A;  1CK1 A;  4NQK E;  4YSY B;  4JWS C;  4RGO S;  1IP9 A;  1TY0 A;  2ZNV C;  4MH0 E;  4JL9 A;  2V3S A;  3P42 A;  3PRZ A;  1IBX A;  3AE1 B;  4DXA B;  4NJ6 A;  1LFD A;  3P1M A;  2PPH A;  5BYS A;  1IPG A;  2A5U A;  2FAZ A;  2X8X X;  1H4R A;  4YT0 B;  3ZW3 A;  1WXM A;  4E74 A;  2M19 A;  3ML9 A;  1FXI A;  1KRH A;  2KWC A;  1EU3 A;  2VRR B;  4XYC A;  4N9F 4;  1KOT A;  4YTP B;  3AUL A;  3DHG C;  4A90 A;  3KVF B;  2KTF A;  4DDG D;  1MVK A;  1JAL A;  4GDL B;  1Q0W B;  3DHH C;  2PTL A;  2B3A A;  2CHZ A;  2PE6 B;  1KLV A;  1RM6 C;  2XK5 A;  5HG2 A;  4CQN A;  1E7P B;  4M8M A;  1UNS A;  3FIL B;  3Q6B A;  1WIA A;  2LJI A;  3NZ3 A;  2JT4 B;  2JRI B;  4GN1 A;  1DGJ A;  3I3T B;  3OAW A; 
#chains in the Genus database with same CATH homology
 4BKS A;  1RFA A;  2ZZP B;  4W9L A;  3M63 B;  4MSQ B;  2IBI B;  1WJ4 A;  3CSF A;  3NHE B;  4WWN A;  5GMV A;  2LVQ A;  3T8M A;  3DOW A;  3U7D A;  4KSK C;  1WM3 A;  4OVU A;  4W9K A;  5LXI B;  1WE7 A;  3DVN V;  4GXB A;  1WGD A;  2JZZ A;  2RR9 A;  4FUL A;  1LQB A;  2AEH A;  3ZO5 B;  4CYE A;  4EFO A;  3L10 B;  4NAW A;  2Z0D B;  3BIN A;  4A3O A;  4ANV A;  3PS6 A;  3GOE A;  1QZE A;  3NZS A;  2O6V D;  5IAA C;  3APF A;  3ZTC A;  2GMI C;  2LVO A;  1OQY A;  1KJT A;  2FIF A;  3SHQ A;  4EKU A;  2KC1 A;  3WIM A;  1I35 A;  1E8W A;  1WX7 A;  3KUD B;  2KQ7 A;  3HK0 A;  1OGW A;  4EZJ A;  3RCZ A;  3PRM B;  4PS7 A;  2G4S A;  2KJH B;  3QC8 B;  5AZG A;  2GBK A;  4ANX A;  3RUL A;  4K7U A;  4AWJ A;  2FCS A;  3QIJ A;  3RUI B;  2DYM A;  4WAA A;  2O6V B;  4WWP A;  1S1Q B;  1AAR A;  1UEL A;  2K6D B;  3ZKJ C;  4AJY B;  3ZLZ A;  4KZ0 A;  2KMA A;  4LJP B;  2KKC A;  2RPQ A;  3IHP C;  1WXA A;  2MWS B;  2KOX A;  2REX A;  4WJO A;  3OAW A;  1IYF A;  1XQQ A;  4KDL B;  3SD5 A;  3PGE A;  5EDS A;  2LGX A;  5E6N A;  1WX9 A;  4MM3 A;  4PS8 A;  3M62 B;  2AL3 A;  2LZ6 A;  4WQO B;  4DHJ B;  1C1Y B;  2AL6 A;  3ENE A;  5JZE B;  2MBO A;  4LDT D;  2GBR A;  3UQA A;  4F1S A;  2DYO A;  3IFW B;  4BKS D;  5J18 A;  2BYE A;  2Y5B B;  4RM9 A;  2BKF A;  4K1R B;  1V86 A;  4XZ4 A;  3CST A;  3JVZ X;  3MTN B;  4W9J A;  1WM2 A;  1U4A A;  1GUA B;  1M94 A;  1GNU A;  2L00 B;  2Z59 B;  3JYU A;  4WJP A;  5E6O A;  2UYZ B;  2N7E A;  2XK5 B;  3H6N A;  1D3Z A;  3DDC B;  3EEC A;  1J8C A;  3O65 B;  1ZW7 A;  1GC7 A;  3PLU A;  2MCN B;  4LDT B;  3ZNI D;  2KX0 A;  1WZ3 A;  3DBR I;  3RYT A;  1E7V A;  3VUX A;  1Z5S B;  4J6I A;  4KIK A;  3WAN A;  3PTF C;  1EUV B;  4K7W A;  4MGZ E;  3UGB B;  5DPS A;  5LLI A;  1WMH A;  1SIF A;  4NQL B;  1WXV A;  2W9N A;  3VTW A;  4BFR A;  1TBE A;  4IM2 A;  4JQW C;  3EHV A;  3ZRF A;  3A4S C;  3V6E B;  2KDF B;  2M4N A;  3EFU A;  2HJ8 A;  4HK2 A;  4NAW B;  3WAM A;  5C1Z A;  1YIW A;  3ZNH B;  3QQ8 B;  4FLH A;  4A20 A;  3TCA A;  3C0R B;  3EC8 A;  2MSE D;  3DVN U;  4MJS A;  4FJY A;  2HTH A;  5CTR C;  3ZTD A;  2FCN A;  4II3 B;  4FA6 A;  3AXC A;  1OEY A;  3QAQ A;  5JHB A;  2KTR A;  2DZJ A;  3KYD D;  2KLC A;  3PHW B;  3VTU A;  2KZR A;  5D94 A;  5DPR A;  4HDQ A;  2FUH B;  3ZVV A;  1JRU A;  5CX3 A;  4FHK A;  2N1W A;  3IG3 A;  2LVP A;  2DX5 B;  4BBN C;  2XEW A;  2BKR B;  3PPA A;  2FNJ B;  4ZYN A;  3TJP A;  3DBL I;  2J7Q B;  2KWU B;  3M95 A;  3N32 A;  4G11 A;  1J0G A;  2N1V A;  2PE9 A;  2V1Y A;  4GIV A;  3DVG X;  3IBE A;  3QCA A;  4K7S A;  3PHX B;  4TUU A;  1NDD A;  4HCN B;  2YVC A;  2L8J A;  2AYO B;  3D32 A;  2ZCC A;  2C5L C;  3LDZ E;  2DZK A;  2NPT A;  3QHT A;  1GJZ A;  1WR1 A;  2CHW A;  2EMT A;  4FJZ A;  3OLM D;  3KW5 B;  3WAO A;  4GDK B;  1PQS A;  2MBH A;  2D2Q A;  5D2M B;  2DZI A;  2K1F A;  3SDL C;  2LXC A;  5AZF A;  3VUW A;  3UIO B;  2G3Q B;  1F9J A;  3QX1 A;  4EZK A;  1OEY J;  1WY8 A;  4MDK E;  5L95 C;  3DBS A;  2IO3 B;  4A3P A;  4WWO A;  4DWF A;  1WX8 A;  1E5W A;  1K8R B;  2ASQ A;  3DVG Y;  1WGR A;  3P2B A;  3A33 B;  2C7H A;  1Q5W B;  2LJ5 A;  1WGY A;  2G45 B;  4NNJ B;  3ZIM A;  2MRP A;  2DAF A;  3ZRC A;  2CHX A;  2AWT A;  3ALB A;  3APC A;  2PEA A;  4I6P A;  4E71 A;  4DHJ D;  3APD A;  4ICV A;  4KIK B;  3OJ4 B;  2J0K A;  2LUE A;  4IWQ A;  3VFK A;  3WAP A;  3NOB A;  4BBN F;  1YD8 U;  4AJW A;  5CHV C;  3BY4 B;  3QWZ B;  1V81 A;  2N9P C;  4EUT A;  3CMM B;  3DPD A;  2I1J A;  4K81 A;  1WMH B;  1UH6 A;  2I1K A;  4PYZ A;  3N30 A;  3W1S A;  1EO6 A;  1WF9 A;  1WRD B;  2K6Q A;  1MG8 A;  2KLG A;  4MGI E;  2CU1 A;  1WJ6 A;  3VXW A;  3A9J A;  4W9F A;  1GC6 A;  4AOF A;  3PV1 A;  1VD2 A;  2IY0 B;  1UBI A;  2C60 A;  1YX6 B;  2WX0 A;  2C9W B;  1XT9 B;  4MGY E;  4G50 A;  2BYF A;  1H8C A;  3PLV A;  4ANU A;  1WGH A;  2CKH B;  4MJS B;  2K8B A;  4GDK A;  3PSE B;  1YX5 B;  2KTR B;  1L2N A;  2MA9 B;  2J0J A;  3KH0 A;  1R4M I;  4HWI B;  3VDZ A;  2KC2 A;  3TL5 A;  3A4R A;  1ZGU B;  3VUY A;  2NCN A;  3ZDM C;  1S3S G;  4X57 B;  5KHQ A;  2BWF A;  2KAN A;  3VTV A;  4EZL A;  4HDO A;  2GBN A;  2BGF A;  1V80 A;  2IYD B;  1WGG A;  4WJN A;  3HM6 X;  1YQB A;  2BPS A;  2EKE C;  4IM0 A;  2LGD A;  3UF8 A;  4P7I A;  3MHS D;  2LRW A;  1T0Y A;  2MP2 A;  3ZUN A;  4AP4 C;  2KHW B;  2JPH A;  2KWV B;  4FHJ A;  2EMS A;  1E8X A;  4AUQ C;  3AU5 A;  3Q3F A;  4IW0 A;  3A1Q A;  5BO4 B;  3WAL A;  2ZNV B;  4FN2 A;  3JSV B;  2NPT B;  3DBH I;  3B0A A;  1E90 A;  4W9E A;  4BOZ B;  2R2Q A;  4FAD A;  2KJ6 A;  4I6L B;  2MBQ A;  3V61 A;  3V60 A;  2Z0E B;  4GMV A;  3NZU A;  1TTN A;  3B08 A;  2FCM A;  1NBF C;  1L7Y A;  2NR2 A;  1V49 A;  2D10 A;  3L54 A;  5TR5 A;  1Z2M A;  4GU2 A;  2KFJ A;  3AI5 A;  4II2 B;  2CS4 A;  1E8Z A;  1V5T A;  2KFK A;  3H1U A;  4DHZ E;  4ANW A;  5G2N A;  3HM3 A;  1A5R A;  4MGK E;  3W1Y A;  2K8H A;  1UZX B;  4ICU A;  2J0M A;  4G3X B;  3VVW B;  4HLE A;  3X23 A;  2NS5 A;  3A9K B;  2IZV B;  3LJ3 A;  5E6P A;  3PRE A;  4JGH B;  3ZDT A;  4KSL C;  3SU8 X;  1G6J A;  3ECI A;  4JIO U;  2D07 B;  3ML8 A;  3QA8 A;  3PT2 B;  4HPM B;  4IC7 B;  2HD5 B;  2N7D A;  1P3Q U;  4NY0 A;  1ISN A;  3V62 A;  2HE7 A;  2KJR A;  2M8S A;  2RSU A;  2ZVN A;  2KVR A;  3H9D A;  3L17 A;  3UIP B;  3ONS A;  3L0W B;  3CF6 E;  5LXH A;  3TBL D;  3H7S A;  3A9J B;  2BYV E;  2IO2 B;  4CO7 A;  4ZRI A;  1LM8 B;  2LGY A;  3K9P B;  2MW5 A;  1CMX B;  2MX2 A;  3OJ3 A;  3JSV A;  4F7Z A;  2L0F A;  2ZCB A;  1KM7 A;  2JRH A;  2DHZ A;  2MBB B;  2RD0 A;  2XBB C;  2IO1 B;  2ZPN A;  5AZH A;  1WE6 A;  3VAW A;  1UBQ A;  4CHK A;  4HJK A;  1TGZ B;  4E3C A;  2JZ3 B;  2KDB A;  2LAS A;  2WYQ A;  5J17 A;  2WX1 A;  3VHT C;  4OVV A;  2LWP A;  3W1S C;  1TZ1 A;  4IWP A;  4HVB A;  1R4N I;  2LI5 A;  2N4F A;  4YL8 A;  2K39 A;  2O2V B;  3L16 A;  3QJZ A;  4IM3 A;  3WA0 A;  4BVU C;  2KMC A;  3H7P A;  5DPW A;  1V9J A;  2CR5 A;  1VCB A;  2D11 A;  3DQV A;  4HXD A;  2MP2 B;  4PS3 A;  1I42 A;  1WJU A;  1SGH A;  3ZNG C;  1RAX A;  2C7N B;  3QK0 A;  3PZD A;  3A9K A;  5CHF A;  2DEN B;  2M17 A;  2BWE S;  3A1Q B;  3KUC B;  3TMP B;  4ZDV A;  4LJO B;  3RD2 A;  2JVC A;  4B6W A;  4BKG A;  4EEW A;  2N9E B;  2M1M A;  3B1L X;  4W9H A;  5DPT A;  5CHW A;  1SE9 A;  2KQS A;  4DHZ B;  4DK5 A;  4KZC A;  2KN5 A;  2MQJ A;  2L0T A;  1E8Y A;  3QAR A;  2L7R A;  2NBU A;  4IG7 B;  4TQ1 A;  4B95 A;  2YLM A;  4B9K A;  2G4D B;  2A4Z A;  3HHM A;  4IUM B;  4HPL B;  2FCQ A;  2MLB A;  4G0N B;  5G55 A;  2M0X A;  1P9D U;  2KFK B;  2LD9 A;  4GOC A;  4URK A;  3M3J A;  3U8Z A;  2D3G A;  2JF5 A;  4MEM A;  2WWZ A;  1WI0 A;  1X1M A;  2OOB B;  4MEL A;  1V2Y A;  2NVU I;  5C23 A;  4DBG A;  2IO0 B;  4FBJ B;  2GBM A;  1V6E A;  4GDL A;  2V4L A;  5AEK B;  2GOW A;  3PRP B;  2KD0 A;  2KNB A;  3N3K B;  1E7U A;  3X0W A;  2L3Z A;  1LXD A;  3S2A A;  1RRB A;  3PVL A;  1XD3 B;  4W9G A;  3RZW C;  1V5O A;  3KUZ A;  3NS8 A;  2O2V A;  2K8C A;  3VQI A;  2IY1 B;  5JHA A;  3R7Q A;  2KDI A;  3GZN I;  3HIZ A;  1J19 A;  4LCD E;  4PYU A;  4RM8 A;  2GBJ A;  3TIX A;  4BOS C;  3RZF A;  3JW0 X;  5L83 A;  2PJH A;  1ZKH A;  2N9X A;  1RLF A;  3IVF A;  3R7R A;  1HE8 A;  4DDI D;  1P98 A;  4ZRK A;  3MJW A;  3VH4 B;  4EOY A;  5J2R A;  4WJQ A;  2UWQ A;  4I6N B;  4JLC A;  4KDI C;  4KVG B;  4TQ0 A;  3L13 A;  4MSM B;  3KYC D;  5JH5 C;  2ZJD A;  2RGF A;  1P0R A;  4GB9 A;  1UGM A;  1P1A A;  4XC2 A;  1WH3 A;  2JXX A;  2KO3 A;  5DCN A;  2KDE B;  4NQK E;  1WXS A;  4M8N A;  1IP9 A;  1Y8R C;  5IA7 A;  1C3T A;  2ZNV C;  4MH0 E;  4JL9 A;  3NY5 A;  2V3S A;  3AU4 A;  3H7P B;  3PRZ A;  2R2O A;  1WFY A;  2FID A;  4ASW C;  4W9I A;  4TKN A;  4ZRJ A;  2KX3 A;  2LXA A;  4DXA B;  4NJ6 A;  1LFD A;  2JUO A;  2KK8 A;  2KXJ A;  2NBV B;  2OJR A;  2PPH A;  4NJ7 A;  2O6V A;  1IPG A;  5D6J B;  2L76 A;  2A5U A;  2FAZ A;  2LRU A;  4HCP B;  3U30 A;  4KV2 A;  1H4R A;  5FR6 A;  1UD7 A;  2ZPY A;  4RMA A;  1WR6 E;  3UQB A;  2L05 A;  3ZW3 A;  1WXM A;  4BKT A;  4E74 A;  3ML9 A;  4GSW A;  1WYW B;  2WDT B;  1WJN A;  3UIN B;  1YJ1 A;  1OTR B;  4NPN A;  3V6C B;  2KWC A;  5HKH A;  2VRR B;  3Q3J A;  1FXT B;  2BF8 B;  4N9F 4;  4F8C B;  1KOT A;  1NI2 A;  3R66 C;  2ZEQ A;  3AUL A;  1BT0 A;  3VH3 B;  4W9C A;  4GGQ A;  3KVF B;  2KTF A;  4DDG D;  1GG3 A;  2DYB A;  4M0W B;  3ZNZ B;  4GDL B;  5D7G A;  1Q0W B;  4FJV B;  2JWZ A;  2DAJ A;  2ZVO A;  3T9L A;  4IWO A;  5KHO A;  2B3A A;  1WZ0 A;  2CHZ A;  2PE6 B;  3L08 A;  1KLV A;  2JY6 A;  2MBE A;  3DCG A;  2XK5 A;  3K9O B;  2QHO A;  4M8M A;  4XX5 A;  1Q1O A;  4W9D A;  1EF1 A;  1WIA A;  2NBW B;  1EF5 A;  2JT4 B;  2JRI B;  2K25 A;  3R3M A;  4GN1 A;  4TV3 A;  3RT3 B;  3I3T B;  2C7M B;  2DZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...