2MR6A

Solution nmr structure of de novo designed protein, northeast structural genomics consortium (nesg) target or462
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKKKKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR462
rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords De novo designed Protein OR462
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mr6A00
2LTAA 2LRHA 2MR6A 2N3ZA 2N75A 2LR0A 2L82A 2LVBA 2LCIA 2MR5A 2LV8A 4J29A 2KPOA 5GAJA 2L69A 2LNDA
chains in the Genus database with same CATH superfamily
4Q6BA 5JQGF 1JQJC 3VX3A 4MQEB 2ONJA 3RYFA 3QBJA 4FSXA 2G06A 2G09A 3W5SA 3PFBA 1UBCA 5TMDA 3KKNA 2BL4A 2VSFA 2IZ7A 3D02A 1KK1A 4BLRA 3PR3A 1N7IA 5FP0A 4WKBA 2JFUA 3LUAA 1DC8A 3F96A 3MWKA 1M72A 2ZJ2A 1C9DB 3PL1A 1K8QA 4AY5A 4YH1A 1ZRNA 4F56A 2V59A 1Z28A 4MWSA 2ID4A 4PRYA 1KEVA 4BBAA 4U6SA 4BU1A 1WA5A 2XUOA 1OBHA 3GAMA 4LEIA 2Q4DA 3WLQA 3L0ZA 4C88A 3KC2A 1DQNA 2JHGA 3JYOA 5EZYB 1YD7A 5D8DA 3V2GA 3B60A 3VR4H 3CRMA 1EX7A 1FFHA 2ZS8A 4P34A 1L7PA 4KQKA 1DQYA 1Z2EA 1DWQA 3L8MA 2F1KA 3LD9A 4OLAA 1WKBA 3OQPA 5DO9A 5JALA 2CUZA 2DCMA 2YMMA 1BX3A 2WM8A 3KT8A 4PAQA 2DWUA 3NW9A 2ZYSA 3FI0A 4K6KA 4X20A 2VHUA 4F6LA 1GL9B 5LNK6 3UJNA 2UZIR 2FPIA 3FZQA 3UB4A 2IXDA 5AJZA 3UK1A 1RYBA 4NESA 3RWMB 3N2EA 4YJ3F 3RT7A 3UMGA 2OC4A 1KH1A 1OI2A 2OGTA 2GXSA 2RKOA 3QIAA 5G40A 2PHZA 1BVUA 4NC9A 4A4DA 5FD8A 1TT5B 3FBGA 5FQOA 1WWKA 3ZWPA 3DHVA 4HSGA 3ELUA 1NLZA 5A1JA 1GPJA 4XX1A 3V4RA 1J8MF 3PICA 2FEPA 4GLJA 2HBZA 3O73A 4R83A 3SP1A 3LJKA 5KO2A 1BG6A 5IJ0B 4HXFB 4Q18A 3N2KB 3IT1A 3L4EA 2RGWA 2OCXA 2Y4NA 3L6CA 4LKRA 3FWYA 1HNNA 2Y1GA 4MUBA 4NHOA 4XQCA 3U7IA 4C78A 1SKUA 4CU2A 3L40A 4D3YA 4ETMA 3EDOA 4E46A 4ETIA 2PQ0A 1EGHA 4QOEA 4TS3A 3DZHA 3WK8A 3PXBA 5TJHA 1XTVA 2IYEA 3O84A 4GMXA 4LV8B 2PUFA 2A67A 2HLHA 4QXPA 1QDLB 1WHTA 3V00A 2B8TA 4D4MA 2ROQA 3DNFA 4J6EA 5ALVA 2PLRA 3F71A 4NPCA 1R6DA 1Z37A 3AUJB 4OO3A 2I2XB 4RLFA 1SCAA 1M6VB 3SXUB 5F98A 4RFVA 3EB9A 3R4CA 3FJ1A 4U00A 3QFRA 3TEMA 1V1JA 1V4BA 2L19A 1PCXA 1Z2NX 3H2HA 2W00A 2HY7A 3C39A 1KH2A 4L9WA 4JQSA 1WUHS 2JFFA 1QHNA 3R7WB 3WGQA 2E5WA 2VPZA 5GJVC 5SZJA 1GNPA 2R00C 4IIJA 1TVKB 1X87A 1IK6A 3OIYA 4OH7A 4Q3NA 2ARKA 3EZNA 4XXHA 3VPFA 3MGGA 2BUBA 4O4JA 4EBBA 4FOOA 3C8DA 2ORVA 1IOZA 1DWPA 4C08A 1EFKA 1NBEA 4B87A 3MGCA 4PHCA 2Z43A 3O0DA 4RDIA 3U7EB 4JLPA 1TF7A 1QG0A 1MOQA 1E5TA 5LQSA 3B1JA 4FHDA 3DWGA 4KVFA 3ELYA 2EXXA 3S6JA 2VDOB 1YC5A 2ZRHA 4N8EA 4ZO6A 4LJYA 1E9DA 3HXQA 5EY5B 2IYYA 2BGIA 2QA5A 1KA9H 2ZWPA 3QKIA 1NQAO 1SA0A 3WDKA 1CUZA 1RWQA 1V8PA 1WXEA 4FIZA 4N0QA 3P9YA 3UXYA 4DA0A 2WOOA 1Z2PX 4UM9B 3IULA 5JJCA 1KQ3A 1FU8A 5JYCA 3MT0A 8ADHA 3U7FB 3M83A 2XCIA 3OFND 2PUAA 3DAOA 2QJRA 2MTBA 1T25A 4OIFA 1P61B 2BFOA 3K0CC 5F7JA 1K88A 4FQ8A 1IY2A 2G76A 1IVNA 3NV7A 2H8KA 4Q4HA 3I6QA 4IEFB 2XUQA 1GPH1 2UXDB 4FSDA 3DCYA 1MC8A 1NBME 2QQGA 2R7LA 5FNVF 3RAGA 2X58A 9ABPA 3WZMA 5EMNA 5CLJA 2ZRPA 3HN2A 2FF7A 4TLBA 3WRXC 1M7BA 1C41A 3QVLA 1QNLA 3O3NB 5ILQA 1CTQA 1N3LA 3IPRA 3ZZ1A 2BOVA 1QGED 4HGYA 5AI8A 4MUNA 5FPHA 3U2QA 2X42A 1WB4A 4F1WA 4CKZA 3KETA 1GA6A 2YY5A 4Z0NA 1FSGA 1FTGA 1SURA 3NIFB 4D9MA 1V1RA 1U28A 2QLLA 3R3VA 5JYBA 3FUWA 4OK6A 1NN3A 2CNOA 4NJEA 4XSGA 3ZW7A 4Q19A 1E8MA 4EJ6A 5A9SA 4G36A 1DBIA 1G63A 2ZSEA 5KZMB 4CEHA 2Z0MA 2W6PA 4G84A 1KYXA 2QP4A 3BXXA 5A3QA 4M2LA 1FP6A 1UKVY 1RI2A 1LDNA 4HGPA 4PYLA 1BOFA 4JKYA 3QMPA 5I7FA 4FW8A 3WGUA 2DWPA 3EDMA 1CETA 1TGVA 1Z5GA 2CDRA 3NHAA 1Z7EA 4BQEA 4X7PA 3NH9A 1RYFA 4J1TC 3DPSA 3P9SA 3AF0A 4BKMA 3ZK9A 2F64A 1H6CA 3AIIA 3AP3A 3A3YA 2IF2A 2JF0A 3LLCA 2J3MA 1A71A 2VWQA 4ZI7B 4L15A 2LR0A 4ZAYA 2X6TA 2BGUA 3L02A 5K0JA 4KQXA 4QNMA 2PX5A 3P1JA 1CEQA 2WYUA 2C7BA 1OAKA 3KXIA 4AJPA 2RGEA 3OWOA 1M2GA 3HJNA 2D3WA 4JK3A 4UEQA 2IGTA 4ZGBA 1Y3IA 3LQFA 3AVOA 4FXOA 4AULA 1Q1BA 4GYYA 3I6IA 3VHLB 5ABPA 3VO8A 1W0JA 3H0EA 1L4UA 2IU4A 3NBZC 4NQRA 2WM3A 4N3GA 2ATEA 1NBMD 1QFJA 2OENG 3NKLA 4HL6A 4NE2A 4AK9A 3L6DA 2YCLA 1RYYA 4XJVA 1KVSA 4KYTA 1G0OA 3PLRA 3M3DA 3TM5A 1U99A 1W1WA 2I2CA 2IC5A 4F45A 4WKCA 2QD3A 3HVHA 3I0MA 3ICWA 3QUCA 3HJFA 3Q6MA 3BREA 1GGEA 1NF2A 3D6UA 1R66A 3S2SA 3VOTA 4RTJA 4QEKA 3H2ZA 1F2TA 3CVUA 2ZR8A 3GJRA 2ZZNA 2AFHA 2DULA 4NG5A 3H4MA 3WB9A 4QQKA 1FXWF 4RIFA 1MV5A 5L95A 3U4CA 3OCJA 3GARA 4WOPA 4I5GA 1AO0A 1MW9X 4K0KB 3CKMA 4ZALA 5CEJA 2R3SA 4BPRA 4W5OA 4E30A 2EVWX 3N7UA 4UZFA 5JSUA 1C3VA 1JR3A 2VEOA 3O3OB 1SVMA 1JDSA 1XC7A 4LXXA 1ECGA 1GUDA 1TTHA 5J4HA 5BR7A 4OX9Y 3BL5A 2JVKA 3JQEA 5JXWA 2J5QA 3ESAA 2P79A 2QT9A 4NYIR 2GCOB 2IXAA 4PIPA 5HBRA 2A59A 2HDWA 3UNXA 4A0RA 3T4PA 3KU1A 2EKPA 3DULA 4N6NA 5K8UA 1KDZA 4OQ4A 3W6PA 1JNYA 3ONVA 2O8CA 1NVVQ 2XMCA 1WABA 4BC0A 1V5WA 1FSZA 1EGMB 4NCIA 1E6EA 5F9HA 1I80A 5DMHA 3TOVA 1U7DA 2I4RA 2B4KA 2MMGA 1A3CA 3ABOB 3TL2A 4XVCA 4O4LA 1W2GA 2C82A 4TQUS 3A1EA 3OZEA 5A4MS 3IKMB 3UOWA 3W9SA 1JIJA 3H9JA 2WA2A 2VWGA 2D2XA 3QSGA 2VPQA 1GAJA 2XYQA 4MCIA 2ASEA 4MVJD 5FIUA 2QNBA 4LGCA 3AUFA 3AY6A 1TRHA 3GT7A 1QAQA 3FYUA 1Z8HA 2OGZA 3EZYA 3MINB 3Q40A 4G4SP 5EIFA 3ROXA 4OMCA 1BJTA 5CBPA 2AFHB 5HRCA 1JFVA 1YMUA 2I65A 1DAKA 1G4AE 2DP4E 2EFHB 2X0JA 2IYXA 2ZBPA 1P31A 4H77A 1YR3A 5TPZA 2D62A 3BB3A 1NR7A 3EF3A 4ZVUA 5HUJA 1QMGA 4FWIB 4GT1A 2IH2A 1BHJA 3WC4A 2BKUA 4KQIA 4IQ8A 1PSWA 2FP4B 1T34A 5AVVA 3H4IA 3OQVA 5BPHA 4EY3A 5ICSA 2HH9A 2G40A 3OLVA 3NHMA 2X3UA 5JPCA 3FDZB 1CS4C 4H27A 1HE3A 1QGDA 2KJQA 4HN9A 4BVGA 3ZLBA 3V8VA 4X8LA 3PVSA 5CVVA 1OUMA 5EKXA 2CNLA 3M6VA 3HZOA 3U9TA 1JKJB 8GPBA 3K1JA 3PGMA 1FP2A 2FPGA 4LJ8A 1OTXA 4E2ZA 1T0HB 4ERXA 2P6NA 3DV0B 5JE8A 3UANA 3WV4A 1XU4A 1U98A 3P4YA 4AMYA 3N28A 4GNRA 4O4HB 2LUOA 2QGZA 3H87A 4B1FA 1JG1A 1SUSA 2HJ9A 4P3PA 2XECA 3LDGA 2H85A 3LUFA 4WD3A 3U17A 1ZK1A 3LCJA 5M5BA 1Z0DA 4D0RA 3U44A 3BRWD 4LJLA 1DBPA 3DLCA 5BR1A 5IC4A 4WW0A 1WO8A 1LPBB 5JH7A 3CE9A 2A0FA 1ODIA 4NF2A 5BNZA 5JJBA 1K8RA 5E1BA 3OF3A 2OHOA 4F84A 1YIOA 1F4VA 1YUBA 2M6SA 2ZB8A 1UDCA 1DIBA 1PR4A 3GB9A 1NIJA 421PA 4LI3X 3V1UA 3SX0A 2IDMA 1RYNA 1JJBA 1VFPA 3DEIA 2F6RA 4TWRA 4DCPA 2I6FA 5JNVA 4DJTA 1H66A 4AECA 1AUQA 5AW3A 1BRMA 4MLZA 5A5FA 3QIVA 3UICA 1KAEA 3O26A 4GDMA 4MUFA 2A30A 1OLUA 3FGOA 3K1YA 2ZIVB 3L0PA 4M3NA 1VBKA 1YASA 3GXBA 3S2YA 5GJWC 1IN7A 1I9GA 2JFBA 4CEIA 2BMAA 8OHMA 1G66A 5B6IA 4WKGA 5B1IA 1WSWA 2GQ0A 4O3MA 2HQBA 4NPAA 2F43A 4MRAA 4EQ6B 2K4MA 5TSDA 2BEKA 3IDSA 2HKIA 4OP2A 4ZTZB 3F6RA 5AI0A 3TKAA 3LHFA 2B21A 3BKXA 2GHQA 4X95A 2WIJA 3VZRA 4XZ3A 2RI1A 4UJ5A 2I2AA 2EEZA 4BMVA 3WGGA 4R9VA 5GAJA 3RJ5A 1K7XB 3L0SA 4MO2A 1U9ZA 3LC0A 2AJTA 4XIYA 4DDWA 3UY4A 2UDPA 3BCSA 4E2WA 1AUOA 4MKXA 2WPDD 1RR6A 1E5XA 3GOHA 3WVNA 1VSQA 4US1R 2YNMD 2J85A 5H02A 1J5PA 5C5IA 5IT5A 3GA5A 4QEDA 3ZDCA 3BWYA 1P9RA 2DY0A 4PGFA 4F6RA 4IHQA 3V46A 1EWKA 1J7JA 1PZXA 2C54A 2QQFA 2WAYA 2PGDA 3BCHA 3PQ4A 4KZPA 5HS4A 4CTOA 2A6PA 1WV0A 1TUGA 4YMSA 1A5ZA 1QVAA 4NFYA 3GRZA 4YCJA 3B6IA 3F98A 4FNOA 3RU2A 4LMAA 1GFIA 2JIDA 3KAQA 3STVA 1FBNA 3WWYA 4N3AA 2JGDA 1O9HA 4LDNA 3MBIA 3S1SA 1NI5A 3W3AH 4OG2A 4DRZA 1SZPA 4OSPA 3FOFC 5LKRA 4D9FA 4KDFA 2B25A 3HE3A 5CLGA 4M1KA 5F3RA 4ZVRA 5CA0B 4DV3B 2D7CA 4KR9A 3K70D 2ON6A 2E6UX 4CDGA 3WNQA 4CJXA 1ESZA 2EDCA 4B09A 2NXJA 4EF4A 3LW8A 1N6OA 2GA9A 1PZMA 2IEYA 1WX1A 4OL9A 3KB6A 1FNDA 1HE2A 3PC8A 1K66A 4WN9B 3ZGLA 1G41A 1Q74A 4GYJA 3VZDA 1NX9A 3EZ7A 3GJ5A 2B37A 1WNTA 2FWPA 4O4IF 1KMQA 1PZHA 4MWTA 3SX4A 3QOFA 1SRQA 4RY8A 3KALA 4D98A 3RRZA 3I1IA 2JJ2D 4R2JA 4XQGA 3ZUGA 1Y4UA 1TXGA 1CDDA 3STTA 1FP7A 1U0FA 1NV8A 2FZWA 4UHBA 4BFLA 1JU4A 2AVNA 1EB9A 3ZW8A 4F97A 5B1EA 2JA1A 4JJFA 2VJLA 4X5OA 4W5TA 1KRWA 3OC0A 1YKGA 4M1OA 2VP3A 1JT2A 5LJLA 3L1KA 2H7YA 1FS6A 1SXPA 2YWDA 1KP9A 1JTVA 4Q1EA 4AJ2A 4DCMA 4IF6A 5HF8A 1TJNA 3PTLA 4QO7A 2HN9A 3B6EA 3OU6A 3GNTA 3CLRC 4RIGA 4HB4A 1MIOB 5D1NA 1QLHA 2C2HA 2BF7A 2AG0A 1T9GS 1D2NA 1KJWA 4BO5A 1N9GA 1UMBB 1FYWA 4G0MA 4RKQA 4F38A 2ATIA 2PZEA 2VSOA 4AN0A 2Q4RA 3TI7A 2XYRA 4QELA 3LWZA 4WECA 1WZNA 3DXZA 3JQAD 3OIGA 4FFLA 4Y18A 2P9GA 1W85B 1SCBA 1XK6A 2W2TA 3GG2A 2FPGB 3GPBA 1VZ2A 1DIHA 5HP4A 1RWMA 4CEIB 2PK3A 3WSVA 4GG1A 4YRSA 4RW0A 3IPLA 3UGTA 2CLIB 1I5EA 2YRWA 3CNQS 4XUGB 3RCBA 1TK2A 3AUYA 3ENKA 2PDAA 4MXDA 3LZ6A 1E6WA 2PKRA 3KEQA 4KKXB 4OHRA 3C6BA 1KPIA 1CR4A 3U4MA 4FDMA 1UDXA 1SUIA 4J2OA 4TL7A 2QZZA 5K0SA 5ITWA 3MRSA 3VC1A 4EMTA 3BGWA 1DGQA 4J0IA 1NI4A 2IYRA 4MAAA 1YZTA 3CEPB 3RSFA 4G8BA 4XYMA 3H13A 5JAQA 2VQFB 3BMNA 5H8WA 2RB5A 4D9BA 3KQUA 3TYXA 1PRYA 3RANA 3ZI7A 4ZK2A 5AVZA 2EFCB 4O33A 4TS1A 3KZVA 3QWBA 1U1DA 3LO5A 4MLPA 4DCJA 3ACDA 2VRBA 5IKEA 1YRYE 2B4TO 2O3QA 3N53A 4HDQB 4FXPA 2ZR7A 1HG1A 2XKAA 3TW8A 3A0RB 3NYWA 1E3WB 4EG0A 1GPKA 1GUYA 2XA1A 4AJOA 1N8SA 3OEWA 5EMKA 3IO3A 4HN4B 1QF6A 2C57A 2JI4A 1G4UR 1E2PA 2JZNA 4KWIA 2QMHA 5CDSA 4MI3A 1F9EA 3VPCA 5KC8A 1K6MA 3AFOA 5FTWA 5ILGA 5FLEX 3OKAA 4KO1S 4G2NA 3FLMA 3VVMA 3FRHA 4QG3A 1D9XA 2MWMA 1XTSA 3KX2A 1CB0A 3A9WA 4TYQA 1SBTA 2J7KA 2A5LA 3EAGA 4XUDA 4Q4JB 3T3DA 3DLBA 4B71A 3V3KA 1PJ3A 2WG0A 2ZDQA 1SCUA 5DHAA 2G28A 3NOVA 4F3NA 4DS3A 2B20A 3ANTA 3H6HA 4UAJA 4UMEA 3SSOA 3OIWA 3PA8A 5E9JA 4PCLA 4U0JA 4LE0A 4BAGA 5F51A 2Q6VA 1TVEA 3KHTA 4QBTA 4ZC8A 1F8YA 1T6ZA 1QYCA 1Q16A 2XNCA 3R40A 4D02A 1AB5A 4DFDA 5KSWB 4A36A 3K15A 2IY9A 1BXRA 1LNSA 3DXYA 3H2SA 5HQ3B 4MEAA 3AHFA 4QARA 1OT5A 3SF8B 1AQNA 4D4HA 3JYNA 2I54A 2WG2A 3NFRA 4XPZA 1PG5A 1KPHA 3A6LA 1Q0HA 4C4SA 4W7SA 3DE2X 1BVYF 2M1XA 2VK2A 3ENVA 1ENYA 3AKYA 4LHSA 3A9SA 4KW7A 2X0DA 4AJEA 1O95A 3MC1A 1T6BY 2Z2KA 5JI2E 2IE0A 1UM9A 4XLLA 5CTAA 3T99A 4INZA 2C0CA 3QXGA 4MW6A 1ELOA 2OCIA 5LFAA 2HW8A 4RESA 1DDGA 4DMLA 1U8XX 3A6DA 3OEEA 2EFDB 2ZIGA 5E1DA 5H5JA 1OH5A 2R7MA 1KKUA 3EIOA 5CH3A 5JDIA 3DDWA 3VPHA 1X94A 1PTJC 2N1BA 1IY8A 4KZKA 4QT0A 1N2SA 4N7BA 4ZA2A 2GA8A 5HCUA 3TQHA 4D9JA 2ZRGA 1TQDA 1K4KA 2FW6A 4L0QA 2R4UA 3I4CA 2Q4EA 4ZJUA 3CV3A 4TV8F 2HIHA 3O9MA 3U4AA 1KP2A 3UMMA 4DUPA 1FRVA 1EQ2A 5IARA 4EG8A 1QGUB 2RGXA 1WMEA 3LDHA 4IOKA 4WNCA 1FZTA 1PJLA 4RA9A 3M81A 1FYVA 1IL0A 1NBMA 4BNFA 2AN1A 5HUQA 3ENNA 4QQFA 4D3FA 4BKPA 3MIIA 2ZTVA 2C04A 2YC4C 5L3SA 4B45A 4ZEVA 2P2DA 4V3CA 3N0TA 3ODGA 3DEHA 1Q7CA 4ABTA 3FIJA 3PXDA 4DLBA 3KSUA 4FMCB 4OJQA 1XCMA 4XUEA 2FZ5A 1QV9A 3T1HB 4RVGA 2OBXA 1MVNA 2A14A 1K7EB 1DE0A 2QNRA 4IDBA 1ZIYA 3WB0A 3G0GA 1U3GA 3ID6C 2Q1XA 1UM9B 5G4KB 2NWQA 3I05A 1TZJA 5IYZF 1ZXBA 3UA4A 1VLVA 2E4WA 1CIPA 1KXZA 5LU9A 3MQFA 4FJ0A 4GF5A 1WP9A 3W79A 1ZGAA 2YWGA 4EATA 4MI9A 5CD1A 2CKDA 3CLVA 3ASVA 3BJIC 5DCWA 4D80A 4E33A 4IJKA 3L6BA 1RXVA 4QBGB 3RDPA 1N8NA 2P3OA 2DFLA 1ZDMA 4PNPA 2WQ6A 3AU9A 3ZYZA 2WDPA 1ZP6A 3CT4A 3PDIA 3GRPA 5CFNA 3CG0A 1ADBA 5BSVA 1OGJA 1VHQA 3T7DA 3F7OA 5JVDA 4M37A 4HWGA 1LBEA 1YI8A 5LD2C 1WW2A 4ND8B 1S7CA 2WV7A 5DTRA 4A5SA 1EUZA 4R5MA 3UO8B 1D03A 2FEAA 4N0DA 1MIOA 2BAGA 3Q11A 4B8YA 3HY4A 2QVXX 4BLTA 1QG4A 1MT0A 5LYYA 2O6LA 3PLAE 1RRPA 3A1NA 4EP1A 4MEBA 1H42A 4IZ6A 1J2JA 5K3AA 4DR5B 4NU8X 2QG6A 1LGYA 1ZW1A 5EEGA 3VZBA 2CMKA 3AUTA 3HU2A 2IUTA 1BN6A 2VNSA 2Y0BA 1A9ZA 1JU9A 2YY7A 1EVKA 1FS5A 4U2KA 3UKDA 1SMKA 3NQ41 2P5TB 1UFOA 3DONA 3PHLA 3Q9UA 4JLAA 1O6FA 4RK0A 3SMQA 2H57A 1MF7A 4CKBB 4KN5A 3DL2A 5EXSA 4M6WB 2VYCA 2CFTA 1CRWG 1NQXA 2V0GA 3V4VB 1VE5A 1M5UA 3FKJA 3T4UA 5ESRA 4GH5A 1KORA 1ODCA 1UPAA 1H9AA 4IVRA 3UHFA 3V8MA 4ZEXA 4EG5A 2W6IA 1QH1B 1VE3A 3BIXA 3NBQA 3OOWA 4FGWA 2YFYA 2W9XA 3WIEA 1I3CA 4WXPA 3ECAA 4X1IB 5IKOA 2WICA 4X61A 3WLKX 4DA9A 5JW6A 1E69A 1RHQA 4LJSA 4LE2A 3QKTA 1Q0UA 2WYVA 3NHLA 2ZG6A 3FETA 2ET6A 6GPBA 3EASA 1OAAA 1FCJA 2B7LA 4S1NA 3ILXA 2FSVC 4K5QA 2ANCA 4BO3A 1U0JA 3HXTA 3TOSA 1MT3A 1W4ZA 1EP1B 1M2OB 1ZWLA 1HRKA 2VK1A 3W8RA 3RIYA 2C94A 4HVAA 3RVLA 4ZI7F 2HMTA 1FMFA 2FMHA 3HBJA 1TJYA 1X1DA 4NH4A 4UUPA 5JC8A 2PQMA 1QFSA 2PNFA 3ANNA 1KSFX 4E07A 3SC3A 5DHRA 2F9LA 3AM3A 4K8RB 3HVKA 2YVAA 4JL8A 3U09A 3DM9B 4KE6A 1TQ8A 3WAKA 4KPUB 1V7PC 3THSA 4URFA 3JYHA 1W581 4IGAA 5K1ZA 5HFJA 5REQA 1JE0A 3EXEB 1ZEJA 1U9IC 1ZD9A 2WKSA 4BNVA 5I7OA 2XA9A 4R7GA 2O0HA 5FPKA 3OFVA 2IBSA 3V8RA 2VYVA 3KR0A 3O91A 4MJXA 2QR2A 2WF6A 3RW9A 1L5HB 2GZAA 4MRMB 2QBYA 1ISFA 5CVDA 3VBEA 1CB7A 4B8WA 4CT4B 4BVAA 1XDUA 3II6X 4ARAA 4PW0A 5EL0A 4FPXA 2PUHA 3LE8A 1A9YA 1O6ZA 2VCEA 2EBFX 4NI5A 3VR2A 2Y27A 3IAXA 5THQA 1VECA 1GQOA 4ZT4A 3QKUA 4F96A 2QGNA 1OLSA 2P3QA 4RK1A 4I3GA 3EDRA 2R1ZA 4XX0B 2D06A 2QMYA 1XJ0A 1VIVA 4RYLA 4QYSA 1W36C 3OI7A 2BMVA 3PKJA 1SOMA 2JAQA 4CG0A 2H07A 3CKYA 4O0MA 4RCZA 3UMSA 3HFJA 2V7WA 3M9WA 3DE6X 3U0BA 1X7WA 3MFYA 4LHXA 3R7AA 2Z04A 1HZJA 2NZYA 3L4SO 1T1GA 3KQOA 3DVLA 1EBFA 2D4AA 3NOXA 1XWIA 4CIXA 2FN8A 1GAWA 5JROA 3O93A 3UC9A 3LV8A 5C32A 1L1QA 4POAA 2VP6A 2ZUBA 3H0KA 3SG0A 4W8HA 1PT7A 3JQFC 4L5BA 4NFLA 1JAHA 2CVFA 4NR0A 3ZDFA 3AILA 2W6MA 2XUFA 3DTVA 3IDFA 1T35A 2RGRA 1C2YA 5SYAA 4RYDA 4E94A 3IIMA 4ECAA 1RWPA 3CH7A 1E8NA 4AP6A 5IT0A 2JIPA 2P8SA 3OLQA 2FH5B 4HUQA 3CF0A 4CTKA 1BMDA 1DB3A 2H48A 4A5OA 3N8HA 2GLUA 1DOAA 2CLDX 2ZP1A 3DVAA 2D5BA 1CR0A 1IXKA 4X84A 3TAUA 5L3QB 3I61A 3IFSA 4ED9A 1GDDA 4MICA 5EIHA 1MKYA 5CG2A 1GL7A 1DJLA 3TMKA 1E2DA 1EUCB 3V9PA 4A0HA 1DKOA 1KKMA 5FPSA 1T5HX 2K87A 3CG4A 2ZE7A 4TUYA 3B5IA 3K16A 4BQSA 1YVDA 4ZJYA 1JSZA 4Q05A 5LXTA 3H1GA 3TW0A 2XLBA 3AXTA 4EJ2A 5ITSA 1RP1A 5KNCA 1TMYA 1RKUA 1TA4A 1V71A 1NPYA 1RD4A 4LYDA 1Y33E 3IUYA 5TQ2A 2ZIAA 3RVJA 4P36A 5KX5F 3W5BA 3ZVNA 1Q21A 3QE9Y 2VA8A 3BN3A 3MA0A 4O4LB 4QBKA 3FOBA 3IXLA 4ZXFA 4E11A 3OJXA 2VTBA 3WL7A 2RE8A 3EXEA 1R0XA 3WZ2A 5EHGA 2IOFA 2UV8A 3QFFA 4QNRA 5TPWA 3ZJVA 5DI3A 1UPXA 3MJCA 4M0UA 4MYTA 4DG5A 4BO7A 5BNWA 3AEUA 3R0VA 5IAKA 1XEFA 4ER7A 4DREA 2Q6LA 2I22A 1RI4A 3KUKA 4TYPA 5L45A 2I6TA 4LS3A 2WJ3A 4LV6A 1SHLA 4WOKA 1X0VA 1NQUA 2CZQA 4J7CA 2H2AA 4AZ3B 1RIIA 1VPEA 2C03A 3L5KA 5IH3A 3PRHA 4C03A 1OAOA 3JSAA 1IVSA 4JVMA 3WLIA 4LRWA 2HSEA 4N9QA 6Q21A 5ALFA 3LA8A 3OX4A 2HSWA 2Q3EA 2HRDA 2GBIA 5HF6A 3E7XA 5KWEA 2WV9A 3FFXA 3DZIA 1LEHA 3HL4A 4UJ3A 5AOCA 1PW7A 2OO3A 4WUTA 2OCGA 3NTXA 1SQ5A 1HLGA 3PX2A 3QU4A 1IM8A 3U6BA 3ZVMA 3K6JA 3VO2A 2H2FA 1GNTA 4P2GA 1JI3A 1O3YA 2C83A 1LRKA 2RMKA 4RMIA 1K7SN 5FO1A 1H2FA 1J39A 1TYAE 1O9BA 3K0EA 5G4LA 4RF4A 4M6WA 1A4XA 2F8MA 3W9YA 1PDVA 4C05A 4QDOA 4L2IB 2LW7A 5HEKA 3UMVA 1AHPA 3IB6A 2QX9A 3FUCA 4INOA 4IVPA 2AZMA 3E22B 3PDCA 1OVMA 2O7NA 3RUCA 2GJKA 3WGZA 2EW2A 1XRLA 3AJDA 1UWCA 1UKEA 3FYUB 4NE7A 1MQSA 1ONNA 3COPA 3IDQA 3DOIA 5HCIA 1FFXA 2CVOA 5ERYA 2OBMA 4ZCPA 1Y9AA 2HJWA 3AOEC 3D8RA 2JLWA 4CEJB 2ZRCA 4MR7B 2FN9A 4LTMA 2ZE6A 5DM70 4FCVA 1P2BA 1ANKA 2W8BA 1XDZA 3DD1A 4FYKA 4OFBA 5C3UA 4DRYA 4WESB 1L4YA 5JEDA 2RGDA 3QVMA 5BN3B 3FOCA 5J2TA 3U60B 3LU1A 4IIEA 5TT0A 2C78A 4W5NA 1R9NA 2QXUA 1MAWA 2VAMA 7AT1A 1O8BA 3K8QA 5D7NA 4G1BA 5AVOA 3LYLA 3M5PA 2OZPA 4WADA 1XAJA 2DGDA 4OVKA 1S1CA 5E0KB 2E4XA 1DOZA 3GHHA 3MELA 4JJIA 2B8WA 2AOVA 3KKEA 3OWXA 2BY4A 1F3OA 3NM5A 4LNUB 3Q3EA 1QIEA 5CVTA 4YRCA 1FSSA 2I2DA 3I5AA 1SCJA 2C7GA 2UYHA 4MR8B 4UHEA 4N5IX 1W73A 1EDZA 1GGVA 3ZOZA 3TZLA 3OOSA 1JHVA 3U49A 2MT9A 2BDEA 3KPYA 3I2YX 3HO6A 4JJAA 5EJEA 5C5EA 3PQ5A 2QE7D 1DINA 5FBRB 2XMGA 2PS1A 2YMLA 5DRYA 3J7TA 3OY2A 1VSBA 2H11A 2CNNA 4BMOB 3IRUA 1EWQA 1NVXQ 1C14A 1U4OA 3O8BA 2FE4A 2CHFA 1PJRA 2OZKA 3E8XA 3ELBA 3I9KA 3MT9A 1TF5A 4IFBA 3HFSA 1XUOA 4OMFG 1U6JA 3ZTWA 4B6SA 4EHJA 1HXHA 5HQTA 2FSIA 4MV5A 2B0JA 1GZ3A 1O95C 3L8FA 4PPNA 3MBKA 2ATVA 4WNIA 5FV7A 1NZJA 1QVRA 3WYDA 4CR7A 4FOPA 3FD8A 3ADOA 1G9XA 2JCVA 3QU7A 3TL3A 1VLMA 3U4DA 2HT1A 4MV8A 4R6XA 3IURA 3MCUA 4LVNA 1GU1A 3DWFA 2ICAA 4URHA 2P9ZA 2D4HA 1T8TA 2JATA 5CD9A 1XLVA 4KAAA 2WJAA 4FYVA 3CWQA 2B5VA 1X1RA 2YWXA 5KJFA 4D82A 3ZJ4A 3IQDB 3KJEA 4WXYB 2FFHA 2JRCA 3V8QA 2JI8A 4MUYA 4QGGA 1DX9A 3SQMA 1ZWKA 4MA5A 4S1VA 3K1TA 1IUNA 3HBNA 3K94A 4NBSA 3HKDA 4R4JA 4BNKA 2W6ZA 4ZI7A 5F1OA 3Q0IA 4NBLA 5G0WA 1TU3A 2CVQA 3H75A 1D4ZA 1K3FA 2JGNA 3NC4A 5LZ7A 5B3JC 3X2SA 1PT8A 1TA9A 2Z6QA 2OXRA 3IHKA 2BZ1A 1QCDA 5BSHA 1CUIA 4FZ5A 4IHAA 2R1VB 1IONA 3MTBA 3Q12A 3OKPA 3INTA 3NBXX 4EI8A 1S02A 4NOJA 4I1PA 2GM3A 3AFHA 3LT2A 1A5TA 3N39C 4H7DA 4EHAA 2E37A 1KP3A 1ZVKA 2OCYC 1MZPA 5E9WA 1NQWA 4G9BA 4OL0A 4RV9A 3ZDBA 3IIEA 2XUIA 3SEZA 3BFVA 1EAMA 2VXYA 1SXJC 1TEZA 4TV9B 5HNKA 3GJ8A 5FYDA 2AG5A 2IU6A 1E8DA 5JSYA 2Q7OE 9MHTA 1QBKC 2ZWVA 2NUAB 2G0NA 3DVQX 4IX9A 1TF2A 3T15A 2E2WA 1HDYA 3AR6A 3EUEA 5ESDA 2YZ2A 3QKRA 1XJ5A 2WFZA 4M76B 4HH1A 1CS0A 5JSKA 2X14A 4X92A 2VYNA 1MGPA 1V9SA 1W0KD 3C14C 1NVUQ 3TRIA 4HHEA 1OWMA 4NFSA 5JC1A 1G9SA 1D2MA 3IT0A 5NLLA 2GAAA 4Q7MB 5KBYA 3Q6IA 5ENZA 2IWHA 1YI0A 4XYEA 4NYMQ 2F67A 4ZT7A 3FCSB 4MVYA 4Z8YA 4MV7A 5H81A 4X8HA 4DQXA 4P3XA 2CLHB 2FWAA 3F5QA 4IIJF 2B3TA 2GBCA 4GYWA 4DIOA 1N3IA 3PQ2A 1L4KA 3D0OA 4LZAA 3TIVA 2VZEA 2JJYA 2VQDA 3PA6A 3Q9SA 5DHFA 2SKCA 1ZG3A 3OEYA 3QI7A 3VKUA 4LW8A 5CDUA 2JCXA 1YHNA 1S2NA 4G0WA 2J3LA 5HKBA 4NNPA 3NHRA 1VPTA 3QRWA 2G8NA 4KXQA 3JU3A 1Y6JA 4DAEA 5C7IO 2W6ID 3P8ZA 3QJGA 4JJKA 4K26A 1FDVA 2X3FA 3TGPA 1QSGA 3IQXA 3X3HA 2J6IA 3G6WA 3KQTA 3I2FA 4JH0A 5E95A 4DLSA 1XZIA 2XOXA 2BEVA 1J21A 4MW0A 4PRLA 3QNMA 1ZN9A 1UT6A 3TKYA 3UJ8A 4MRRA 4YRBA 3EA0A 3H2IA 2JDID 1THZA 2ZIEA 3TECE 1H2YA 3PIRA 3SYMA 1H8ED 1ZCZA 2X8BA 3T5DA 3FWNA 1L5NA 3AVQA 3WMWA 4BMYA 3JQ9A 4GWKA 2H9YA 4UBKA 3IAEA 1L7VC 3PFNA 1SELA 4MWZA 1GPMA 1UK7A 3G1WA 4DCVA 4YMWA 3ZV7A 1QBGA 4RVHA 3AFNA 3FSEA 5DX0A 5DJ5A 3IJEB 2JI6A 5JFTA 5AT1A 4EA9A 2D1YA 4AF7A 3P4UA 3HA7A 2YWBA 3LLUA 4FS3A 2C9ZA 1T13A 5DGHA 1L8OA 1E1CA 2QLMA 3FKSA 3R7FA 3S99A 3DYVA 1MX9A 1QO7A 1RYEA 2JFXA 4M36A 3ZHYA 2YXPX 1X92A 1ZI8A 3BPSA 4I5IA 4EPWA 3R3HA 2DLCX 2GHIA 2QTVB 1N8TA 3DE7X 5FLKA 3QWAA 1CJSA 1KVQA 2DBVO 5LOVF 2DPHA 3GLGA 2WKQA 3S8MA 5D51S 3LOQA 5I7HA 5K8LA 2C98A 4MVJP 1DC3A 1NRXA 3FJOA 4KPUA 3S2FA 2COUA 4LBYA 1V4VA 3DKPA 2RGNC 3L6OO 1RMQA 4D42A 2Q6TA 4KO4S 3AF2A 3DOJA 3MCAA 4PX2A 5E4TA 1X42A 1R2QA 3GGOA 5LP6C 2IODA 3U3OA 3ZY2A 2HO5A 2WUEA 3GO4A 3HBMA 3O0TA 3BJEA 1NUTA 2R8XA 1RZ3A 3S70A 5J4YA 1XZJA 3EZ6A 4ISBA 5DWDA 4B0PA 1JFFB 4RH0A 3E2PA 1Z35A 2AIRA 2D3TA 1ZOPA 3O8LA 3LCCA 4P0TA 2GX6A 1QG2A 2NZXA 4D97A 5HPYB 3EPLA 4Z1MA 1MHTA 3IBGA 3G85A 3HDYA 2V8BA 4KDRA 4ZCMA 3MERA 3NOOA 5DOVA 4PICA 1YDFA 3DYIA 4H3VA 1PVDA 1EBUA 5ANRB 3H11A 4I81A 3E7DA 2QRNA 2ENWA 4X85A 1T10A 1TK3A 1HYEA 3WB2A 1QTNA 4R8SA 4TTQA 4X65B 3OQJA 3KOZA 4LRSB 5GPBA 2B1IA 5KKNB 1KO7A 1YA6A 3H83A 1IBRA 1KC1A 1TM2A 1QH1A 4X3OA 1ULTA 1WHSB 2J3DA 2KQUA 4P0QB 3DV9A 2FUKA 1G3IA 2HRBA 1LTKA 2NO1A 4M8NE 4EVSA 4A16A 3G2QA 1QB7A 2HA2A 4JJEA 1PJ4A 1MN6A 5DXJA 4B8ZA 2V5AA 4X66B 1Y1TA 2AHRA 3MGAA 3T7KA 4DG9A 2J3EA 1XP5A 1CK4A 1YDGA 1Y9DA 4TTAA 4Q02A 4B3BA 1YFJA 3A3OA 1TEHA 3WIDA 1M5TA 2QVGA 3GZJA 4WV3A 3MAJA 2FJUA 2D54A 1XZAA 2ZTSA 3UWDA 3D1JA 4EG7A 3PCRB 4KPYA 1MVLA 3GLVA 3JVVA 1MD9A 2CNKA 1H3FA 1GZVA 2QUJA 5EJGA 3MTIA 1XQWA 3IGFA 4PC6A 1DUIA 2O2YA 1OE0A 2EGUA 1GNVA 4HNRA 2IYZA 1F2VA 4COKA 3LC7O 3HKBB 1UKAA 2P27A 2DJIA 5KS2A 4OP3A 2WWHA 3W5IA 1AK1A 1OIWA 1Z5PA 5LC1A 2PGAA 3Q41A 3WAJA 3RKSA 3FPFA 3IEPA 3IUSA 2WJWA 3E82A 3MOGA 2F55A 4BP9A 3WX0A 4NCAA 2IZZA 1GCGA 2Z57A 2EP5A 3H8SA 4S1TA 1PFVA 4WCFA 3U16A 1HYGA 4DSTA 1MLDA 4P7BA 5FBKA 1I7QB 2RAVA 4TTTS 3NLLA 3TGWA 5KJCA 2ABWA 2C8KA 1NRWA 1VKHA 2AMFA 1OFVA 1Y9EA 2P41A 2PFGA 3N7TA 4FE4A 1Z2DA 1Q57A 4GD3Q 2WP0A 3K72B 1EFPB 1P9OA 2E89A 2WUDA 2RH5A 3F6EX 4B3HA 1AH2A 2O1EA 1Z0UA 2JLZA 3SBXA 1OWOA 4GXNA 4KQCA 2C5AA 1ZOOA 5CCBA 3WFJA 1KO1A 2Z4RA 5J2UA 3RVQA 3UHOA 5ILOA 2RC6A 3FTQA 1XQYA 2ZKIA 4YP7A 3V8PA 4Z9YA 5LN1A 3IVCA 1SM4A 4PRZA 2RHHA 4G0VA 4I6GA 1P1KA 3GXOA 1CUJA 1RWKA 2ORYA 2Q0XA 1E5DA 4YWHA 4D79A 2QL7A 3ZXXA 3G9UA 3VYWA 1JX6A 1XALA 4YK7A 1RWBA 1VG0B 1D1TA 1X80A 4B4UA 3RYIB 2G7MC 1COZA 2QTVA 1Q0ZA 4JBWA 2C4VA 1A7UA 1VI5A 1MB9A 4TRNA 1TMKA 4DR1B 4DDMA 4HQ6A 1BKDR 4TYNA 3G7NA 4AYTA 5LA6B 2O1WA 4Q0MA 1XKTA 3OTGA 3OURA 4UOEA 2JIZA 5I8WA 1J9ZA 4K0RA 3FWKA 3KYIB 4KKVA 4J94A 4ZHSA 2ZIFA 1RQLA 3FHOA 3H1FA 4C87A 1P5HA 4J0CA 1VGVA 4JROA 3LYUA 5KVQA 1TCVA 1ZM4A 3EIQA 5MN6A 2VUHB 1YZLA 3E0XA 3RSOA 3T3OA 4GNKA 4L27A 3V1TC 3A4LA 1GSAA 1T2VA 3T4XA 3AL0C 5IYZB 1Q1QA 1VMKA 1XF9A 1VRCA 2IHVA 2XCUA 4B4KA 1E9RA 1FE8A 4LZZA 1P60A 1SUBA 1P7CA 3MIZA 4RPHA 4CODB 2R4QA 4IIUA 1SIWA 4F60A 1AA6A 1RLUA 4D3SA 4C3ZA 3HRIA 5JCXA 4LY0A 1AK2A 1K89A 4DPLA 2BH9A 4YJ3A 1CQZA 4KMSA 1XELA 1JR3D 2BLLA 3ZBUA 3WRVA 2AMLA 3R7LA 3A32A 3JV7A 1W4AA 1IVYA 4AWXA 3P2OA 1HV8A 1VL8A 3PFHA 3T5GA 4F4IA 1F06A 3PC6A 2FQQA 4ER3A 3SIRA 1YFLA 3P0IA 3JZIA 2FZ4A 2QZSA 3ZDQA 1QYIA 5B2ZA 1ZJWA 4ZWNA 3SMVA 2GFHA 5DSZA 2I8AA 1XI2A 3MRVA 2RAPA 2XGGA 3WQBA 1HOXA 4XSVA 4I9NA 1WAMA 4M0EA 1HDZA 3S2ZA 3TDKA 4K2AA 3B1FA 4TKZA 4TXHA 3WDMA 2VEDA 4FEAA 4MJ7A 2PZMA 2ZZKA 1GFSA 2JAOA 3BIFA 3LT1A 2OAEA 4IRUB 3X1WA 2HU2A 5B2EA 5IC5A 3WJAA 2I0FA 5A3JA 3T1TA 4QX6A 2EFJA 3FCCA 1U3DA 4NZMA 3R9XA 4CR6A 3O9VA 4JZYA 2H5IA 5CYOA 3M5CA 2IU3A 4C4XA 3K09A 1W5TA 2ZQZA 3B1WA 1L4LA 4FLMA 1GA4A 1XZDA 4EHLA 5DW0A 2H4ZA 4KQ1A 3PL5A 3HGQA 2J3QA 3R8XA 3I6MA 1M73E 2H6EA 2DQKA 1T5BA 4OYYA 3KCQA 4PSCA 2GASA 3QVTA 4TXJA 1J22A 2OCPA 5FWXA 1T1IA 1RI5A 4RHCA 2DLNA 4MARA 3MM4A 1ZIDA 3TW8B 1V43A 2I1QA 1Z0FA 3EF0A 1APBA 4RS3A 3F8TA 5AR1A 3B85A 2BGLA 3LUBA 4MS4A 2LPMA 1R9GA 3CLTD 4D0NA 4F2PA 1IEQA 2NMVA 5A06A 3PYMA 3FRIA 2B34A 2F3RA 3F3SA 3GEMA 2VHJA 3IP6A 1CULC 4O2BA 4RPIA 4UAVA 3BFKA 1H0RA 1J0AA 3AYZB 3ZXYA 1PWZA 2FZVA 1TEXA 2F1HA 2Q6OA 1YK1A 1E62A 1LC0A 1SG6A 2C2WA 1TUIA 1V4NA 2JARA 2PT7A 4B46A 1IBSA 4L50A 4HMPA 1H9BA 1L5QA 1O6CA 3EVZA 1F5SA 1NOJA 3I2GA 1B6SA 2Z8YM 3DBHB 4J0KA 1DG9A 1V41E 1M1ZA 4J1TA 5JASA 5FUWA 2EKDA 5BWOA 2FR8C 4AY6A 1NW3A 5J2UF 4IMPA 1LC3A 3ZWMA 3OAAA 3SZ3A 5KNDA 2J46A 3IUPA 1U0NA 3NKVA 3EY9A 4MS3A 5JDCA 1PJQA 2H59A 5KVVA 4YV7A 3TGLA 3L2OB 5BSEA 4IV0A 5A6SA 4WEOA 1SC3A 3CR3C 2P6PA 3MSCA 3T6KA 1ZRMA 5KTKA 5HS6A 5CDYA 5LMUB 1ILEA 3TDNA 1C8LA 2DTEA 3NIDB 4EW1A 2GCPA 1UXGA 2JBAB 5I4BA 4NFHA 5KYUB 4RTNA 1N78A 2Q2VA 2AI2A 1GP2A 3USZA 4C5CA 3HJHA 1CJCA 1NZDA 4M83A 2XLCA 3I37X 5DSXA 5EI5A 5I3CA 1CU1A 2GZMA 1FRQA 1PV4A 3STWA 3WRYA 1KPGA 5A2QA 1L4HA 2J6BA 4N0PA 5EWMB 4G89A 4IDGA 4LJ4A 2WINI 5B30A 3KWLA 2HHCA 2HYIC 4QPPA 4HQRA 1SR8A 4TV9A 3ZNPA 2QF7A 1UBSB 3T5PA 1YIDA 3AGQA 4Y30A 4J1QA 2JGJA 1C1XA 4D4JA 1D5WA 3OJOA 4OV6B 4DYHA 2P2GA 3DKVA 3PWKA 5ICMA 1OIXA 1NHWA 3E5NA 3VI4B 1FFYA 2A9JA 2CXQA 1X15A 3HY3A 3ORQA 4JHXA 4J1SA 4YMGA 4WNAA 2B0CA 2OMKA 4RK7A 4RF3A 4C0BA 1NYTA 3P9KA 1SXJB 2OY0A 3AIKA 4PWYA 1C1DB 1GCAA 5DX8A 2ZBFA 1DTEA 3NJ4A 3TINA 1C7FA 2JFYA 3VR5A 2WHYA 3GRFA 4NABA 1GKLA 2ZW9A 4UBOA 4DRXA 4K3VA 1SQSA 2WNHA 1PQUA 2BMFA 1M8FA 2GYYA 2HFKA 4LY9A 4BO0A 5IP5A 1U6KA 3ZWWA 3U31A 5BSKA 4O0LA 5JY6A 2HLNA 5DBHX 1KOJA 3WMGA 3BF7A 1PGPA 1GNRA 1XCBA 4PFSA 3R24A 4ZOQI 4P9NA 4MGHA 3BC1A 2V4MA 4JUFA 4C2UA 3RHZA 2W2LD 4B2LA 3GNLA 2GJ8A 4BQFA 4OHUA 4AKEA 5E3IA 2ZYDA 2Z5LA 1JG6A 3RIMA 3QF4B 2HQSA 3WNVA 4R8KA 1ISRA 4A92A 2YHUA 3BIOA 5AUOB 5DPMA 1UANA 3AR7A 1E0KA 1UPFA 1UQRA 2Z9CA 1PJCA 4NV3A 4TZKA 3WQSB 1UR5A 2W2KA 1LF0A 4U7TB 3RTAA 2O2ZA 3IQEA 4IGKA 4AWAA 1DV1A 4Z5XA 3GDFA 2VIIA 4EJFA 3QUSA 1Y1QA 2ADMA 3ISVA 1UBOS 2PXXA 2RHLA 3QX9A 1D07A 3P0JA 2PR7A 1AU9A 2JHCA 4CM5A 2PXHA 3RRBA 1SU8A 3R6LA 4WLFA 3T7TA 4QDKA 2RARA 5DNVA 4DARA 2OHHA 3EFOB 1DBSA 1Y98A 1VJRA 4J2TA 3PXGA 2RK6A 3EDYA 1SBNE 1ZM3A 1K08A 1CX9B 2NTNA 2XXBA 1QO0A 1L5RA 4WJZA 1CQJB 1E2FA 1UFRA 2C2XA 3CUVA 3GFGA 4XEUA 2QAJA 1RLIA 3GWZA 2O2JA 1P4HA 1H1TA 4KPGA 2X2FA 4JSRA 5E6RB 2EYUA 1KYQA 1MR3F 2ISSD 1SHKA 3CUKA 1RM0A 4XIJA 5AOBA 2DPMA 1USIA 1Q7EA 2XH8A 4MJ3A 4BTEA 3OO1A 4BV2A 4D8WA 4QTYA 1QF9A 3ZQ4A 3RKUA 5GP1A 1IAVA 3G1TA 3PEVA 3B8EA 4Q9DA 1Y6GA 3FSGD 3MAGA 4CCYB 4QASA 1JQKA 3H9BA 1A69A 2L18A 1R5JA 3K5WA 1IUOA 4ZZIA 3CRW1 5KQSA 4CF4A 4GI1A 5I7AA 1B42A 3PNYA 3GROA 4W1RA 3K9LA 3MWJA 3P97A 4BNMA 3SK0A 3GH3A 4P2BA 1X13A 3TR0A 1ESNA 1ZKDA 2NX2A 4PPYA 2O4UX 3DJFA 4IXNA 1XXHA 3FLAA 3SS7X 3CKKA 3FB4A 4WEQA 3TOXA 4C0SA 4YV1A 5BXQC 4QGHA 1RZVA 2PT6A 1YXMA 3DGEC 4JAVC 1BAPA 1UDBA 3CF2A 3HJRA 4UXJA 4C89A 2B7BA 1PIWA 2ZI7A 4NEHB 5DGIA 3NYQA 3FNIA 4EG3A 2LCFA 4HCJA 4U63A 4RULA 3GR6A 4B3XA 4U39A 1JKXA 2WNSA 3PJGA 1HDIA 3G5AA 3IA7A 3ND5A 4TVBA 4TLEA 2WJGA 5HR5A 1PTKA 4RVUA 4ARSA 1LK7A 1NPDA 2DPGA 2VXBA 1N77A 1TZ2A 1QLWA 2YHIB 4JXJA 3UGQA 1B6RA 1WIWA 4IDQA 3RS2A 1CE8A 1KU6A 3H5IA 1HNZB 3Q3JB 1ISIA 3E3AA 2FSVA 1VSTA 3ENWA 3CW8X 1T9KA 3QE0A 4FB5A 1II8B 1W29A 3FMPB 3J81A 3LZCA 3RVSA 5CA1F 1IYZA 3HUEA 4ZCQA 1FB5A 4I46A 4EVIA 3HA5A 4X62B 1ORWA 3EUWA 3E23A 3FX2A 5CJPA 3FPEA 4S12A 3SQNA 3TK1A 1KERA 4ADSG 3MS7A 4R7ZA 3WA7A 1AKUA 2ZJ7A 4LDPA 1GSOA 1VMDA 5AK5A 2WSYB 1UMKA 1MPTA 2B94A 3LT5A 1UBEA 3AM5A 4MO9A 2I9PA 4GC5A 1MJNA 2NU6A 2X7JA 3VC2A 5KTOA 4OJYA 5DNCA 1B4DA 2B1RA 2G63A 2YXEA 4XFDA 1D2AA 4RKEA 5I45A 5UKDA 1THMA 2PQ2A 2ZB2A 2ZSFA 1C1DA 4Y2TA 4CV1A 4RWZA 3DE1X 2QYHA 2FW9A 1R10A 3CY6A 4H3SA 4AI6A 2PR2A 1BD4A 4C4RA 4D0SA 1SCNE 2BEJA 3D3EA 1WVMA 4CQLA 2C3MA 1ID8A 4CTNA 2X15A 3SJAA 5JYEA 4FYWA 2W2KB 4ZI5A 3TLGB 1I3KA 4I4LA 2BLNA 1G1AA 2X13A 1FL9A 1E94E 2RBGA 3RS5A 3R5XA 2Q4OA 3VMMA 1Z5UA 1H05A 5EIAA 1FDTA 4Z4CA 2VSYA 4Z51A 4FMCF 4QECA 3TSAA 1JDPA 4YUZA 5JAUA 4ZT2A 4DGSA 3H5LA 3O6VA 3HA2A 2P62A 3IELA 3ZZNA 3AWIA 3CPSA 3I2IA 1YU9A 2MMCA 4RSHA 4W6ZA 5A3SA 3RUPA 3MJVA 2OK8A 5HDBB 2O2SA 4UW9A 1QOZA 4NBUA 5CR9A 4W9NC 3SX2A 1WUYA 3I6ZA 1ZD4A 4PZLA 1Z34A 4JLOA 2AXEA 1BVRA 4N6OA 4QM7A 3L7KA 4JA2A 3QYAA 1XN1A 3Q10A 4JEIA 3VV2A 1VHWA 4HYEA 4E70A 3FOAA 2PPLA 1G8MA 2NU7B 4CCYA 3IMGA 3WGTA 1IN4A 5AVRA 2JJMA 3PHBE 5AD1A 1Z13A 2BKLA 3DW3X 1QE0A 1TKBA 2G88A 4HTFB 5AXBA 2EHDA 2V4UA 5I9IA 1L7QA 1M2OA 2IOFK 3RSLA 3T7RA 4H7IA 3URKA 1RQRA 1ZU4A 3JQBA 4MA4A 5J5AA 1RIFA 1U2ZA 4EHHA 4F4FA 1G9TA 1G18A 1SIUA 1H94A 1RCUA 1O5TA 4RADA 2B9EA 2EG5A 3HJBA 4L9SA 1YZGA 2GZSA 2NQ8A 4M98A 4JFAA 3IT3A 4XIGS 3U39A 1JHMA 4KYVA 3FDXA 4JENA 4PXSA 4TUYB 1PW5A 1QCZA 1GLVA 3R4VA 2QE6A 2YN4A 4LBWA 3M5WA 1WXQA 3I83A 4RH1A 2CXPA 3U3KA 2H1LA 1HUQA 2V6MA 2XMRA 3EXHB 3IHLA 3G3EA 4MRVA 3SHOA 3KJFA 2H2HA 3R0ZA 1HYHA 3UXEA 4BCDA 1RYMA 3P2EA 4KQWA 2PA0A 2J9XB 4Q93A 1NUUA 4KJXA 3T3EA 1MQ9A 1X9GA 1HFKA 2XY4A 3QQPA 2JAUA 4YROA 1MC4A 1ZH2A 3VOSA 3G59A 3UTDA 1X3LA 3A4MA 2VR1A 2Q5OA 5AOVA 2VJDA 2HEGA 5CFPA 3OMWA 4HTFA 1HMPA 3BK7A 4TLAA 4YDSA 5IJ9B 4Q3DA 3FRJA 5HXAA 4MKHA 4B3FX 3CE6A 2APJA 4BYMA 3C3AA 1ACMA 1V47A 3QE3A 5KWSA 3OJLA 1EA7A 2EFGA 1TC2A 2GB4A 3AUAA 2RDMA 5JMWA 5FEUA 1WKVA 3G8BA 2I1WA 4MS1A 4YALA 3ZY6A 5G0SA 4NLLA 5EJMA 4PQGA 2DC1A 1IEWA 1RXEA 3KEMA 4PS0A 1FFAA 2BRUA 2WHPA 4YP5A 2R7AA 2C2ZA 3BL6A 3DOHA 3KPWA 7YASA 5J5VA 5FBHA 2YVQA 3BTOA 1DXOA 5AQEA 4MUIA 2BT4A 4DZRA 5IJZA 4MDFA 3A3PA 2ACEA 1W6RA 4RD3A 3ZU5A 2O4CA 1Q83A 4RU1A 1V8BA 1LDMA 2J48A 3IBYA 3V33A 1L7XA 3E9DA 1JWLA 5DXAA 4ZV4A 4CDRA 5B3LA 5LP6A 1C1HA 1JQEA 4UKDA 2VJCA 1UEXC 3GDGA 5DCLA 3C8HA 5JRJA 1ZK2A 2NZVG 3E70C 2OLJA 3N87A 4JP1A 1FY2A 2E6KA 4WI1A 1HFJA 4ILKA 5TGTA 1HWYA 4OK5A 2OQRA 4BFZA 3LUKA 3VTFA 2YN2A 4PG5A 5KDOA 4LKOA 4YECA 5E7IA 4Q3KA 2Q7DA 5AHWA 3T7JA 5KQGA 1YS2X 3M1AA 4X20B 3R7DA 1WULS 3RT9A 4Y1EA 5MFZA 3KSBC 4F46A 2O5RA 1AMUA 2GEUA 1U2SA 1EP9A 1HT3A 1CZHA 1MC1A 2D59A 2X23A 2Z3ZA 4K05A 3X1DA 1TM3E 4IS2A 1K75A 2V6FA 3HEAA 4L75A 2ZCVA 2HCTA 2P4HX 3FNEA 2ZR9A 4BZWA 1MRNA 3GLFB 4PPGA 2RHCA 3OZWA 4GVLA 3AOEA 3BS4A 2PTHA 1YOBA 3GELA 3OFNA 2ZSBA 4YAJA 1WCV1 1SOVA 2QRUA 1J1IA 2MHCA 1E2BA 2J7PA 4BKQA 1FMCA 2PWYA 3LVFO 1OCEA 3NXKA 3GT4A 5KQMA 4IV8A 1W2HA 1S3SA 2QPOA 4AG6A 3QG5A 4WKNA 1LRLA 4FCCA 3KKKA 4KIWA 3TWOA 3DTTA 1A9XB 2R47A 5C7LO 1N7GA 3CTMA 2K2WA 3DAGA 1GN9A 4ZIRA 1J8FA 2OV1A 1XD8A 2RFLA 1NNSA 2ZRNA 2FUEA 3HP4A 4E13A 1GTJ1 3OQBA 2NV2B 2XUDA 5TR9A 1ZL0A 3EFHA 4NAUA 3T3HA 1ZNQO 5ECDA 4BYGA 1QH8B 1T6XA 4LVUA 1LQUA 1T5OA 1DAGA 2RBEA 3MWEB 4URXR 1LQ2A 2G5PA 3F2VA 1R8JA 1JQDA 1XZQA 3HVIA 4FNGA 4IIJB 4PNHA 4XM2A 4YA6A 3ROGA 4CM1A 4DLNA 4GLOA 1A27A 4FD2A 4I1VA 3ED1A 4EW6A 4MPJA 1TRKA 3DYBA 3EWIA 5EZQA 2IOQA 3ST7A 2O8NA 4MGYR 4ARBA 4CW7A 1KY2A 3O7MA 4DBVO 2BFEB 5DNYB 1KEPA 1UIRA 2QWXA 2YUIA 4PQYA 2JK1A 4MR8A 1MP0A 4JJ6A 2C29D 4LK3A 2XBLA 1DBVO 2ZIXB 5J2TF 2PFKA 1IXZA 2WU8A 1VCNA 1D2RA 2QQ5A 1Z6ZA 3RI3A 3KJXA 4DC1A 9ATCA 3N05A 2RJ3A 2VAVA 1ABEA 5GM1A 4YMVA 1BJKA 4JLNA 2VH1A 1VKJA 2AHOA 2MJLA 2W2QA 2W98A 3I04M 2CCJA 1ACJA 2H00A 5ALQA 5F33A 1G8JA 1MC5A 1Z62A 2R1TB 3ICVA 2J9YB 2LE0A 3AHIA 4KAXA 5HCNA 3UAGA 1IXSB 1E9SA 3ZEAA 1YACA 3A28A 3MHPA 3JARA 4WVLA 1AKRA 2MSDB 2YH2A 4O4HA 1UZMA 3VO9A 2NP6A 1RNLA 4IAOA 4ON9A 3MTDA 5L7YA 5L3SB 1D0SA 1KMNA 5KX5B 1JAYA 4EKGA 3HKCA 1ZJYA 2Q5LA 3QXSA 4BUJA 1ARZA 3COSA 3IAAA 3KZOA 5K3DA 1N3YA 1BQ3A 3E18A 3ZGOA 4KK3A 5JNWA 4V0MA 4XW2A 4HLUA 1NZFA 2NNLD 2IYTA 3D4PA 2F62A 2DM6A 4M9ZA 5EC8A 5E38A 4G0XA 2ZE5A 2WG1A 2IEDA 1Z3CA 4GSLA 3LL4A 3G8YA 3LT4A 3CHYA 5BMVB 3TZ6A 2IZ1A 2CJYA 1HF3A 2HUPA 1DL5A 2YVUA 3DDSA 4PO9A 4Q1FA 4Q24A 5DBGA 4E08A 4ESOA 2A1IA 1Y8ZA 1YK0A 4G8JA 1ISPA 2ERCA 2XWQA 5IUNC 4PXAA 3BGDA 2GWHA 1U0SY 3VUEA 3Q8MA 1KDPA 3NIGB 2N42A 3QE2A 2Q50A 2R6HA 1EFLA 5C4IA 4CGZA 3N2GB 1SVWA 2DHQA 3RJTA 5EJ5A 3HDJA 5IH7A 4XD7D 2V9CA 2GK6A 2QK4A 3WK4A 3HCBA 1O1YA 1YI1A 4LBZA 2JD1A 1AF4A 3Q4GA 1OX6A 3ND8A 3IV9A 4HG2A 2GGSA 1KJYA 2G4CA 3G02A 3NTRA 3SZGA 3U5ZB 2Q5IA 4JLDA 1P5ZB 4LOLA 4DIFA 4C7KA 1ZIPA 2J9FB 3OZCA 1SCKA 1X7YA 2I9KA 1W1IA 4ARIA 2HMYB 1U8EA 3OD5A 3C7AA 2W8ZA 3HABA 2XGOA 2Q49A 4E21A 2Q8NA 2ZRKA 4JITA 4KWCA 3LWDA 2FG6C 2BJVA 2QM0A 1LLQA 2GYWA 1BXRB 4XWAA 3EISA 3F47A 5J9FA 3FLEA 5IFKA 4HYYA 5M29A 2ZJ6A 3OC6A 1CF2O 4LXUA 4X1KA 1KGSA 2QG4A 3HKCB 1MHPA 3C8MA 2P68A 3I6YA 4NMHA 4QPNA 2QLNA 2YYZA 4DMHA 5A0FA 2A5JA 1RS0A 3CCFA 2LCQA 3ZHZA 3N7AA 2HU7A 1NUSA 2EHJA 4E5KA 3RQSA 4D6PA 5FR1A 1YU6A 4MYCA 1YR2A 2BI8A 1NF3A 1VHJA 1MOSA 4DNFA 2ETXA 1VC2A 2EYQA 4L22A 1ONBA 2A4KA 2B1GA 2BONA 2QVLA 3M0EA 2B5WA 2C5GA 4BNXA 3D6VA 2EOAA 2NYUA 2OK7A 4JB2A 4OKSA 3VMFA 3GFPA 1UH5A 5FWNA 1E2UA 1QR2A 3BSYA 4TLDA 2V6IA 4EJSC 4TKMA 1TYDE 2EU8A 3NU1A 5JMPA 4RY2A 1P5JA 4BJ5A 4LECA 1SIOA 1H5UA 3DO6A 3UN1A 4IJUA 3VV3A 3R3WA 1X8KA 1J1ZA 1QFZA 3JAWA 3WWCA 3E2MA 3GFBA 2O8DA 1KO8A 4Y6QA 5BW5A 2D2IA 4OREX 2VK4A 4HDKB 4JA0A 1L4EA 3K9QO 3UAWA 4U1RA 4BBZA 1JPJA 4LXGA 5ICGA 5JWRA 2W70A 1KFBB 4IMRA 2WILA 3REGA 3NJ8A 2NSLA 1RXCA 2IEGA 1TYZA 2FRDC 4C01A 5A5GA 1Z7BA 3I4FA 4R1LA 4K40A 4KH0A 1GR0A 1NBOA 1V6CA 3GHYA 2W58A 4NK4A 5KVCA 1U7UA 2IZOA 4HWTA 3TQCA 4DA6A 5LQUA 4U7WA 1UBNA 1T9CA 4RQAA 2DWCA 4CLRB 3I4LA 1E6MA 1HA3A 2NXWA 1FRNA 2WD7B 1CR2A 1JB1A 1KIAA 5K2OA 3ZD6A 4HWRA 1XNGA 1N0WA 3C5VA 5DX1A 3UAYA 1U7OA 2XA2A 4NOLA 2YJTD 2ZSJA 5HKKA 5LP6B 3SC2B 1FMJA 1ZCFA 5DM0A 1WEHA 1WL8A 2IX9A 2OE2A 2ZYGA 3CQ9A 1MJGM 1OX5A 1XDGA 3CWZA 4QTTB 4ZEWA 1EGAA 3WSTA 4BRSA 5IWCA 2ZAOA 2WF7A 4L72A 3TXXA 3RIHA 1TJPB 1ACLA 4KFUA 1U0EA 3GVXA 3LRPA 4FYIA 3EQ2A 4PSVA 4QOSA 4WACA 1O94C 1PGOA 3EGOA 2XQKA 4L4SA 4NCXA 3PHIA 4LAFA 2I7CA 1GU0A 2LRHA 4V0OA 3QPUA 4HV4A 3N07A 5TGDA 5EWJA 4Q01A 1U90A 4PLCA 4Z9BA 3ZQKA 3KZCA 1CJVC 2A5DA 3CLSD 4XD2A 2HPAA 1XZHA 2G71A 2D0DA 3MRXA 5HG0A 3BXPA 5BQPA 3A1CA 1CYEA 1Z73A 1PLLA 1NRIA 1DHRA 1ZEMA 4IBOA 5HILA 3TOCA 1SQGA 5C8DA 5JUWA 3DGFC 2VTEA 1OH6A 2OORA 4R68A 3NFYA 4IGIA 4NV0A 4W63A 2ZU0C 1H22A 3OQIA 2H63A 2OBBA 3GF4A 3N1UA 5E6UB 1N5JA 3MTAA 4C22A 1HL7A 5KSYA 1L5HA 2HT6A 2V54A 2WTUA 3MWYW 3GC6A 3ZC3A 4K46A 4G07A 3L0CA 1K92A 5CB0A 4YMUA 2G04A 3JZAA 1N2XA 4M1WA 1QWOA 4MTCA 4DNPA 4EGFA 5A4DA 5I5EA 3K0FA 4ZYTA 2HHAA 3G0DA 4B43A 1LH0A 3LMKA 1P8JA 1P6UA 3UV7A 5TMBA 3I45A 1HI9A 3WAGA 1US8B 2YZKA 2XR1A 1L9XA 2Q07A 3EOZA 4LYFA 2OM2A 1EFVA 2WJVA 3T0GA 4BX9A 3BULA 2GFIA 2YIMA 1EA5A 1E9VA 1WSDA 4EFLA 4EITA 2GJ4A 4NEQA 3KYDB 2YYSA 3ZBQA 4YACA 1FVOA 2BGRA 3HNPA 1SXJE 1CUCA 3QNWA 3RFFA 4WGFA 3QFCA 4OBWA 1E5QA 4NBRA 1BEEA 2XOEA 4R2LA 5DKFA 1I4OA 3GGJA 1N2CB 4GM1A 4JLWA 2EIHA 2FPKA 3AKCA 4Q7KA 4Y1RB 3T61A 1ZM7A 3ORHA 1L5WA 2HJHA 4WJKB 3TTXA 1Z18A 4EW2A 2BCGY 2R6GA 1E9AA 2XVYA 2FW0A 1TKRA 3P2IA 4RZSA 3ZNOA 1QFXA 2BP7B 1OAOC 4PV7A 1J9EA 5PNTA 1RKBA 2JPDA 1YB1A 3KOXA 4C0XA 1BDMA 2XEXA 1BDHA 4Y1FA 1CLUA 3R2JA 4MHTA 3FCEA 3FROA 5B4VA 4JOBA 1ZY2A 2IPXA 1G60A 1U4SA 2PO7A 1YL5A 3ZWBA 3F9CA 1NVFA 4PO8A 5AM0A 5BVHB 1KJ8A 5C8YA 1UBMS 3NANA 3DKIA 4ALJA 3AM1A 3COWA 1BU5A 3W5CA 1O58A 4MAMA 2VYND 4GKBA 3P2YA 2H1SA 4DL9A 2BTOA 4Y2RA 4WBXC 3STYA 3CKLA 2JCGA 1Q0TA 1W49A 4JR2A 1KIFA 4ARZB 4EENA 1PX2A 5BN5A 4ZYYA 2JVIA 4UFNA 2FN7A 3WNCA 3H8JA 2VNAA 3IP5A 4N5MA 1TI7A 4WDQA 5LBTA 2QSUA 3MYRA 2I1VB 4CMEA 1K1EA 5BQFA 1QIHA 1LJLA 4WLUA 4XSHA 2JLUA 3D5TA 2BSXA 2VDKB 2Z08A 2VWPA 3L8ZA 4QOHA 3KOUA 4YJFB 1CZNA 2V65A 2WT9A 4LOHA 4DGQA 5JY1A 1M1YB 4EVRA 4XQ9A 4E5UA 3PEWA 3KQHA 5KOIA 4FKZA 4AJHA 1M2HA 5TS2A 1IJKA 3FZYA 4MX8A 3VR6H 1XJCA 2HM7A 1XHEA 4JCOA 5J63A 3DV2A 3VU9A 2W8BB 5T6MA 2BHNA 4YT2A 2FRDA 5HE8A 4EWLA 2H5JA 1HQCA 1GADO 1JSCA 3ORRA 4FK8A 4F7DA 2AV6A 3WGKA 2FZEA 1J8VA 2FRVA 2FZLA 4QXAA 4BZPA 2FEMA 4ZCRA 1WS6A 2WHXA 1O87A 3WYEA 3VZQA 5KWIA 3I5XA 3C1OA 4AMZA 4FBMA 4HO1X 1JHOA 1QIGA 4YPOA 3HBAA 3TVYA 3W5JA 2I6UA 1NULA 3CN7A 4QUBA 5DP1A 2WKRA 1WY7A 4RMJA 2C3PA 1YS1X 2NYAA 2YW2A 3N8KA 4MDEA 1UFKA 5JRZA 4HEA1 3EEQA 4KO3S 2QY9A 2V7QD 2WAOA 3DBVO 2IXBA 1GZHB 1RHKA 3BH0A 1HETA 2JAWA 4UNQA 1N0HA 1ESCA 1KMMA 1PZGA 2BE7A 3HKBA 4JT4A 3U9LA 4TL6A 1EDDA 3WJ1A 4LZLA 4R3WA 1F8XA 5CYPA 3ER9A 4AN1A 3IMFA 1Z39A 3IMKA 1XCGB 1E6CA 5ELLA 3ELDA 1OYYA 1ZGGA 1AD2A 3EBOA 3MCTA 2K2QB 5KSZA 3IP7A 5AKKA 5FBZA 3HSSA 4KBFA 2Q3CA 1TA0A 3WK6A 3T52A 1QCCA 2MYUA 3MTQA 5HJEA 2XT9A 5B7PA 5K09A 3MCWA 4G23A 3BXFA 4MB0A 1F2UA 1KJJA 4MB6A 4NQZA 1ISJA 4NYJR 4R8VA 3VAYA 4HGZA 5A5VA 4C6SA 2VUSA 4P80A 1PKXA 4UM5A 2X0IA 1RHJA 3CUUA 3LKDA 2HI0A 3X1JA 2P5SA 4WJLA 1E6LA 3EH2A 3QLUC 4L8VA 1B74A 5SICE 2IIBA 4B73A 1W47A 2AYYA 1Z4MA 1E89A 3X1KA 4BQPA 3DO8A 3V7YA 4RE6A 3TIXB 5CJ2A 3SIWA 1FU4A 1VL6A 5AHKA 1TYBE 2ERXA 1WDLA 1RAEA 2GO1A 4DIKA 5BPFA 2GKOA 1X8XA 2EFYA 2PD4A 3TN7A 5IG2A 1FFCA 4ZAXA 3WNBA 4PC1A 1FW8A 1ENOA 1XTZA 3B48A 4HPWA 4WA8A 1YMVA 5KTMA 3GLHB 1T9AA 3EJ6A 5A62A 3F0TA 2PH7A 3RU3A 2HA0A 2XKJE 3NB0A 4WLNA 1PJTA 1RRGA 1SC9A 2R8EA 5K3CA 4QGBA 2GJSA 3THRA 1VLZA 2XB2A 1RJ9B 4URYR 3W6ZA 1GY8A 5C8YB 1NG9A 5I51A 1CUVA 3GAZA 1L3IA 1W9MA 1BO6A 1OZ0A 2HL6A 4YLYA 3AY7A 2LKDA 3R6GA 3G68A 2QJFA 3JD3A 1XWWA 1TKCA 4KMOA 1KKLA 5D85A 3NAMA 4KVAA 2QTAA 3MAAC 4ZICA 4CI0B 2VAPA 4L4ZA 5JOQA 2PCJA 3K5IA 4X7RA 2ZIUB 2XMSA 4OB6A 3FCUB 3WV5A 1U1FA 5K8JB 3L01A 3VM6A 1OROA 3ZU3A 4DUZB 1H1DA 3TLJA 1BVHA 2WU4A 3OLZA 4W5RA 1Z63A 1NBHA 1JDJA 4M0KA 4DEXA 2HBYA 1Y42X 3ESBA 4HQ0A 2PT9A 4P54A 3RF7A 4AMUA 4B3TB 1HT1E 4ZMBA 2NAFA 2HYDA 2O8VA 4LJKA 4FNMA 1PT9A 2Q7XA 2WI8A 3PWSA 4MKRA 4Q3OA 4YO8A 2EL7A 4WNYA 5E9QA 2ZTMA 4ZDJA 5JTTA 4KX3A 2FSSA 1BWQA 4IFEA 4IOJA 4L6IA 4UEOA 1J49A 2G0TA 3NVKI 4H1HA 1LDEA 5IBRA 4XDZA 3TZKA 2H1IA 5CHYA 4YJHA 2GILA 4JI0B 1H8HD 5AKLA 1MAVA 5JS6A 4O59O 5G02A 4Y2XA 4YT8A 3WWPA 1HRDA 1ZH0A 3ENZA 4IZHA 5JXJA 1DG3A 1J42A 5C8XA 1VG9B 3TI9A 4FINA 3MK31 4DVJA 1RRFA 3EZFA 4F3CA 3FAZA 1OPXA 1R6TA 1WQ1R 2YXBA 1U8TA 3DW1X 3RASA 2GEJA 1NBWB 4IICA 3KFXA 1KYIA 4LVOA 1H6DA 4C3VA 2CN1A 4JYZA 4BEJA 1OLSB 3E9CA 3EXG1 3L7JA 4XYBA 1K6JA 2G7ZA 1NN0A 2VDWB 1D6JA 5GJCA 1K5PA 1KK0A 5C37A 1YZQA 1T4DA 1UDWA 2IIVA 3EXAA 1BW9B 2QVCA 1ODSA 3INRA 4A6XA 1QRSA 3PDJA 4POOA 2O20A 4MS3B 3C7TA 3EPKA 1MORA 3VDMA 2V55B 5L7WA 4LF6B 1J5EB 3L0YA 2WKWA 2HK6A 3EVBA 1KAQA 4V3BA 2PE5A 1LBIA 1SKYB 2O2IA 5AW6A 1DO2A 2CFIA 1E7YA 2ID7A 1TQHA 5L3QA 2QUHA 3FCXA 4UQLA 3MQ2A 2WLTA 1U81A 2OBNA 2B92A 2MR6A 4DJEC 4RD2A 3HI6A 1RKXA 3D8UA 5F5LA 1E2EA 3OOHA 4MUAA 3QYPA 1R4NB 3VNAA 1Z4IA 3WWDA 5JNLA 1KSGA 5C2JB 1OA0A 2AR9A 1W5AA 2VBIA 1M67A 3PPYA 1KYYA 4LPSA 1TO2E 1Y5IA 2AH5A 4O2BB 4Y9TA 2WT8A 3K0SA 2WF9A 3KLNA 1F2DA 3ZWXA 2PZAA 1LPNA 1BROA 1C3OB 1QCYA 4KYIB 3SNHA 2CLMB 3H3XA 5ALXA 3RGGA 2G80A 1PNOA 4F4JA 2DUJA 2QLJA 3SXJA 2OBLA 3WHIA 1Y34E 3WGLA 1N0UA 1XRJA 2IP1A 3JALB 4C21A 3CR8A 1M1UA 1T5DX 2WU0A 1NLFA 4XGRA 2E7ZA 2CF6A 1ETHA 2ZVQX 4JBNA 3B2EA 3U37A 1GOTA 3OCYA 3DWIA 3HA3A 1L8LA 4DIUA 2FMIA 2X7XA 4LNHA 1H2HA 3ANMA 5IF3A 3B9RA 3JRNA 3VNUA 1PGNA 3EE6A 1J7KA 4H08A 6AT1A 2IV3A 2RHBA 3OP4A 3BZBA 3ZD9A 4Q82A 2GDJA 4WZBE 5ERGB 2EQAA 3LNCA 1UINA 4EKNB 2BUAA 2GO7A 1X7DA 3KAPA 1W5SA 3K0AB 4OYLA 1W36B 1ATZA 4JC5A 3OAAD 2FLVA 4L02A 2PBFA 3IA2A 5JBNA 2REQB 2HMWA 5JSQA 2GPSA 1PQ4A 1K98A 2H1HA 3I8OA 5CVUA 4BATA 5JCJD 1ZNYA 5DV9A 4WLOA 3TLKA 121PA 2BI7A 4BIMA 4ZZ0A 1FNSA 4TT3D 2H1VA 3AXSA 2FW7A 5K0FA 1MO3A 2B2XA 4BAZA 2NT3A 4MINA 3T41A 4CQMA 3EX7C 4QLOA 1E2JA 1OZFA 1YCFA 2CDCA 3NV9A 3ZWDA 5AKIA 4CHTA 3SE0A 1KJ9A 2B4AA 4M0CA 1YIAA 2C5EA 1KEUA 4NBWA 2JK0A 3LUGA 2ZRIA 1N32B 2CXUA 2OBYA 5BQXA 1OWNA 4N9WA 4Q37A 3RARA 2WY2D 3KQNA 3RHFA 4A1FA 5FA6A 5F21A 3WS7A 4EBFA 5CEEA 2GF2A 4R98A 1YQTA 2FRXA 2GKGA 3O1IC 5IC6A 3OPNA 2NTJA 1KDOA 4FT2A 3JWJA 4OTZA 3HKEA 3PUXA 1A2BA 2G5CA 4JZKA 3OZDA 3TD6A 1Y82A 2NADA 2FV8A 4S04A 3UV6A 4ND4A 5SV2A 3T7AA 3AJ9A 3UJHA 1F60A 3GOQA 3HCAA 3TB4A 3P5SA 2I4IA 1X86B 5HKOA 4LXQA 5TQVA 3OJEA 2QRGA 4E31A 3FMIA 4FFPA 2KLHA 4TN5A 4YI5A 3JAWB 5FPTA 5DP2A 5AVQA 3E4DA 1P44A 2REBA 2Q0HA 4TSKA 2QW8A 4XM0A 2PYDA 2O5EA 2OCDA 4NOMA 4J4BA 5AO9A 1C30A 3P0EA 4N12A 1EK0A 4BGVA 3WWZA 1ZQ1A 3BB1A 3GUZA 1KI1A 3K1AA 1MDFA 3U4IA 4HZUB 4M7OA 2VDWA 2Y0PA 4WASA 5EPUA 3VR5D 3WDLA 2CJPA 3O7WA 4WK0B 1VDMA 2G3YA 1SD1A 3AIMA 3FJYA 4D2IA 5IKMA 5J43A 2RHRA 3DUFB 2WSIA 2XF8A 3PUKA 2FCRA 3LPDA 4NP6A 1KQPA 4EAAA 3OM1A 1DIGA 1E59A 3GYGA 3L9XA 3NNDA 3HU5A 3Q8WA 3TRJA 4AJIA 3NALA 1QONA 3QY9A 3VNBA 3DFIA 2WWVD 4U02A 1HYQA 1XD2B 1YKFA 1GKUB 1EVYA 2AOWA 3E5RA 1Z6AA 3FY4A 3HDHA 4GRIA 3ZZTA 4DABA 1P2GA 2YWFA 1R5BA 1C0IA 3FPAA 2JBHA 1OFUA 2KYRA 2N47A 4F2WA 1ILWA 4I4TF 5IZCC 2OL4A 1P4AA 5TB5A 1N1DA 1Q1GA 1CUGA 1FP4B 1XR3A 3LOUA 5EUQB 5I6DA 3UK0A 3QH4A 4PLYA 1AURA 3MPUA 4US0R 1G19A 1H5NA 1Z6PA 3K9FC 2ZETA 2MCFA 4ENUA 3EHEA 3IAS6 4EAQA 2DWQA 1BIFA 1VIMA 1B0AA 5HMLA 2Y1KA 1N4AA 1X80B 3KB1A 1FJ2A 3WLPA 4DPKA 4FE3A 1PTJA 2QHXA 4EYKA 2CEAA 1Z5ZA 4ZKDA 5IK2A 2FP4A 2NW6A 4BV9A 4F3TA 3E03A 5JD3A 3GH1A 5EYPA 1RWVA 4G25A 4PTLA 5B3AA 2JLCA 1RXWA 2OCKA 5ARBA 3FF4A 1GNLA 1GCOA 1ZMXA 1IK4A 4NSNA 4YJDA 4NXMB 1QFYA 3G2MA 3HCPA 2JLRA 2OGSA 4MQ4A 2XTAA 3ZTYA 4HZUA 2DERA 2YHBA 2PT5A 3DF9A 3WIUA 3O8OA 1TIKA 3HYSA 4N65A 4Q9LA 1P1FA 2M98A 4KGDA 4WSOA 5DYIA 4B34A 4FMBB 4CT5A 2DKNA 4LTNA 2CNWD 2DR3A 4A8TA 3LY9A 3NTOA 4FGUA 3D2CA 4H7PA 1A8QA 1G20B 2QUZA 2CF5A 2WM9B 3M3PA 3PXXA 3Q1LA 4O4LF 4QBFA 1R8XA 2Y4OA 4UUQA 3OQNA 1KRXA 3EG9B 4AUNA 4Y8VA 2A9RA 4EYGA 3FVTA 3HCRA 5AJUA 3R23A 3BERA 5DSTA 5T41A 3TJZA 2IE8A 4U2EA 1U2DC 2ACVA 2F7SA 3NAZA 4W99A 4NU5A 4PIMA 5T8KA 4UEWA 3UFXB 2PKXA 2WQZA 1L5OA 4OQNA 1UXHA 2BFDB 3OTWA 4I08A 1UBRS 2I6SA 1OBVA 2Z2JA 3KYJB 3N8DA 3PV0A 2P7IA 1LKZA 1R12A 3G1UA 3FFAA 5CFLA 4C3UA 3FWPA 5C1IA 5EUMA 2F2TA 4PNZA 3W5AA 2PRIA 3SQDA 2XBMA 2H31A 2C96A 2NPFA 2A0WA 3ZCRA 1XHLA 3PUYA 4MB2A 2SNIE 5EE3A 4F11A 1TM5E 1GV0A 3I3SR 1K4MA 4ZP1A 4MLCA 4ARZA 3DT8A 4ZQIA 1E3WA 1I3LA 4QU0A 3VR1A 3CF6R 2ZYWX 5FWDA 3MB5A 2GK4A 1AG9A 1UCFA 3A1DA 4DLPA 3GVIA 1NASA 1QHGA 3D3NA 4K6FA 1OQAA 3M49A 3KLMX 3ZIDA 1YJAA 4OKIA 4QL3A 3L1UA 1PU2A 1U0OC 2C59A 3T0FA 4A8JA 3K4PA 5DWQA 3CO0S 4TYYA 1UEJA 4QDTA 2C61A 2ZTHA 5KTSA 4ZVMA 5H82A 4H1WA 3BWCA 1GUZA 1Z08A 3TTWA 4UC0A 5IT4A 4FFVA 1D4FA 4OXNA 3K2QA 3TPZA 4LRXA 3QOXA 2OD9A 5EZ6B 3FVRA 2DFKB 4TTRA 3OE7D 1J09A 4GDFA 2GN6A 2XD4A 1VJCA 4GIBA 4NZOA 4MW2A 1KDVA 5BP7A 3EVEA 3JQRA 1NJGA 5FA5A 1SBYA 3AHGA 4BVLA 4C7JA 3BDIA 4MQUA 4REOA 5I4IA 3ETJA 1SNYA 3R5JA 2R8YA 3DC2A 2GT1A 2H18A 1PO7A 4TQAA 5BWNA 4PM4A 2DBQA 2R6ZA 1FDWA 3E7WA 2VDQB 4JELA 4E3WA 1U28C 2FQ1A 2FK8A 2WSLA 4D8XA 4FBGA 3N3AC 1VL1A 3HCFA 1VCMA 4G3XA 4CQMD 5CA1B 3D59A 1SWWA 4I4CA 3KV1A 2ECKA 1C7RA 3R77A 1LB1B 5SZKB 3OZUA 2NO4A 1G5QA 2A5GA 5BWLA 1JSXA 3O4IA 5DB4A 3RS8A 3LGXA 1EWVA 5DEOA 3VH2A 3LBNA 2CNDA 2XIQA 4QQ8A 4B6OA 1EGQA 2O48X 1JBQA 3QG1A 4W8OA 1G8FA 3BILA 3C6KA 4DXHA 4PZCA 5DRTA 2W6CX 3DCJA 1TO1E 1M8KA 1IOLA 4KO8A 1ULHA 1KE2A 1CY2A 2CXOA 3P7MA 1MQAA 2P1DA 1E3QA 4P3OA 5AOAA 3T7SA 2C7RA 2PZBA 4G0PA 2QTNA 1XVAA 5AUPB 1CVRA 2UVPB 1SU6A 2PPVA 4L0DA 2O54A 4Q4LA 2QMQA 1AKMA 4QG7A 4MHOA 4JJZA 4L4XA 1IPFA 3D0QA 1LWOA 3R5KA 4GPIB 5CB4B 1TZMA 2B36A 1IIBA 2HCBA 3C48A 3L84A 4W5WA 2EW8A 2GD6A 4DMUB 2P5YA 3AVWA 2X8JA 3RAJA 4B6GA 2Q45A 1PYDA 4R3NA 5FH9A 1S0UA 2M6LA 1R64A 4OY3A 2XCOA 2IXFA 4L07A 5FBWB 4EKYA 1A9XA 2P9CA 3WQHA 2Q1WA 4AZWA 2EJWA 2OGUA 2GD2A 2PSDA 5B58C 2I3DA 4P3KA 1PZFA 3QYFA 2V7XA 521PA 2XNSA 2BR4A 4C76A 3V1KA 1Z74A 2Y1LA 2QVZX 3FHJA 1GTL1 1T8YA 1WVGA 4IEEA 1U0GA 2LCIA 3CRNA 4G24A 2WYIA 3ZZMA 2OB1A 3LPCA 4GMKA 2ZI6A 3WYGA 4BQNA 4E12A 1U3UA 1NPTO 2PXCA 2VI5A 3FGPA 3F6SA 4NYIQ 2GR9A 1O94A 4ZQCB 3VVCA 3GYBA 2H3EA 4B83A 5FAKA 4NBVA 4UVIA 1FX0B 2VATA 1RT9A 2WIFA 3RS4A 4GBED 3I9FA 3R3XA 5DLQC 5EWLB 5TY0A 1QOQB 4UE3S 1SZDA 4BLUA 4CLRA 4CN9A 1S9DA 3H9QA 1P75A 3L9WA 1QAOA 4WXEA 1GV1A 1NFQA 2OHGA 1M8GA 4YRAA 4JYMA 2Z09A 2JJ1D 5CA0A 2A86A 1KI6A 2EF0A 3JYLA 2TS1A 4MGEA 4U9HS 4YLEA 8AT1A 2R65A 3WADA 1GKYA 3CONA 1U8FO 2C7OA 2WJPA 1COWD 4LXTA 2Y1WA 3PNOA 1XNQB 1TFUA 2J33A 3DDZX 4H31A 4CLXA 4OHXA 4XYGA 2OFFA 3G0HA 4FZVA 2AF3C <