2MR6A

Solution nmr structure of de novo designed protein, northeast structural genomics consortium (nesg) target or462
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
136
structure length
136
Chain Sequence
b'MGVVILVLTGDERIAEELRKEVQKHDPNVKTVPTKDKEKVKEEIEKARKQGRPIVVFVRGGDDERAKDIAEYAQKEGLRVIVIIVSQDEEALRKGYEDKKKKGYDVYTSRNEDEAKKKLKEALEKSGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed Protein OR462
publication title Solution NMR Structure of De novo designed protein, Northeast Structural Genomics Consortium (NESG) Target OR462
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 51
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2014-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mr6A00
4J29A 2LTAA 2LNDA 2LR0A 5GAJA 2N3ZA 2KPOA 2LV8A 2L82A 2LRHA 2LVBA 2LCIA 2MR5A 2N75A 2L69A 2MR6A
chains in the Genus database with same CATH superfamily
3I61A 1FMFA 3IYLW 1QHXA 4BLVA 3V4ZA 4N01A 5LKRA 3EA4A 2ZR9A 1TT5B 3D7RA 1U0FA 4OYHA 4RQAA 4RSHA 1PNTA 5TQ2A 1ZAYA 1H0HA 2AUNA 3IVGA 1QPGA 4DIDA 2PGJA 2W2PA 1GPJA 1XD2B 2JFNA 2QM3A 3ESYA 1C3VA 1ZNYA 1CFJA 1HYQA 2QTTA 3L4JA 2Q1WA 3AUFA 1K68A 1WNTA 1E7QA 3GP5A 2XQFA 1VE9A 3O8OB 4P53A 4E14A 2ZUEA 2X76A 4E30A 3N6VA 4L07A 1JKMA 4K9NA 1ZOLA 5JADA 1T9AA 2ZWPA 3H04A 1P0PA 1O4VA 2O7RA 1BXRB 5AKEA 3IBSA 2M6KA 3ZN2A 4CM1A 2XMQA 2H9IA 2EKDA 3CNQS 3EA0A 4PYQA 1TU4A 3A10A 3T52A 2J9YB 1PL8A 3AY0A 1DDIA 1PS9A 4P5PA 3TB6A 1ILEA 3WP0A 1LF0A 1RQNA 4BNZA 2OAEA 2EU8A 4AY2A 3L2OB 1Y6JA 2W71A 2PUEA 2PJZA 1VPEA 2Z6AA 3E58A 4KO1S 5DDIP 4NC9A 4D8WA 4UUMA 3FRJA 3TI9A 5AW0A 2O8BB 1JHZA 3LUDA 2ZAYA 3RVMA 2D0DA 3F4LA 2EATA 3LSTA 2CLSA 3WBJA 1M5TA 3HCPA 2A92A 3SFZA 3OIWA 5FFFA 3CA8A 3BPSA 5CVVA 3ZU3A 4CETA 3BHIA 3RE1A 4ENRA 2OM6A 4YP7A 1WU8A 2PVCA 2XTJA 1KGDA 3TI7A 2HYIC 3BSWA 1VECA 4WLFA 4DR1B 2AZXA 3KJQA 5HIJA 4DY4A 4JNCA 2I7TA 3TUZC 3EH1A 1JDUA 1YUBA 2LCIA 4Y9SA 5G0WA 3GO4A 4KOEC 2NZWA 2QTZA 4J0FA 4Q7QA 3R5KA 4YALA 2QAJA 4D0GA 2JAHA 4OA8A 3K4PA 4A16A 3BZBA 5EXTA 4Y67A 3OQOA 4QELA 2FWBA 2WI8A 5LQMA 1V45E 1UC8A 3OAAA 1Y8QA 2WT8A 1V11B 1B8UA 3OPXA 4GI3A 4NE9A 2WTEA 2ZW9A 1B4DA 5A1JA 1JIKA 4HDRB 4FW9A 1I2DA 2QI9C 4LRQA 4LOKA 3QE4A 4PTLA 1DL5A 1PYOA 2VBGA 3GG2A 4LQ4A 2OV4A 2Y0DA 2FEWB 3LF1A 4I8XA 4V2IA 5CXXA 4QBGB 4WVLA 2J3MA 1KO4A 4ZCSA 3REQB 5B1EA 1P1IA 4ZHQA 4NYIR 1NBHA 4ZEVA 4F0JA 5FPKA 4MW6A 3DW3X 1Y1PA 1JIJA 3U48A 2IIPA 4MWTA 1EQAA 1MC5A 1KAGA 1MV5A 1UK8A 1ZKDA 4EG4A 5J4YA 2TSYB 1XAIA 3QLVA 4YMHA 3RJ9A 1VB3A 5JZBA 3E7PA 3JQGA 4URYR 3W4IA 4UNRA 1ZD5A 5KJ1A 1CUEA 1EK2A 1NRIA 1Z3CA 2J09A 1H8ED 2D59A 3QTLA 3SN6A 1LJ8A 1J2RA 5A6SA 5HUQA 3ZR4B 1FNMA 1ICEA 2W2NA 4GSKA 3TM4A 5I3CA 2WMDA 4K6CA 1PP4A 4AZ3A 1QC5B 3DBLB 3GOQA 4W9MC 2GH1A 2VTBB 1ZQ1A 2QDKA 2JFOA 3GJRA 1FRQA 5JARA 1CSEE 1CUYA 3AH8A 2VPTA 1H2YA 1QTRA 3C45A 4N5HX 3TD9A 1NR5A 1YUMA 2O6LA 2RAUA 1GZ5A 2G82A 4J0JA 1H1LB 1T0HB 2EAUA 4OHYA 4OBBA 4BNDB 2YQ5A 1R15A 2V65A 4G0MA 2HZBA 4QXMA 2WA2A 3R9XB 1GKKA 4FFOA 2PX4A 3V8VA 4GH5A 1OA0A 2Z1MA 3DE7X 5F1PA 1ISMA 1M1ZA 3GRUA 1GPKA 1R8QA 2E0IA 3DE4X 3ELBA 4IHJB 2P68A 4XSGA 1A82A 5DTEA 2NVWA 3ITEA 5DGXA 4Z7NB 1JLKA 3ADPA 1YOBA 1N8SA 5E7IA 1JMYA 3G0OA 3PXAA 3R6GA 4W8HA 3K0EA 4Y9TA 2R1ZA 3WYNA 4AZTA 3IP8A 3CZ4A 1EJ6A 2CNDA 3ZWCA 5A02A 5A5VA 2HC9A 3B1YA 5CYOA 3ZH9B 1VLLA 3TVTA 5KOJA 2HLDD 2R2GA 4N3CA 3DNPA 2YOGA 3P4XA 4RGVA 2QN1A 2JIOA 3KU1A 5LMCA 2WSIA 5CJ2A 1P39A 4UPVA 4EKIA 4W5JA 4KFCA 3NFYA 3BICA 3G6KA 4WNIA 5JOQA 1LRJA 2IUSA 4HZUB 4Q1EA 1WA5A 4GMHA 1MZVA 1S2IA 2B8NA 1P0FA 4M9ZA 5JJCA 4CEIA 3A11A 1HGXA 4Q21A 2ETXA 4BBAA 4B6QA 3HCNA 4JUIA 1VBMA 3X3HA 2I4MA 3W6ZA 3BWYA 1XLWA 3BD8A 3MILA 1E9FA 1QIFA 4QBHA 3ESQA 3D0RA 1VP9A 4EMBA 1ZN8A 3M6FA 4YY3B 1VA4A 3GLSA 2WVAA 4XRRA 1NHGA 3X1YA 5LA6A 4QLBA 1BW9A 3PJRA 1P4RA 2CZCA 3SXPA 4X24A 3UHOA 3VYSB 2H59A 5JXHA 4FNGA 3L0YA 4S0XA 1OYWA 4UHDA 2XHEA 1XTPA 2I66A 1JVNA 3A9UA 5A5FA 5HXAA 2XXAB 2JAWA 1EFPA 3PFIA 1N6LA 2AI1A 4NJEB 1JR6A 2I4OA 4PY2A 3SBDA 4BNWA 4IYJA 4HWOA 1WZCA 1XLTA 3FCUB 4XYBA 2NPIA 2CZGA 2HUNA 5IP5A 2QN3A 3URMA 1NQAO 1ZMOA 1U99A 1K9VF 1URPA 1VL8A 1WM1A 2B1GA 1Z0JA 1XHEA 2M98A 3EF3A 4TLEA 1Z2CA 1YL7A 2JD2A 2ZUVA 3RANA 4EMSA 4NNJA 2BGIA 3HABA 2PFGA 3TUIC 2SECE 3FSRA 2IOYA 2YW2A 4P32A 4X1KA 2VAPA 1WUTA 4YAIA 5HNKA 4RTNA 4JQZA 3L7YA 1P60A 4KYIB 4E2FA 1BEZA 4GZ3A 2UYCA 1TA0A 1ZH6A 1ZJJA 3PVCA 5EGNA 4C43A 3KHTA 1IZ8A 3RAJA 4R7GA 3ACCA 1BAPA 3D6NB 1XOIA 2OPBA 3GH3A 3QYAA 5CGQB 3UIEA 2AWOA 3C39A 3U5TA 2UZ4A 2PRIA 3PDJA 4IG4A 1NN0A 1IHPA 4MRRA 3HNRA 1CXZA 1II9A 3KOXA 2WWVD 3DZHA 4K9PA 4AO7A 1U6KA 2NO7A 2B30A 3GNQA 1QZTA 1GPWB 1C29B 3ZGVA 4E11A 4JI4B 1RZUA 4CR7A 1C7RA 3RK1A 4NAUA 5AKZA 4LKOA 4MGIR 2OXCA 1Y1TA 3R77A 4WERA 2HL6A 4UTRA 2IXDA 1N2HA 5DYIA 4PRYA 2I3BA 1I4TD 4R1MA 5F64A 4LNHA 4I6EA 3RRZA 1F5NA 4BX2A 1F8YA 2HV9A 2PSEA 3C6QA 4LZOA 4MSUA 4MCAA 2B1QA 1N2XA 3QMWA 3TEMA 1V6SA 4AX8A 1YV9A 2Z0MA 5DT2A 4ALMA 3WLFA 4G25A 4BAUA 4QUEA 2YMMA 1YBHA 3CF0A 4OA5A 2X4DA 3JARA 4X1YB 2OLJA 1E3TA 1H69A 2J7PD 3QH4A 2PYZA 3H5RA 3OFSA 3KE8A 5B7PA 4CI9A 1OIXA 2HNAA 1YJXA 2LDXA 1FCJA 2VYNA 4RK6A 5E1BA 3UV7A 1LV7A 2ZVQX 5ER6A 1GUAA 3TSYA 5CA1B 5DXAA 3CLUC 1E7YA 2IC5A 3R7NA 2PZLA 2YVLA 1A9ZA 1I4WA 2VT7A 4QNNA 4H7PA 4Y2SA 3ZD8A 3I4CA 3MTJA 1Q77A 4XA8A 4DRXB 3D6FA 5FBRB 4XGKA 4IMRA 5DULA 3HP7A 1PWZA 3H5NA 4LDRA 1L7XA 1UT8A 2BKUA 4KDCA 1Y63A 1QTIA 4BQIA 4PXSA 4KYTA 4D3XA 4NL4H 5HM8A 4CM5A 4DMHA 3SF8B 2EC5A 3PNMA 2ZUUA 2IU3A 5IS2A 2NUAA 5CK4A 2RGEA 4BE9A 4UE3S 3D7SA 1T6ZA 3VR6A 1KZ1A 2FZVA 1HKUA 2VRCD 3L7DA 4LDPA 1V47A 2H85A 2IY9A 2BFBA 2BEVB 3N8HA 4L22A 3TH5A 1T8WA 4MV4A 5CP8A 1F2UB 1GVNB 3NIBA 1FDOA 1MA3A 2B20A 3OCYA 4PZEA 2PE5A 4ZO4A 2AYXA 3VV3A 2IP1A 3JQFA 4IJUA 2EP8A 3SQOA 2QM0A 5DNEA 5JU6A 5AO9A 5JWOA 1AQYA 1AZLA 3HB0A 2FFQA 4MUYA 3P9XA 5AI9A 1CY0A 2WU4A 1M2VB 3KKQA 4CYMA 1RYNA 4Z2AA 4RS3A 4POOA 1E3QA 1ZZEA 3GEHA 1P31A 4WBSA 3S8YA 3TQRA 1OBVA 4BJ6A 1DLJA 1EK1A 4CT0A 3IPAA 1SUPA 1JE1A 1Y3AA 3FAKA 4BC0A 2CDAA 2MHCA 3JQEA 3A26A 3X2EA 1H05A 2OXIA 4DJTA 2JH9A 4AZWA 4L50A 4Q01A 3ZU5A 2C4WA 2WILA 3I92A 2J46A 2OB2A 5AHXA 4ZO6A 5K5EA 1U9YA 4GX2A 4PZCA 1M0TA 1CUFA 4NEGA 5AKIA 5DOZA 3U9SA 4XYGA 3VPHA 3AR5A 4MGYR 4UZFA 4RKRA 2B1IA 3EGCA 2AOXA 4FYJA 3TBKA 5J2UB 1E3DA 4IQ0A 4PYLA 1UAYA 1Y89A 3U60B 1EE1A 4L75A 3SS7X 3P9QA 4FYMA 5TQ0B 3WDLA 3IAS6 2QTMA 3RYFA 5BN5A 4ND2A 2E7ZA 4PR3A 5L4LA 4PO1A 3ZDZB 3N0XA 4D3DA 2CMDA 4EJMA 5C1OA 3SD7A 4S04A 2J3HA 3WXBA 4GF5A 1E3WA 2BFPA 1FS4A 1SKMA 3GBPA 5MGBA 4KGZA 3MWJA 3OSZA 2ACEA 4DIBA 3IPYA 1Q15A 2H4YA 3GPIA 3T5GA 2F3QA 2ZT5A 2ID9A 3EW7A 4TVOA 1Z4JA 2X15A 3KK0A 4D97A 1GCUA 1L5FA 1P0QA 3QQ5A 3F2VA 4NZMA 5KX5B 1UBTS 3OG9A 1STOA 4PCLA 3K2IA 4EVRA 2OFOA 4BO5A 5KTPA 4I19A 2XNSA 4XVRA 2BGUA 4EG1A 2BCEA 1W85B 1NT2A 1TJYA 2ZBEA 4P4GA 3BORA 3KJFA 2C4MA 3KVYA 4HDNA 2NYRA 4ER6A 1AG9A 3UKJA 2FSPA 2ZULA 5LWHA 1GRVA 1G5IA 1UC5B 2VHQA 4R31A 4W82A 4H35A 4HFJA 3IIEA 3RU9A 3RV4A 1ADBA 4RAQA 3WNVA 2NO6A 3AOGA 4QOFA 4G85A 4AMZA 4HNTA 3GUHA 3IURA 4BIIA 3UGJA 4ZQBA 4TWJA 1UFRA 1WUHS 3P4UA 5JNUA 5AI6A 3USZA 4EYSA 4BFUA 1SXJA 3WYAA 4GXQA 4Z8XA 1O0BA 2C4UA 1QGYA 5KSPA 3FRHA 4R2XA 5FUQA 3UOGA 1GV0A 4IMIB 1HEYA 1O97D 3LZCA 2G67A 3HJBA 3OY7A 1SU7A 4MO9A 4OB8A 3WL3A 3WBFA 1G5HA 2SKDA 3IULA 4C30A 2FZWA 3NPMA 4OQPA 5JWRA 4H31A 3OPYA 4WLEA 5EN4A 3ZS9A 1C0EA 3MJVA 4RZHA 2BHTA 3F49S 3IBTA 2VA8A 1IM8A 3LDFA 5EMKA 4BY9E 3ZI4A 5BP7A 4OJYA 3TUJC 5DM1A 4Q03A 1Z07A 5FYDA 1TPZA 3C2QA 4RTSA 5DE3A 2R751 2CJWB 2ZTUA 1XRQA 1U3GA 2WWGA 3OPMA 1W2GA 4J16A 4P36A 5G4KA 3UGKA 1MH9A 2R5WA 4PG5A 3UAVA 3ZY6A 5JZ9A 5LUBA 1PV4A 1SG0A 3BFXA 1PFYA 3RVDA 4G8CA 2ORIA 3GCZA 2FW0A 1JWBB 2AJTA 2E18A 4HTFA 1MJNA 4QLOA 2GA8A 2EP5A 2HRCA 3FTEA 3CTPA 3WX0A 1PD0A 1VMEA 1B7GO 1WRBA 2ARKA 2ODBA 4KNVA 5IXSA 5IBPA 3ZE9A 2B3TA 1PX2A 3ME5A 3T5BA 1MHPA 1REQB 2QR5A 3T15A 1U1CA 2Q3LA 3K0FB 1RBMA 3MXOA 5HEKA 3FPEA 1YS2X 2DUMA 3HYNA 3ZY4A 1EBFA 4TZKA 1VL6A 3RF7A 4QFDA 3U13A 1NMZA 1BQEA 3MWGA 2GEUA 4JC8A 4F8YA 5CCBA 1KP3A 4DXHA 3B3AA 4X20A 4PLWA 2ZROA 5AW5A 1E1LA 3RUCA 1MQAA 2C7GA 3C8DA 1JDSA 4KQMA 1K2WA 4FPXA 2HSJA 2WRZA 3V33A 1IY9A 4C0LA 1J8FA 3IKLA 1USVA 2CXPA 3IQGX 4K9MA 4NZ9A 5FI1B 1YA6A 2OHJA 4DR6B 1J8QA 2QT9A 4AKTA 4Y2XA 4IKOA 3UQZA 4DZZA 1HFKA 5LR6A 1XHFA 1Z6TA 2DGDA 2XKBA 3IODA 4JD5A 2BELA 1BCSA 4OIFA 1FYEA 2R11A 3CXUA 4W1SA 4ZAZA 2VQ6A 4DG5A 2G09A 4MYTA 3SBXA 1XRSB 1I2ZA 3TZEA 1X92A 3QKWA 5L8VA 4FLMA 2XZLA 3DFUA 1YZKA 2GOYA 2CF6A 4UTPA 1Z0ZA 2AOWA 3H83A 5FXMA 3WIOA 2Q8PA 3ND6A 5IEJA 2UVPA 1N6NA 1CLUA 1JV2B 1NDUA 3L46A 3P9KA 3IQDB 4GOMD 1QZUA 3FFTA 5ALDA 6ABPA 2BSQA 3A6EA 4B33A 4WY2A 2VDRB 4LZWA 3Q88A 4IV0A 3TIXB 1YUNA 4X94A 4TXLA 3QKTA 4ZT5A 5LD2C 4EB0A 1E7MA 2BOVA 4XFKA 5IYZF 1UADA 1EUDA 2O20A 5JI2E 1UL1X 1ZJ5A 3DMGA 3M70A 1SG6A 2XDQA 3VNQA 2QVYX 1QMGA 2OV2A 3NOXA 2WF9A 5AOVA 4OQYA 4C3OB 2VI5A 3AJ9A 3FSGA 4N5IX 5JY6A 2F4NA 1ZIYA 4F85A 3SHOA 1T2CA 2KW5A 1E2NA 2ISSD 5IAGA 1RVV1 3Q3VA 1LS6A 1O4WA 2VG8A 4J90A 3N0RA 5IKXA 1NP3A 1NLFA 3LC7O 4PHCA 4KR9A 4EA6A 5L7YA 5EE1A 3B12A 3V48A 5C18A 1BQ3A 1CIJA 1PJBA 3PPWA 2WHRA 1HPLA 4UDXX 2HMVA 4H7EA 4BRUA 3MBKA 1CD5A 2R8YA 3FN4A 2OR3A 1R6BX 2B61A 3JWHA 3DS8A 3WGTA 4B76A 2FFBA 4AZSA 2H00A 2ZTVA 1I6MA 2D8MA 4KAFA 4CQMD 4DL9A 3HK2A 2A5JA 1XEAA 4JQSA 5KYXA 1MF7A 1AV6A 4BV2A 1HE3A 1QQ6A 2GUWA 1R6AA 3JQGB 4IKEA 2PUVA 3FI0A 3QYFA 5GZ3A 2FW8A 3F6SA 2C88A 1YDGA 3E9MA 1JKJA 4LZJA 2I2WA 1IQ0A 4JC4A 4PG7A 5AOBA 1S3SA 3D4BA 5JXGA 2E3JA 1NVVR 2JEOA 1A9PA 1THMA 2XYRA 4GU5A 4ZT7A 4YRGA 4LTDA 2CLHB 5EHIA 2F3PA 3JASA 2FQWA 4L2IA 4MGEA 3F7MA 5EJ2A 4AZ3B 4B6OA 1X7GA 5K09A 4AQ7A 5HTOA 4BQPA 2O14A 3FOBA 1NJ5A 1JIIA 3I01M 3BYZA 3ILYA 3NAGA 4JJIA 1LI5A 5CVTA 3ZD7A 2MYPA 3CYFA 1G3QA 1MPTA 4RQBA 4TQAA 3TGWA 3Q9SA 1DZIA 3VKGA 4DCMA 5FTNA 1KI2A 2O0HA 1U7DA 3UOWA 2Q5CA 3UAYA 4CCAA 4YRIA 5BNTA 1KEUA 2CYCA 1PFGA 2GJKA 2ZVPX 3AEZA 3L7AA 3VMFA 4PU0A 1LBTA 3KOYA 4NU5A 2EKQA 4RENA 4YECA 2PPVA 2NTEA 5D7BA 1NU6A 1H2AS 4X95A 4B3TB 1SXJE 5B1IA 1FUUA 3LP5A 1EVZA 3UYLA 2RK4A 2TS1A 4OQNA 1YB4A 3HEAA 3JZAA 1AQJA 1P4AA 4OF4A 1WSDA 4PZUA 3PWZA 4PHFA 1W94A 1JZSA 2HK9A 1Z45A 2GK6A 3CB2A 2HK8A 3IB6A 4TT3A 1VSTA 4TWRA 3VDNB 4DV6B 3MHTA 4NBRA 3ZJTA 5KOJB 5EMJA 4RIHA 3ICOA 3LX8A 1WTAA 4EAQA 1B6GA 1VOTA 1NVUQ 4FZJA 1YI0A 3ABOB 4WZBB 3K6JA 5CFNA 4QECA 2Y66A 3WJ2A 1KK1A 1LLDA 3AIMA 3FLBA 1EHIA 1YOVB 4UBKA 1L7NA 1B3BA 3AX6A 3SYTA 3T7AA 2OBXA 4IXNA 4QDOA 4QREA 2HQBA 2RMKA 4YP6A 1VSUA 4WRRA 1S7GA 2XCLA 3U4AA 1K8XB 1OZHA 2NU9A 4GMFA 2FPMA 4KQXA 4DDVA 5AM2A 3HUFA 2I87A 1LNZA 3CEJA 4QFCA 5D84A 2ONCA 2DH5A 4B6EA 2D4AA 5JPIA 4BATA 2YX1A 4RTQA 4HDSA 4MA0A 2YYZA 2W4IA 2YJNA 1N9GB 4YCJA 4PSUA 5LA6B 4QOIA 3F9RA 4RXUA 2R8XA 1L3IA 1L4EA 3IMFA 3QKRA 2PQ0A 4ZEMA 1KOLA 1EFPB 3K20A 3UN1A 3DAPA 3GV0A 4O4LF 3MWEB 1R5NA 1SHKA 4X62B 3Q5EA 4QQNA 3PGJA 4ZRMA 2FSIA 2A5GA 2Y1EA 2L18A 1PW5A 5E3HA 1BYUA 3A3YA 1TLTA 5EXDA 3NWEA 1ZQ9A 1H94A 3L6EA 3MCWA 3H1FA 4IIGA 1D0IA 4V0LA 1D6JA 5EHQA 4ZV9A 4QEKA 1COWA 1QAQA 1X3SA 4ZDWA 1FSSA 3I34X 4RL4A 4R0VA 4RX1A 4MULA 1R00A 3IEUA 5EWLB 3LG2A 1Q7RA 2QRVA 3TLGB 1U63A 4LJRA 4MP8A 3W5DA 5DM4A 4ZYYA 3VYTB 4Y8VA 1DAGA 3G68A 4F2HA 5HM6A 2DEUA 3IO5A 1X8KA 3CPJB 1ZITA 4A0SA 2OILA 3P0RA 4RQUA 3NBQA 1ZK1A 4RE5A 1LH0A 3HO1A 3RS4A 1NXXA 1GZ3A 3AP3A 3ZPXA 3K6KA 4QO7A 2QX4A 3VU8A 1BROA 3HXOA 2PU5A 1GVHA 1DC8A 2C07A 3FFAA 4GNKA 3K0SA 4UAVA 3RM3A 4YUAA 2G72A 3HGQA 3IAHA 2NZ2A 1GUFA 2WOJA 1AV7A 3PC6A 3PCXA 3CPSA 4Y1FA 1N33B 4ZVQA 5A9RA 3JD2A 4Q4LA 4BJ5A 1H22A 1UANA 2AC7A 1Y5IA 2D1YA 4WFJA 5B53A 3ZWKA 4ZJZA 1WKCA 3QXHA 1HE5A 3PHHA 3DB1A 1M3SA 1DKLA 1PR6A 1UXOA 3JARB 2P11A 3PIIA 4NBVA 5EXXA 4NWIA 1CIPA 1KO1A 1LLQA 1ZUNA 2X6QA 4BLSA 5IBQA 1US8B 4G5QA 4OI2A 1EB8A 1U4NA 4JLDA 5KNCH 3G7UA 2E87A 2QXUA 4AQYB 3MS4A 4LCEA 2IYTA 1RSZA 5KQMA 3GL9A 2C7QA 2C7VA 2I8CA 4X7PA 3JWEA 1T8PA 2DM6A 4TVBA 2YTZA 1FTGA 1D3AA 1D1QA 1YIAA 4O4JA 1FDSA 1LWNA 1Z4IA 4JVMA 1W2HA 4DZRA 3DCJA 4M1SA 1YHYA 2FNAA 3K1AB 4AL4A 4XVUA 4I99A 1S7CA 2Q4OA 1IBCA 3QOWA 3VNSA 2VH1A 2IVZA 1AS2A 1CEXA 1E58A 3FCYA 4F8EA 1QGOA 3IP3A 3IDQA 5DCWA 3FDFA 1QB7A 3ILVA 3UB4A 4EHAA 3OQMA 4E13A 4G0VA 3ICQB 1ZNWA 2AOUA 3CBGA 3DL0A 2GTPA 1IZ0A 4FILA 4M2LA 4S24A 3CUTA 2NUAB 1JLHA 4MAMA 2MCFA 4N18A 5DX8A 4YP9A 1CJKC 4RVDA 2ZI9A 1N1MA 1BGWA 3KT8A 5T57A 4I50F 5EG5A 1ZESA 2QUHA 1E89A 1EP9A 2H1HA 3RAGA 1WW3A 4E5KA 2BFBB 5A6VA 1C9YA 3G49A 1RQ7A 3ORYA 2QUAA 1UDCA 4B9AA 5CB8A 1XDGA 3TJMA 2NU7B 5IYZA 4ZAWA 4J6EA 3WNBA 5AK0A 3BA1A 1KYQA 1EGQA 3PD1A 2WJVA 2ZRAA 1FUIA 3CJRA 4P0TA 3RUIA 1W52X 3RU3A 4P3XA 2AHOA 4TS1A 2VAMA 3VO1A 3QKSB 1EM8A 4KQ6A 2ZI5A 1N7HA 4RVFA 3ZNNA 4E94A 2H4FA 3ZIAD 5L3QB 3D64A 3BJIC 3LP6A 3L8DA 5MDHA 2CVPA 3E2PA 1CS0A 4EM6A 5JAQA 4EHFA 4ZIRB 3QEBZ 1YI1A 4EY8A 4S2EA 3KFVA 2O59A 1CY1A 4TGLA 3GFTA 5ALMA 1TCBA 3QI7A 3BCRA 5HF5A 3SICE 2XCRB 5BQXA 2M32A 2X42A 3V4FA 4AZ0B 1SKUA 4TMYA 1HKHA 2W6JA 4OHCA 1M1UA 5BMVF 2O8VA 2Q3CA 4YMLA 1DPGA 3DNMA 3KL4A 4TTQA 1CYDA 1R5BA 3ANSA 1RW4A 4E51A 2Z6UA 2ZTMA 2CEKA 1R4MA 2B9EA 3WLEA 3ADBA 2FMIA 5T3UA 5JMWA 3DEFA 2G07A 2FLVA 4LRSB 5F5XA 3ZCRA 3EPRA 4H2DA 5D85A 1EPUA 5EUBA 1P75A 2UUOA 4DLUA 4CV2A 1ESZA 1ZH0A 3A06A 5C4IA 4XVQA 1AM4D 5H70A 2G9ZA 2XZPA 4QHYA 3WHPA 3WWPA 5KSOA 4GXTA 4RHCA 1ES9A 1GGMA 3SDSA 4JUDX 5KYUA 4NX2A 1PVDA 2BKXA 2Z83A 2BBSA 3ND7A 2M6LA 2ZQ5A 1CY6A 5JANA 5CT6A 3JD0A 3DKRA 4FCWA 4N3AA 4LTMA 4ZGWA 3DAHA 2D54A 3OZXA 1QYRA 1I9CA 2C4TA 2R7KA 2XE4A 3B3GA 4RABA 4FZVA 1GYRA 1JVSA 1QH8A 3BM5A 4IFTA 5E0KB 5EXSA 5HQTA 5BUQA 5K0FA 2DFVA 5J4LA 1GEEA 3IA7A 4HF7A 2BGMA 4I3FA 3NH6A 4NZZA 1HSZA 1NW6A 3CNLA 4WA7A 1CR0A 2TRSB 2WT9A 5COQA 4OGGA 1F0YA 2X8JA 2PS9A 4HNGA 2HWKA 1CVIA 4TLCA 4ZA2A 4K1LA 4DCSA 3Q9UA 5D7NA 3OEED 3TZHA 3EZXA 7ABPA 1EDBA 2QRLA 5EE3A 2ZRDA 1ZSVA 4KGDA 4RM3A 2GRUA 4YJ2F 5ALZA 3F6BX 4G97A 1Z5GA 3LKVA 1E1DA 4WESA 2HIMA 1W1UA 1YQUA 3L1JA 5C7YA 3PSHA 1NBWB 1MMFB 4XM2A 3HWX1 1A4XA 3RUAA 5IVDA 2F8SA 3EGOA 3LT5A 2G5PA 4P35A 4A3SA 2F55A 2BFDA 1QIMA 2JJ1A 3DVLA 3UHJA 4EPYA 3GQBA 1AO3A 3P2MA 1N2CA 4OXNA 1FNNA 1MABB 3RFCA 1U2ZA 2JVIA 4Q3EA 2EJBA 2PYIA 3SP1A 4D8VA 2UUCB 1KIAA 1DDOA 2PKYX 3OPYB 3CRMA 3K0AA 2FMXA 3E4CA 4KWEA 1B8OA 4PYIA 2CXQA 1OSNA 4AJEA 3BXPA 1AJEA 1LI7A 1TU3A 3COSA 1QIEA 3C3YA 4YGYA 3ZW7A 4O6VA 5K99A 2W8BA 1XNRB 2ZIAA 2RHMA 2RSLA 2VWHA 1F1BA 1EFUA 1YRQA 4KFUA 2HF9A 3ADDA 5FTLA 1SCUA 3ZCSA 1XA0A 8ADHA 2ZJ5A 1A97A 3C1UA 3E2IA 5F1OA 1WCYA 5KPDA 2I91A 2X9NA 1LLUA 1QX4A 2UKDA 4L0DA 4YAOA 1A04A 2QMZA 3K96A 3MG9A 4JLKA 4GPTA 1GZ4A 2EX4A 3H5IA 5SY6A 2H1OA 1HTWA 3LQ4A 1H6AA 3NP9A 4DWJA 3HCRA 1XZAA 1WDTA 2CVHA 3NO4A 2XUQA 1IDOA 2YRXA 1RXVA 1RHQA 1V0JA 1KJIA 3M6LA 4KC0A 2IXTA 1AURA 2ZRBA 2XITA 3E9RA 3T3DA 1EX9A 2PQ6A 3UWKA 3T1HB 2I2FA 4ZTZB 1FUEA 2VHEA 1GN8A 1LFAA 1ZLYA 1NRWA 2XW6A 3LLMA 1RWMA 3I37X 4H7DA 5C7OO 5HW0A 3EN0A 4GBED 2H7YA 1F20A 4WVFA 2UZIR 3KHUA 2YWFA 1N9ZA 4QOEA 3QJ5A 3UQYS 3WISA 4BN4A 2NO9A 1R8XA 1UKYA 2XUAA 1XGKA 2GCNA 1Z88A 3GRZA 4G5FA 3EWSA 4TZTA 3SIPA 1SUBA 3NHFA 4BMDA 4LZZA 4CMIB 1PR0A 2FMHA 2H17A 2W7TA 1XVUA 3A7DA 1U3FA 2DJ5A 2PL5A 3BRWA 3BXXA 2ZVDA 4E07A 5CG1A 4DJ5X 4MDYA 4N8DA 1FVOA 4ZVPA 1SBHA 1O89A 5IT0A 4WUVA 3LA6A 3EK2A 3ECCA 4Q48A 4UNQA 3TEFA 1E2KA 5HKBA 3T3MB 3GJSA 5CCEA 3K73O 2BR5A 2VJBA 2FY8A 3BTUA 4IJQA 4Q1FA 3T5TA 4YCSA 3D5EA 2XNKA 3HRKA 3B78A 3NXSA 5BSTA 3D7MA 4D1YA 3CNHA 1B42A 2BL4A 4UBLA 4XARA 1F6BA 3KETA 3S7TA 4FB5A 4JI2B 5KNLA 3OJCA 3UUEA 3KQYA 4WD3A 3FI9A 1N5LA 4HWSA 4TYQA 3K9BA 4BO2A 3LW8A 3KB6A 2AFIE 3RRMA 1ECLA 4U1RA 3T7CA 5F7XA 4UM9D 5HDBB 3KOUA 2VEDA 3A2LA 4F60A 3CUVA 4TLLB 4FJ1A 4TKUB 4LV8B 1OB5A 2P9JA 3LO5A 2H8KA 3D0QA 3IILA 4B82A 1QDLB 1ECCA 3OESA 3OQJA 4UHJA 3UV6A 1YFLA 2D13A 1L1QA 2P67A 1DEHA 4Z0PA 4YCNA 2W5UA 3PPVA 4GKJB 1OXTA 3O26A 1EUDB 1XROA 3GOHA 3I42A 5E6SB 3Q11A 1VCIA 1YB6A 3A4YA 3E3MA 4DLBA 1SXIA 2P7HA 1B2LA 1UDAA 2X1MA 4RIIA 2I9KA 3NGXA 4WNAA 3PUYA 5FPHA 3RK0A 1CUIA 1Q83A 3B9QA 3HP4A 5C8VA 1YRBA 1GL9B 4XXHA 4A15A 1A8PA 1UMBA 1YZYA 4AP9A 1X7WA 2RH4A 2B98A 1Z36A 2VHWA 5K3CA 4EYQA 1RXEA 2WMOB 1PJ3A 3MGBA 2A9FA 5LLDA 2Y6UA 3KQOA 5REQA 2GNAA 1RPAA 3KXDA 1F5SA 3SSNA 4HO1X 4K6KA 1GTMA 1XR3A 2D2EA 1NONA 3C7TA 3KU4A 3KKNA 1SUSA 3R6WA 4JYCA 4R71A 1U7UA 2G76A 4RS4A 5H5JA 1QF6A 4DQDA 3IHLA 1MEEA 1O8CA 3PG5A 1E9RA 1RRPA 3EXHB 2EFDB 5JDCC 2D5LA 3UKDA 4HVLA 5KWIA 1K5HA 3KSRA 2IHZA 5I8ZA 3J81k 1T5IA 3D81A 3R8CA 4RJ2A 1J97A 3ZGZA 3GGPA 2V55B 1XB2A 1G0OA 3PC8C 2X5XA 3C15C 4ARZB 4NYJQ 4KMMA 4H27A 3CXRA 3BWCA 3JQDA 4KG7A 3VU0A 4V3BA 2AD5A 2VL7A 1R4ZA 3AEXA 3PGXA 4L2IB 4TMZA 4BB0A 4JB2A 5K8VA 5K8IA 3EIEA 4MQEA 1I6KA 1YL5A 1SD2A 2JW5A 2XF2A 1RCTE 1KMIY 4B35A 4E5VA 2REOA 3TIGA 3BBPA 1G6Q1 1AHIA 5KINB 1PU2A 3A6LA 1GGEA 1NJ6A 2JC3A 5D87A 4ZT6A 3GRRA 3PDHA 4P5EA 5IC5A 2FUNB 1X1AA 3BFKA 3MD0A 1EQ2A 4KTTE 2TMYA 1ZC4A 5IJWA 3BJZA 5EQJB 2QVGA 3KKEA 4B3MB 3JATB 4KQFA 2DUWA 2YFHA 2HBZA 2RH8A 3AZOA 4JMLA 4K40A 3IJRA 2IDZA 1S89A 1U8ZA 1SC1A 2VK4A 4JK3A 4V38A 5EKDA 5J5CA 3U31A 3ZG6A 4BNTA 1TIKA 4E88A 3P20A 1KYTA 3W5JA 1PV1A 4BLWA 5KTMA 1K6JA 4K0RA 3AW9A 3TEJA 4AJKA 3IRUA 4RKEA 4QM7A 5AD1A 3EW9A 5JI3E 5CW2A 3KCNA 4Y2TA 1VSVA 4E1VA 1SC6A 4JXZA 1WZUA 1E3IA 5A3RA 1FUYB 2P2GA 1KYYA 3LJKA 4IL5A 4L5JA 3Q72A 1HT2E 3V4SA 4MRVA 4KVFA 2WVGA 1KI8A 2XMCA 2OWEA 1BJRE 2P9TA 3V42A 2NQ8A 1NX6A 4LYGA 4R2MA 1E3EA 4L9SA 4ML3A 5C5IA 4V1CB 2JI4A 2VSYA 4EFNA 1U0TA 1HORA 2FMFA 3ZBQA 4KMSA 3O1HB 1JKFA 2ECPA 2YDXA 3CSUA 4IIVA 3NYIA 4LX8A 5DHAA 5JJKA 3IR7A 3WV5A 4R6WA 1CFZA 3A25A 1GU7A 3L0IB 1GZ7A 4L9WA 3UWOA 1O77A 2IYXA 3L7CA 4ZPJA 4EENA 3SJUA 1L5SA 3CW2A 3IMKA 5J1SB 1QP0A 1SZCA 3LHSA 4XE5A 2HW8A 1Y5LA 3GLGE 1V43A 4N5NA 1G3UA 5TRTA 3M3DA 3VC3A 1E0AA 3V9AA 1RP7A 2A1TS 1EXNA 3AQIA 5KC9A 4GRIA 3CURA 3IDSA 4LOLA 3QKRB 2GLXA 1PJCA 2P1DA 2AH5A 4UOQA 1OX6A 2O4CA 1KARA 1DZ3A 4H0FA 3R5SA 4X1KB 4Y1EA 3IDZA 4X9XA 3ZJYA 5JNTA 4OBEA 3DKPA 1NBMD 2B83A 3BBLA 3ANTA 1QVZA 3EISA 4MKXA 4DLAA 4WBNA 3H5WA 2TYSB 4GZLA 3TZKA 2A88A 1PZFA 3QIAA 1L4YA 4BKMA 3S1SA 1FFCA 1BMFA 9ABPA 3DUFB 4GNRA 3ZWQA 5I7HA 5C51B 1P0CA 3DWGA 2R66A 1G63A 4NBSA 1U1GA 2NV6A 4NENA 3BFVA 4EELA 4ZJPA 2CC2A 4KTVE 1XTTA 3K1YA 5A4FS 3HNPA 4HP8A 2GQ0A 1GZ6A 2P40A 1MU0A 2H5JA 2HCFA 2WSSA 3F71A 3QVXA 1V5IA 3LOQA 4PN3A 4K7JA 2ADMA 2G0TA 3VR4H 5AW9A 3VR5D 1GIAA 2QRVB 4EKDA 3SZMA 4ZDJA 3A1FA 4DLLA 5KQPA 2O3SA 1C8BA 5BVHA 3D4NA 3B6IA 1TCUA 3QXXA 1Z0SA 3R7SA 4G0ZA 1X6VA 1NI5A 2JGLA 2J85A 1WXHA 1NXSA 1G2PA 2OLKA 4YN3A 1DT3A 2HPZA 1KYXA 3DZFA 5TEWA 1EP1B 1LB1B 2CYAA 2I8LA 3DEIA 5KDOA 5FHRA 1XJ0A 4GDFA 5KS2A 3MTAA 4N5LA 1T0BA 4CKCB 2XIJA 2EEPA 1F0KA 5KQGA 1UR5A 1QQ7A 3D4IA 4J75A 5CFOA 1X42A 3UMBA 1FTSA 1NSFA 4U00A 2CW5A 2QJRA 2OZLA 3QWFA 3UT5B 3DDWA 5DTMA 2XMZA 3EQZA 3L06A 4JLOA 5H1YA 3AIIA 4X6YA 4URFA 1C9KA 2IBMA 4UW9A 4MZXA 3RVLA 4B4KA 5JC1A 3HGMA 1IG3A 3B38A 2VNAA 4PQEA 3U56A 2QV0A 1FXSA 4ZQCB 1XPOA 1NAHA 3N2NA 4JLJA 1X9IA 2IV7A 2GJ4A 1ZUNB 3U3OA 3LNCA 3FZNA 3CVYA 3E8XA 5IM4A 3QVWA 3L5KA 4ENVA 3QK7A 3P94A 3LW7A 2O23A 2IODA 1RWOA 3PHBE 4GKVA 2LDBA 3WY9A 3GJYA 4Y9DA 2FZ4A 4GI7A 2CBGA 1XI2A 3QU9A 3RGWS 2X9QA 1J1IA 4QDZA 4O2LA 5B6JA 2QG6A 4QFMA 3R75A 3RC9A 1QUFA 1G1MA 1E2MA 1Q11A 5TGDA 3ULKA 3P0IA 4G65A 4A6EA 3EC7A 4UHFA 1A9SA 3BK2A 3LHDA 4LRUA 1JQBA 4NQRA 5HMLA 2G7ZA 3QF7A 2YWCA 5JSQA 4HNAA 3O31A 4IVQA 4B09A 3AF1A 4RPIA 4UVDA 4ZCQA 4AKSA 1AVTA 1H2WA 1LSSA 2A9PA 2FF7A 4HGRA 4HUQA 3GR6A 4OXIA 4Y1GA 1WLYA 2WNIA 3WFZA 4BVKA 1JW9B 4I8IA 3HS3A 2WT4A 2AXPA 4MEBA 5ALYA 5AOCA 2QTFA 1SIBE 2D0OB 4JT2A 4CUZA 1DKRA 1PS8A 1FLAA 1TYEB 3GUZA 1L5GB 4JZKA 1CNEA 4H77A 1P1FA 2K87A 4YUVA 2AFIB 2NTNA 5JSZB 2WKQA 5DM2A 2RGRA 4BVLA 2OFWA 1PSZA 2ZJOA 4B47A 2QMUA 3CCFA 1N7GA 3HXQA 3BWXA 3OE5A 4IXTA 5LMNB 4LNUA 5IYZB 2IPAB 2CNWD 4YBZA 2G5TA 2O8DA 1V6AA 4UEKA 2PLAA 4QEZA 4DDWA 2AJLI 4Y0VA 3VHXB 5EUCA 2QLBA 1TRKA 2UV8A 4JJFA 4R7TA 1Z6GA 1AA9A 4KLZA 1CDOA 4O2BF 1QNLA 3P2YA 4CODB 5TIIA 2B4RO 1E6MA 3LSYA 1KDZA 1CS0B 4UMDA 5JISA 1K2VN 5A9TA 5LDDC 1V4VA 1OILA 2WNSA 3FFXA 3L0SA 3P32A 2MYUA 4LDAA 4LHVA 3RGGA 4F4JA 5CCXA 5I4CA 1XTIA 1WZIA 2QU8A 3BUSA 1NKVA 2ZJ1A 1XJCA 2JASA 2XECA 2ENUA 3JZMA 4PV7A 1A2QA 1LDBA 2OOKA 2Q2VA 3CQ9A 2AX3A 3KE9A 3T0FA 4DMLA 1JB1A 2A2ZA 5IH7A 5HBRA 1Y4UA 3D8SA 1J1UA 4CMCA 3RIGA 5TEVA 2YWHA 1P2UA 2PIDA 1QIJA 2JKVA 1KOJA 4XYLA 3UWPA 3AHGA 3N86A 4CQLA 4CM4B 2XB2A 2EG9A 1G8YA 3KFLA 3ADOA 1KYVA 4RK5A 1H23A 1IAQA 2W4QA 3P1JA 3KQPA 4OVKA 2CCJA 1T8YA 1TW3A 3IEIA 4M1MA 3K30A 4RD0A 1P7WA 1ZIPA 3C6MA 3DGFC 3KLOA 4TTPA 4OXQA 3KKZA 3SHFA 4YROA 2FMKA 3H2KA 3AL2A 3HTXA 3PNSA 3HA3A 4KXFB 4R9SA 4RLFA 4QJIA 4RJKA 4WZAB 4BNXA 2VRBA 3H3FA 4PG8A 5EIWA 1I30A 1YJQA 4Q9IA 3DDCA 4R1TA 3GA7A 5AH0A 2KM1A 2O57A 2PQ2A 5DEOA 3RNLA 3SKYA 2PMBA 4Y2YA 4B8YA 2G28A 1Q95A 2QPLA 1QPBA 4JU9A 4REOA 4LRYA 1M7BA 1M2FA 4PYJA 5BPFA 5KOYA 1XE3A 2A33A 4I5EA 5DP1A 1W19A 3GB9A 1ISIA 2Y93A 3PQ2A 4TXMA 3W79A 4QVGA 1IC6A 2CXHA 5J47A 2VH5R 3I5MA 4H3SA 3D1LA 1AGXA 1IZ9A 1G21A 2C84A 4I9GA 5BOSB 1MB9A 1UDRA 2A1IA 5AI5A 4CMAA 4DCTA 3TFOA 3QHAA 2X8JB 2Y71A 2VAWA 1CZKA 2XVAA 3B3QA 3NIGB 4HFNA 4OQLA 5HQJA 1AMOA 5ICGA 5IK2D 2YUTA 3H3XA 4P08A 5DLPA 1I6WA 2K2WA 3A4MA 4KIGA 4XUDA 5DTIA 1JH8A 1MOZA 1ZICA 5B1YA 1D07A 2Q2QA 1FU7A 1YVDA 4YJ3F 3I8OA 2DQYA 2OHVA 4AO8A 1J24A 2FKNA 3FJYA 2JA2A 1J6UA 2BFOA 1KZ9A 1IM5A 2VK2A 3OE1A 4XX0A 4ZWNA 1H2HA 2NSYA 4NP6A 1E1KA 1WBDA 4TV9F 1QH1B 2BFDB 1U7ZA 3AR8A 2P4QA 2G6BA 1DARA 1TECE 2GPSA 4E7OA 4C6TB 4EP1A 2J3QA 1H1DA 4KXQA 1GTSA 3C16C 3SX2A 1GCIA 1DRVA 1WMEA 3DE1X 1Z7GA 1TMGE 2ACKA 4K6FA 4LSMA 4E21A 4Q9NA 2DT5A 2HU7A 2QNIA 3C7CB 4LZAA 4AVYA 1E9BA 1D0VA 4GZ6A 2QJTA 3SZOA 3WQHA 4AJ9A 3BDAA 3MWDB 3WTCA 3E84A 3WV4A 3I12A 3ANYB 3S68A 1OC2A 1ZISA 3R5HA 4XWWA 4F3NA 4AWXA 1YVUA 2I78A 1Z4PX 1Z37A 2QUIA 3L6BA 4XDZA 1D7OA 2QQGA 3AF4A 2Q7DA 2NO1A 2AC4A 5KWSA 2Y99A 4YMUA 3GLGB 1ENPA 3JYNA 4S2UA 1PNRA 1QIKA 3G82C 2ZYGA 1DNPA 1YS6A 3T4XA 2OG1A 4X6LA 1NW5A 4G24A 2COKA 4QYWA 5C1DA 4GM1A 1J8MF 2C98A 2PMFA 1DOHA 3MPUA 5CPFA 3HSSA 4GSYA 3R0VA 2CBZA 1AS0A 1ZK3A 2JAOA 1YA8A 2C7BA 1XF1A 3HACA 2WFAA 4PFQA 1PS0A 3RS8A 3F7OA 1WW2A 1J20A 5F7ZA 4RCVA 3WB1A 3KHSA 4CKZA 2PL1A 3SWWA 2FWAA 3OCJA 5GV8A 3VJRA 1H66A 3BXOA 1T9CA 4LUCA 4ZAYA 3G79A 2HK7A 4PHGA 2TMGA 4OM8A 3L6OO 1GY8A 1U2RA 4HGOA 5F2OA 3AFNA 3BSFA 3EUAA 3HFRA 3JSAA 3ZYCA 4GPD1 3VOTA 2JCVA 2XV1A 4CG2A 1N5OX 2AFHA 4EGCB 5IJ9B 3EEYA 2XWSA 3ITNA 2WKWA 1T36A 1AKUA 5MHTA 4O1IA 1ZVQA 3A37A 1OY1A 4EPRA 1GM5A 2H3EA 4BDTA 1AUVA 1FP4A 1XRJA 2A0XA 5A4DA 4IFIA 4FKMA 3SYRA 3FCSB 4B73A 2JDID 5JAPA 3JYHA 3FHLA 1W5BA 2P2SA 2R44A 3LUAA 4KUGA 1YDEA 4QOSA 4W7SA 3GXOA 4K9OA 2R48A 3CNNA 5TXGA 3ICCA 3ROQA 3RS5A 1YR6A 1ZMTA 5J4KA 1Q7BA 4U7GA 1MJGA 3VZCA 1D09A 1NVMB 1U1FA 3EVCA 4D2IA 1BWQA 2WQZA 5A4IS 3M1YA 4ZOAA 4M9XA 2C2MA 2RH9B 2FFRA 4IIXA 3DDNA 4OAPA 1M2OA 1Y33E 3PDIA 3E48A 4EG0A 3MHPA 5CAEB 2IH4A 4RVSA 2HIAA 3FGOA 4YDHB 3ETGA 1FQKA 1RJEA 3BXEA 4IQ8A 3ZE0B 1ZGAA 2JH3A 3ZX5A 1NDQA 3MJDA 5BV8A 5AW1A 4LYHA 1SQ0A 2W2OA 1ULSA 2J07A 2ZS9A 3EGXA 3L0BA 3MFYA 1ESDA 3AR6A 3PU6A 4PLCA 2ZTSA 3TSOA 4BMPB 4BRWA 3WMFA 2QTLA 3P9ZA 3K8ZA 4QGFA 5ALEA 1GR0A 4F3KA 3EOZA 3VJKA 1O2DA 2V7EA 1CF4A 3E22A 4Z51A 3LC2O 4OJTA 2XCIA 4BWYA 1Z2NX 1JDBB 2Z2ZA 3CCBA 1G60A 4RF2A 1UMBB 1SBZA 2FUG1 3CH4B 2X4IA 2NU8A 4OHUA 2Q50A 3DCIA 3F5QA 3TTUA 3UPUA 4LQDA 2C9DA 1X7ZB 1RMQA 3SHVA 3DHVA 2NO4A 1XTBA 4AROA 5KOHA 5JFTA 3FM9A 3KTAA 1JRLA 3HEMA 3KDSE 1M0WA 4FGUA 4OIMA 5FQNA 2HM7A 2QOEA 1RYZA 1WL8A 3FVWA 1YR2A 3STUA 1OCEA 1BWSA 1R0XA 5DB4A 4MS4B 2GPJA 4MQBA 4UMVA 4CM7A 1NLYA 1IXZA 4XD7D 3O4IA 1WDLA 2WD8A 4FE4A 5HCNA 2I03A 3UMCA 3FYCA 1KPIA 1N8NA 1QKJA 2P1RA 2ZJ6A 4A92A 4MRMA 3SEAA 3D3NA 3JZDA 2XTAA 4I50B 3W3AA 1PJSA 4BKPA 3LYHA 4OHKA 4JOBA 2ODWA 2G36A 1RI1A 4HLNA 3SIXA 4RA9A 5AXAA 4DSOA 4EATA 1VRVA 4OHZA 1KC1A 1DO2A 4M8SA 5JALA 1SVMA 5L95A 3WL4A 3MTGA 8ABPA 3OFJA 4ZD6A 5L4NA 4O4IA 1GTVA 3TO5A 1W25A 2X6TA 2Z5FA 1W5EA 5ALNA 3LVQE 2OK7A 2H2HA 1XZJA 3LT0A 4OUKX 2X4LA 3D0KA 4DMFA 3PWKA 2V74B 2WU0A 2FZLA 2ZAGA 1Q19A 2ZI7A 1I7SB 1G21E 3ORFA 2YH2A 1E9EA 4P0PB 2H4JA 3VC1A 2OQ2A 4KQGA 2QD4A 1RM5A 3QPCA 4HQNA 3UJPA 3NHLA 3CR7A 2IPXA 1L4HA 4BP1A 1WKVA 4TTVA 1O96A 4IIJF 3MJ4A 3EVZA 3O3OB 1JPJA 5FBWB 5ANRB 3PZRA 4OI0A 2PUHA 1RC1A 5DLYA 4AWBA 5JXIA 5BMVB 3ZZ1A 1KDYA 2QTCA 5C8XA 1AUQA 1KHHA 3QWHA 1R64A 1C8KA 4KLNA 3AVXA 1NNSA 4IW3B 3BJRA 1K66A 3FYUC 3KWJA 3ROMA 4BFXA 5HKKD 3N2GA 3E1KA 2VRCA 4N8SA 5LQCA 4WXPA 3STTA 2CLIB 3O2JA 2B34A 1LW7A 5ADUS 1JU4A 1XC7A 2KQUA 4K05A 4XIIA 4AX4A 5KNDA 1I3CA 4AJJA 4IH4A 3ZCQA 2BMJA 2DQZA 3TSZA 4DCGA 2IYUA 1L7MA 1IPHA 2CN1A 2IYAA 3HYCA 1RWPA 2O8EB 3WLMA 3KKMA 4MAAA 4RK4A 4B75A 1YR3A 3OOSA 4QQFA 2YDYA 1IB6A 1NMYA 4DE5A 4CNBA 1GLGA 5GQSA 1QGED 4ZPXA 4FCVA 3I58A 2HCJB 1ZEJA 1CY2A 4JT4A 4PS1A 4ZYXA 1IN6A 1FU8A 1Z7EA 4F45A 5EZSA 4C7JA 1W1IA 1X80A 3E5NA 3UBTA 3X0DA 2CNNA 2WJGA 4LA4A 4ACAA 5JEEA 1XZKA 4UHEA 4XIGS 5CYFA 1TZBA 5LU8A 1MW8X 3CMCO 2AKAB 3AHCA 3NBXX 1LVUA 4RMHA 3W9YA 4CM8B 3F8SA 1JG2A 3GFFA 3O83A 1B00A 2GMWA 3SE7A 3A4IA 4YXWD 1A1SA 1VIVA 2PRSA 4PTYA 3RSSA 3UMVA 4IPTA 4TMFA 1T0JB 2F59A 1U2TA 1CZRA 1W35A 2I67A 3H6HA 3AKEA 1UKAA 3IDFA 3GZNB 4GBMA 4QPNA 2AQKA 2LBPA 1D4OA 2I6XA 2AA3A 3DG9A 5D01A 3O3CA 5G0TA 4D44A 1TJNA 4DZTA 3RWBA 2K5UA 1SH7A 5FLYA 4DA0A 4DT1B 2FWRA 1WW8A 1TADA 4LJAA 4WWHA 3DPSA 4RJJA 3K5HA 2XODA 3B70A 4IUBS 4A8JB 2Z6VA 4DMRA 1R0YA 4QBTA 2AFHE 1U2QA 4ZI7A 2BZ1A 1W49A 2OYRA 3F74A 5F2EA 4P8RA 3BIXA 1DBQA 4C6SA 1GYPA 1I13A 2X7HA 3DWIA 1CS4C 1IHXA 1PSWA 4X7BA 1NVXQ 3FUUA 4B4WA 4B44A 1G9XA 2NTYC 2Y1DA 4LMAA 4NK5A 3AOEC 2OLEA 4JJZA 3ANMA 9LDBA 4J43A 4LWPA 1G64A 4O8CA 3E3NA 1WDMA 4Z3OA 4GGMX 5J63A 3IBFA 3DVRX 1SKQA 2GBPA 1E2QA 2BONA 2Q5IA 3OCVA 1M1NA 3WGUA 1RJFA 4MMXB 1OZFA 1Z6QA 1W4ZA 4RIGA 5B7GA 2F1KA 2FOIA 2FA9A 3RHTA 5LZ7A 3RIYA 3ZCPA 3HDGA 4RMJA 4FOOA 5DN9A 4GQAA 5KZMB 5ILOA 3IAUA 4LVCA 5EJ9A 1AZSC 2AQHA 3D3WA 1UFKA 1TM2A 5JDCA 2B4TO 5I9SA 4AJ2A 4WOCA 1K8RA 3VPGA 1JFTA 1Y6ZA 3BGVA 4PGAA 4DCJA 4QBFA 3R6LA 4WBXC 5JV5A 1CR1A 1JLMA 1JYEA 1RABA 2J45A 3FDZA 4JJEA 2Z3WA 1X7YB 2HQOA 3PC8A 4WOJA 1XQXA 4RGYA 3SHTA 1YH3A 1U7XA 2PR2A 3GLQA 3G3EA 2L69A 4MHSA 4EHDA 2C95A 1XYGA 4KH0A 1XCLA 3F1KA 5JW6A 1CRLA 1P61B 3V8QA 1O9GA 4I6GA 3JQAD 3MD9A 1ZCJA 1W36B 2GZ1A 3RTAA 2FEXA 3EDOA 4I5IA 5DBGA 3DL7A 2PKCA 3HCWA 5BSUA 4CLOB 2D3TA 2C5AA 1PZXA 2E5WA 2XNDD 5CNKA 1JPUA 3E1SA 2QR3A 1ZAKA 2VTKA 5ALTA 4MV7A 1H85A 3GPCA 5IG2A 3PA6A 4HFRA 4IIYA 2PD6A 3LZ6A 3VMMA 1CT9A 1YIDA 3LYAA 4BVJA 4CR8A 1QORA 1NMXA 2ID8A 2W22A 3CJTA 3LTEA 4MWBA 3I52A 5K3FB 3EIWA 1U8AA 3FYHA 5H82A 1P17A 4OK5A 3L84A 1U8TA 4OI1A 2VJCA 4D4HA 3BK7A 1B41A 4FLFA 4W9RA 3IQIX 3GFBA 4HNAB 4L5YA 3VX3A 1V3VA 1AN0A 1NW7A 2VP3A 1FP7A 1V16A 5KIAA 2Z57A 4K26A 1QYWA 3L0OA 3QTBA 8LDHA 4MUKA 5AXBA 1DX6A 2OZPA 2PGAA 3PJFA 1YQEA 2QTAA 4GPBA 4Z99A 5E2IA 1DOZA 2NO5A 2PM8A 4UMFA 1OIVA 4QPZA 1EFKA 2W6MA 2YINC 1W0CA 4K6HA 4N3BA 2P9QA 4KLRA 1GPLA 2I3DA 2PMDA 2CXUA 3B3JA 4HPWA 1EP2B 3VAAA 1MAVA 2BMEA 5K1ZA 5AVRA 1VA5A 5HJ7A 1AD2A 2ZR0A 3CN7A 4M9UA 5I51A 3JWPA 5EKSA 1P5HA 1NN5A 1EXWA 1WCIA 2OFXA 1N34B 2O8DB 1T6XA 2BEKA 1GHTA 2NUPA 1GZVA 4PQRA 1WQ1R 1N75A 2A5FA 4TSKA 5EVCA 3TBFA 1MPXA 1Z2OX 1LW6E 2E85A 5F77A 3BCSA 4EFMA 1KWGA 3U44A 3EYAA 1OLXA 2H7CA 4GRDA 3L8EA 1JZQA 1L8AA 1IJKA 3W2IA 2ZSHA 1Y9ZA 4ZVKA 4AZVA 1VGRA 1HYGA 1P1JA 3TNYA 4ZOQI 2GF9A 1L8QA 5CM2Z 2GBLC 2QL6A 4MGHA 1XZPA 5AHOA 3P9NA 3ZHCA 2OTCA 1CF2O 1P6QA 5AUOB 2BEWB 2JVJA 2YN2A 4P0QB 3O3NB 4FCTA 1GPBA 3TAHA 4B3FX 2GARA 3U7QB 3PIRA 1AXGA 2QW8A 4NCAA 4PAQA 5NLLA 2PWBA 1W30A 5TF0A 2YOHA 3LP8A 3PEVA 3UMFA 2C03A 2C4VA 3VAYA 121PA 5AK5A 3OWHA 3WMWA 1PN3A 4AMUA 2C2XA 4MQFA 1R0BA 3WVNA 3LC0A 4CQLB 2YVKA 3ETNA 5BNWA 2HD4A 1ZOSA 3L9WA 3PA8A 4ZOLA 3O2QB 3RUHA 1LPAB 1GILA 1ZLXA 1I6LA 1ZXXA 4B3DA 5A2GA 3WGMA 1NG9A 4XLLA 3S5UA 4WCFB 3K6SA 1F38A 2GILA 3GRAA 1AX9A 2NT4A 4IR7A 4HWPA 1DXYA 1A8UA 2WYUA 2R60A 3JYPA 1DKQA 3W8EA 1L4LA 4CF6A 3ORHA 2OCGA 2QEQA 4HLQB 4OOFA 1SVLA 4FMDF 2BEUB 2QY6A 3R5TA 4EFDA 2VF7A 1GPUA 4QYXA 3VU3A 2HA0A 3H65A 1XJ5A 3INRA 3LI2A 3RSOA 4CUKA 4P4SB 3ZQ6A 3KYCA 4ER3A 5IX8A 4I1PA 2GPAA 1WPGA 3MJFA 4F71A 4L0MA 2J48A 2JBAA 3PDUA 1S01A 3BJEA 3FOWA 4IOMA 1CNFA 1VE1A 3EVTA 3URKA 3IC5A 1SQGA 1G21B 2G9QA 3PFBA 4OQ4A 5G0VA 2V5VA 5AM4A 4M7OA 1SCDA 5DX1A 1V3TA 3U17A 1Q0HA 3OZUA 3TW6A 4CQMA 4EBFA 2EV9A 1TYZA 4CLRB 2G5GX 2W83A 1A98A 4JQOA 3N8NA 2QZ4A 1U8EA 4RF3A 3SLRA 3CGGA 2Q9BA 1KWKA 2QSUA 1G8HA 2BFEB 3KT3A 3OF5A 4U39A 2NLOA 4X54A 4X8MA 4HY3A 3PQ4A 3TD2A 4A5OA 2Z2XA 1C3JA 1LPPA 1X38A 3ZUGA 3AVTA 1D7AA 4W5RA 1I80A 4YLGA 4IVPA 5D00A 2P4UA 1ZRSA 5CIYA 1S8AA 1RPZA 4TXHA 1X70A 1MQ8B 4QTUB 4CIAA 5KTNA 3OCZA 4PM4A 2ZRIA 1G8AA 1EX6A 2IK8A 2J33A 2ZUTA 5KJ6A 3DDSA 4Y7DA 3DL2A 3KEQA 2VXYA 2NPOA 3WKBA 3MRSA 1BOOA 1EA5A 3E6AA 3C3PA 3EDRA 1JF8A 1FNDA 1IN7A 2GUGA 1KVTA 3FMVA 4NBUA 4P22A 1BO6A 3HA2A 3ET5A 2R6HA 3LGSA 4HNHA 3FWYA 4FGZA 4FS8A 4CGYA 4BQFA 5I01A 1UOQA 3O4FA 1EXVA 2BFFB 3F5MA 3EMDA 3RYIB 3NRBA 5DFAA 3SMQA 4L72A 4UREA 1FU4A 2C1EA 2H1CA 3D6UA 4M6WA 3TTTA 5F33A 2K4MA 3LDHA 1GRRA 4AXBA 1SCJA 4U02A 4Q3OA 2X5KO 4IIUA 1M34B 3CIFA 3WC4A 4H1HA 2P2CA 1CJUC 1Z4NA 3B5IA 3AJDA 4H4CA 4H1WA 5HGXA 4MNTA 2YVUA 3NORA 2WUFA 2PV7A 3HR8A 2IHBA 3QPAA 1T9DA 3NETA 3K6RA 1ATIA 3EIHA 2QTRA 4EA8A 5JQWA 3O94A 4DQVA 5HSGA 4UE2A 1T4GA 4UNIA 1JEQB 2WJYA 3B1ZA 3KAPA 4H0CA 1HTTA 5ICFA 5TJHA 3X1KA 3CCCA 1VIAA 3BKWA 3COWA 2A9OA 3O5AA 1VSQA 5LP6C 1QAOA 2FCRA 1VHJA 2ZAOA 1Y81A 2ZBVA 3A9CA 3KELA 4KDRA 1Y1LA 4LDQA 4LHSA 4B7CA 3EODA 1AQNA 3EF1A 5JIBA 1G8KA 5C1PA 3C6YA 2A30A 1FDIA 2QSZA 3IH5A 3PR1A 3QVTA 1Y8AA 3P5BA 2OO3A 4RMIA 1EJ2A 4P3PA 2P6MA 1N5IA 4GL2A 4AS2A 2I5PO 4L4ZA 3ZZ0A 2VT6A 4TYWA 2FZ5A 2M2IA 2OCLA 3FIJA 1SVKA 3Q7RA 4WEOA 1BVRA 1T36B 1UMCA 1NSTA 1WUJS 3F5SA 3T3PB 3LTNC 2G08A 3L5OA 2HXSA 3DDHA 1AC5A 2GRAA 2MTBA 3OLXA 4DIOA 3EA5A 4DJEC 1CZUA 4MVJH 4EABA 4YLYA 2B8EA 4C1BA 1QRRA 4M7WA 2C94A 2EG5A 2J3EA 4JSYA 4U2DA 1I4EB 1EA7A 3F7TA 4ARSA 1QS0A 3O92A 1RQPA 4YX9A 1J23A 1HYHA 4HDMA 1BX3A 5DT9A 5I8WA 4DR3B 1M2EA 1G17A 1T6YA 1W6UA 3KD2A 2QPOA 4Z4GA 1Z9BA 4E6PA 1WMSA 1Z6XA 4ZI2A 4MGZR 3RUPA 3FB4A 1YWGO 3PNKA 3BMQA 2X0RA 3VR0A 2JGEA 3GRPA 3RYHA 2QDXA 2GYWA 5JMOA 4MUAA 4LKRA 1XQ1A 2DWOA 1AHHA 3HWRA 3QNMA 4K2AA 4C20A 4QTYA 4YO7A 3ZWAA 3SVTA 1RVDA 2P9CA 4GX0A 1F3LA 3K9QO 5FTKA 2WWXA 3Q3EA 4IWYA 4L08A 1MGPA 4R83A 4B6JA 5KUTA 3OMLA 2FN9A 3PT9A 2Q07A 4JI7B 2HTEA 4CDMA 1RR6A 5JECA 1ULTA 3QFSA 2A5YB 1PCXA 5CHYA 4B45A 4G86A 3E22B 1PUJA 5H59A 3MCTA 4XH9B 1V1MA 4ERNA 4R8LA 1QXSA 5KYVA 3KAQA 3VKHA 1FW8A 2Q7XA 2JFQA 4RD1A 2FDRA 2REBA 2YRWA 1A5TA 3OURA 4M0CA 1TCAA 3SY8A 1V26A 1VDZA 2DR2A 3DE3X 2O2EA 1XEXA 3EPLA 1GNSA 5AW4A 5EWJB 3HBFA 1Y5MA 2W2KA 2QRKA 2F9MA 2AX4A 2ZPTX 5HPYB 4X3OA 1KIFA 1EE9A 4ISBA 2JCYA 3VTKA 2Q3MA 2AHRA 3BMCA 3H8WA 3QOFA 4GOOD 4BB6A 2PZBA 4XWOA 2JGDB 1N5JA 5MN6A 2R79A 3GGJA 1MX3A 2JIMA 3Q3IA 4OHWA 4QFBA 1PGNA 1UP4A 4EJSC 4LVOA 3RC2A 3N3BC 2OSVA 4G2NA 1SUAA 1NQWA 2QLNA 3E7WA 3LKDA 2BWJA 2DUNA 4BZQA 1DI0A 2BTOA 2O4UX 2NXJA 1NQTA 2WWHA 1PWYE 5C8YF 4ZVTA 2OD9A 5FNVF 4LWOA 4OHMA 4Q12A 5I7WA 4DSAA 3SC3A 4Z54A 5CM8B 3V8NA 5I4IA 4C88A 4LDNA 4ARUA 3HL0A 1A88A 3QJGA 1O08A 3MSCA 2UZ0A 3HJNA 4O2BB 1P3DA 2PZKA 3TL3A 4US0R 2FI1A 4L51A 3FNIA 3PJEA 4A23A 1RAFA 4PX3A 4CVNA 1QG0A 2BM0A 3V7UA 1A7AA 1QWOA 1O96B 3CX3A 4F9GA 5BORA 1TUBB 10MHA 3NG1A 3RJZA 4YUZA 2A7XA 7YASA 3K7EA 3EEOA 3MERA 3VKUA 1KERA 2VJOA 1R9NA 2LIVA 2VPZA 1T9KA 4G37A 2HGZA 5G0SA 1Y9AA 1FBTA 1W88A 1FX0A 1HZZC 2EGHA 1ZOIA 1NGSA 3P2EA 3HFJA 1F60A 5KWJA 3N2GB 2WTXA 4A6PA 1RWBA 4MUIA 4ND1A 2UXCB 1J7KA 2B82A 2NNWB 2WJAA 3QYJA 2WWYA 1EQUA 1VBKA 1IN5A 4Q3KA 4XSHA 4BQQA 1SK8A 3INGA 4JL5A 2Q1YA 4L7QA 4PFJA 3NC4A 4I9FA 1CRQA 4LY3A 4RESA 4Y6GB 4KOAA 4YMGA 1RC8A 1RXYA 2FPGA 4NAHA 5DK4A 2NZYA 4KACA 1QKKA 1VKHA 1XNJA 3ZIAA 1KZYC 2R84A 4JR0A 5CT9A 1M8PA 2Y0EA 2ZI4A 3B6JA 4FP9A 1E9SA 3WWYA 4CLHA 5CBKA 5JCOC 4HRVA 4M8IA 5LIRA 4HAZA 3SX0A 2XRZA 1TK3A 4LJ4A 4MS1A 2RAPA 1X80B 3AI1A 4UVHA 3FYSA 1L5YA 1N4DA 2AK3A 2M1ZA 3BRQA 4MB2A 3ZE2B 3FMOB 1Y1SA 3NTUA 1VJRA 2P3LA 3R3WA 2G04A 1FFEA 1NY6A 2BBWA 2HRBA 2KE5A 3AM5A 3BN3A 3ODPA 1ZWLA 1TVKB 1UZLA 2MMGA 3HBJA 3WICA 3ASUA 4J3FA 5AJVB 3FOEC 3CTMA 4RKWA 1JBQA 4C3UA 5IKPA 5JAIA 1SXQA 2PWZA 3KB1A 1NIPA 1SIOA 2BCJQ 2G4LA 2LCFA 2Q9CA 3AY6A 3ETEA 4WOPA 5F9MA 3ZY5A 5AUNB 2H2GA 4YJ3B 4BTEA 3F5FA 2JZCA 4L9AA 4UQPA 4Y6OA 3ASVA 1PEAA 2D7CA 2HJHA 4UZSA 5CVDA 4URVR 1WCXA 4IQFA 3ETDA 2IKQA 4DQUA 3L6DA 4G0WA 1XKQA 4TV9B 2DR3A 2BC9A 2ZYRA 4W1RA 4NYJR 2H31A 3ABZA 1QQ5A 3F4KA 4H16A 3I9OA 5CYGA 2YZNA 4WK4B 2WSBA 1EHCA 1BH2A 2CFTA 3C87A 4JBHA 5CK5A 3V00A 4ALLA 4ENQA 3WNQA 3AGPA 4HFMA 3AVUA 5G53C 5F7JA 4GKKB 3EGWA 3TZCA 4EGSA 2Z43A 4QQ8A 1K8QA 3RG8A 5FX2A 5F3WB 1O8BA 3BF8A 4GR4A 4L8GA 2OKGA 2FG5A 1VZ3A 1NUPA 5KOIA 3A6HA 3AKDA 4Q5IA 3UK7A 2PS0A 2HHCA 5AKJA 2YJGA 1QCDA 2W9XA 3DZCA 3I28A 4WLUA 2GJSA 3GLHA 1XZGA 3JQCA 4C4SA 3A2KA 1VXOA 3NHKA 2VT2A 3D3WB 4KIFA 2H0QA 4JMPA 4N7BA 2AQIA 1NC3A 2HQ1A 2X23A 1UFVA 4D4MA 4JITA 4LHXA 1NASA 4R3NA 1OXMA 2JJMA 3NRCA 4ZO9A 4AURA 4CMHA 4DLVA 2PBLA 4D46A 1RZRA 4DUYB 1T8SA 4TZ0A 1NY5A 2GDJA 1ZYUA 4UCXA 5I9MA 4L78A 3AUUA 5JQGA 1H8HD 3LLVA 1JIUA 3OQBA 2QMEA 4BWFB 4MI3A 1E1CA 3PC4A 3WLPA 2GLUA 3S2YA 4JCCA 1ONSA 4LRTB 5CNJA 1TPYA 3X43A 3UHAA 2ODQA 1TC2A 3LXXA 1EJ0A 2WYIA 3DZGA 5GJWC 1TF5A 2UVDA 4B1FA 1QG4A 5KYYA 1M6VA 2FZKA 3GA5A 2EYUA 1F8UA 4K3VA 4ARCA 1Z6AA 1SAYA 1YCDA 1T1EA 3OLCX 5DI9A 1RXUA 3S1AA 3WK8A 3PEEA 3EVDA 1E8MA 4Q3LA 1JU3A 1T9GS 3ZHUA 2FJUA 5ICCA 1TYCA 2ZIXA 1WF6A 3IGFA 4IOKA 4MV0A 2BMAA 2DHEA 4ACBA 4HVCA 4CKWA 5M5BA 3TGLA 4QUGA 1IL0A 1SVUA 4OQEA 4CQJA 3FYUA 5FWXA 1F8FA 1M2NA 3WWCA 1S2DA 4GP6A 5D5QA 1OXKB 1E8NA 3KUDA 2I1LA 2A35A 3PPIA 3Q98A 4XDHA 4G07A 1DIOB 2HA2A 4X71A 1BVUA 3HLTA 1D2CA 3QI2A 3RFFA 3WRWA 3AHFA 2Z2KA 3WK6A 5BURA 4B17A 2HXYA 3BG5A 3DOFA 3HVKA 4DVGA 2PUTA 2GN6A 4FIDA 4U5QA 3SG0A 4PG4A 3SU8A 4CKBA 1O6CA 4YV0A 4DLWA 1CRWG 1ULAA 2ZYSA 1RXWA 2DUJA 3VR6H 2HMSA 2JHGA 5LM3A 2JFVA 2LP4Y 1BA2A 1DC5A 2O2HA 3TQFA 4TRMA 3SSOA 2CL0X 2EKZA 4BP8A 4DV3B 3BE5A 3O21A 4LAFA 1IN1A 1RRFA 3TWOA 1OGYA 3B13B 4XLTA 2D5AA 3BTOA 2IYSA 5HIKA 5IJ0A 1RS0A 4Z7OB 3L0CA 4RZSA 1KI6A 4EB8A 4OUDA 5GVRA 5BR7A 1Y7HA 2Q8NA 4MMYB 2GYVA 2ZETA 3LCVB 3O1LA 2SNIE 1EFLA 1MC4A 1WSAA 1PJRA 2QHXA 4G67A 5AVKA 1SBTA 4TOIA 3GF4A 2IBTA 3B1KA 5L3SA 1QYCA 4BFLA 1NU8A 4G23A 5D5HA 1Q91A 1YQ9A 3ODGA 5A7GA 5LB4A 3DC7A 4A10A 4BPRA 1M1YA 4D0LB 4DIUA 3A32A 2GCOA 4US2R 1AOXA 2XWPA 2P2YA 4YREA 5ICSA 2E1PA 1Q1NA 1MT3A 4Z7JA 1ORRA 2PSHA 1Q1AA 1Z33A 1ETUA 2ZSFA 5A0TA 3WMEA 1OROA 5BSEA 2CHVA 3GUYA 5JYEA 5EPEA 5KDDA 4YRZA 1Y48E 2V6GA 3I2JA 3K6SB 4KWCA 5TT1A 1WXGA 1PFUA 2WJWA 2E4UA 3AOEA 3CLSC 4UJ5A 4BFVA 4IJKA 5HUJA 3ERCA 2RGUA 3RT1A 1Y8RB 1JXAA 2HCRA 2C3PA 4AT1A 4DAOA 2PGDA 4H15A 3VTAA 3R5JA 3KPWA 4PZAA 4QJ5A 3SHWA 1W73A 3DFFA 3QE0A 1KAQA 2DULA 2OC9A 2ZPAA 3D54D 3S2SA 2C9MA 2X3FA 1P7CA 1TKBA 2BFAA 5F3RA 2JBAB 3PGKA 4I4TA 3DE6X 3VR2D 4IIJB 3ZLTA 1WETA 2IUUA 4OP1A 5IF9A 2HA4A 3BL8A 2HJRA 3EGEA 3VSDA 3VOBA 3A6KA 1OYVA 3MMSA 4EKNB 5IWAB 5DV9A 4TSRA 4CQMB 1EG7A 3FYDA 4JI8B 3HLYA 4IWNA 4NCHA 4CUJA 1FPQA 1BCRA 1XJQA 1BX1A 2ABWA 2PKWA 2Y1XA 3HN7A 5BNZA 5HG0A 1H42A 3RT9A 1L6IA 3STWA 3FE2A 4LDJA 1PO7A 2XX3A 2YY7A 4U2KA 3S2ZA 4AJIA 3EC1A 2D1SA 2X0IA 1R50A 1KJNA 3DEYX 2ZFUA 3UT6A 2CSXA 1UP7A 4XJTA 2O3JA 2V0CA 3U5ZB 5EJGA 2OMEA 3OU2A 3PQDA 2FR0A 3O8QB 4CKYA 5K0GA 3JYOA 3KR9A 2B4KA 4DUGA 5EJMA 4DDKA 1QLHA 4QVIA 4MP6A 3I6YA 3KKPA 3LOUA 2P35A 4FFBA 3V4RA 1ZI6A 1RBQA 4IUCS 3U49A 1JFVA 4ZMRA 3D4OA 1MX9A 4YRPA 4H3HB 1J49A 2E48A 2YWDA 4JGIA 4F5DA 3WYBA 3RFUA 3GLHE 5IUKC 2DBQA 3EDCA 4IZIA 2WD7B 4UE6A 1N1DA 4D96A 4F2GA 5JVDF 1ODCA 5TSDA 4YDRA 4FQ7A 5CXUA 1PG0A 3TAXA 3E15A 4MVJP 4PPFA 1C8LA 1TJ4A 2A8YA 5FL3A 4ZZ1A 1GZSA 1G42A 1O87A 2VP4A 4EA9A 3IV7A 1DQZA 5KNCA 4QTXA 4AQDA 3DDOA 5ALXA 1DQSA 4XAQA 4C2BA 3PUIA 1C3XA 4AKHA 1EVQA 1UJNA 4G0QA 3U3ZA 1JFRA 2ZLBA 4B79A 3V6MA 4KDEA 4YPFA 4J4TA 5CB4A 2O0JA 2X2OA 3R0JA 3CH6A 1EBBA 5CCDA 3VNRA 1BVHA 1TUIA 2GF2A 3FPBA 1T2NA 2IHNA 4YPOA 2R8ZA 4FXOA 3A1VA 3V4PB 1FFXB 4EI7A 2CMFA 4DTIA 3N0TA 1NRXA 3PWSA 5D6OA 5AVJA 3JQ8B 4FMBB 1B8PA 4DXAA 1IAVA 3GEMA 2JGMA 2IZ7A 5M34A 1O95D 1FDVA 4YRKA 1FW6A 5A7HA 5K8TA 1TTQB 3NKLA 3SM3A 2CV1A 2GBLA 1G2OA 1RACA 4HWKA 1XA3A 2WP0A 4Z49A 4RV5A 3W5SA 4M49A 1PDVA 5A4AA 5IVKA 2WNHA 4X8LA 1UJ5A 1Q14A 3AEUA 5D3MB 1WTCA 4PYRA 4I9UA 4MA5A 5I8PA 4FI3F 1ZRHA 4X41A 5TQVA 1BS9A 5H9VA 1XDDA 3C1TA 1CUJA 2C9CA 3V1NA 1NBMA 4I3HA 2GJ9A 1T5OA 4MTCA 4JKIA 1NPTO 2CVZA 4CIVA 5FFMA 3B7GA 3BHMA 2XA2A 3KUCA 4ND4A 1Z6ZA 2PWPA 3FPHA 3KPUA 3WOVA 4UXHA 4ENSA 2CMKA 2ECFA 2KSQA 2YHIB 3OOEA 3RYHB 1RT9A 1D8AA 1QVAA 2R3SA 2DECA 3H1TA 4RK7A 3V1YA 1PJLA 3GT3A 1W4AA 2EQ5A 2YIDA 3TQQA 3WRXC 2HXGA 3W2TA 1GGNA 3EQ9A 3WGVA 5JSKA 5ICMA 3KWFA 2G71A 2IHJA 4IOJA 4D6XA 2FEPA 2F3UA 3AT1A 2HMAA 1GLVA 4RHYA 4GEKA 3VPAA 1KH3A 2QX8A 3VR5A 3VZBA 5JD5A 3SYKA 2FSSA 2WD9A 4HVTA 2DWPA 4C07A 2B1JA 2P2ZA 1B0UA 1V8PA 1WE2A 3CRNA 4H1TA 2ODEA 4HDKA 1PEYA 1RM3A 1SWVA 1XZQA 4JIGA 4PSKA 3UXMA 3VZQA 4ER5A 1A2OA 1CZLA 3T4UA 2BI7A 2QS9A 1E9AA 1CV2A 3TDMA 2C8JA 3HJCA 3HB9A 1XTQA 3I04M 3TE6A 2ZZNA 2HHLA 1KFBB 2XXBA 2H54A 2ZR8A 5BO5A 1L6RA 1M1YE 3VJMA 2V59A 3WO0A 4DKXA 2Z5VA 2RKWA 4TL9A 4DDTA 2X3UA 2QG4A 1SBCA 1XZNA 2H9AA 2HA6A 3BZWA 4OSOA 4R9NA 3REOA 4U2EA 1ZZGA 1BSVA 3Q2IA 5EJFA 1KFCB 4Q24A 3ZH2A 4L5AA 3K70D 1XTVA 1Z6PA 1I7NA 3CSDA 1E79D 3T99A 1HT1E 2H1WA 3WMRA 2DQSA 3M6AA 4BB9A 3T3OA 4A0RA 4YV7A 1P72A 3OLYA 2XT9A 4BCDA 1E4EB 1PNOA 2DT8A 1IWPB 2XMSA 3MWLA 3MT9A 3SYMA 3ICWA 4LC9A 5JT1A 2ZAIA 3FCAA 3ITDA 4G4SP 2P30A 5F76A 4KV9A 1Z13A 1ZH8A 1DS6A 5BVGB 4FEEA 4ZKDA 2VHYA 3PV0A 4IDNA 1LPBB 4WGGA 5ARDA 2V9PA 2X58A 2QZ9A 4Q7LA 1RM0A 2JFYA 3BCHA 3OFNA 4WKCA 4C0BA 3SKVA 2VKQA 4I2VA 5TQJA 4FR5A 2I2BA 5HE9A 4LF7B 1LSOA 4DV0B 3FPSA 1VYUA 5JJLA 5TGZA 5LNK6 2CL6X 3QLEA 2WVJA 3WIEA 1J2YA 2AKYA 2GAFA 1ENYA 1KJZA 4QATA 3F3KA 1Q7CA 3WRYC 1XDZA 5ELXA 1AH2A 3CE9A 1J5EB 2FXIA 1R10A 2PMKA 4UNNA 5KKAA 2OV3A 3TYXA 3ILXA 2C99A 1IPEA 1EEXB 2ESRA 3CO0S 3KTOA 4L4UA 4LYEA 2PKQO 2G6TA 3R0ZA 3S8EA 1SCNE 2MINA 2Q6KA 2VBFA 1DWUA 2WG0A 2ZE8A 1G6KA 3QKIA 1IY2A 1L3CA 2ZYVX 3EXG1 4RMGA 2ATCA 3UPTA 1YZTA 5LP6A 4BNNA 3UFXB 1A9QA 4IP0A 2B9VA 3RNOA 3IAXA 4LWQA 4CNQA 4EEKA 1RAEA 5I9BA 4DMGA 2XH8A 3PFNA 1PR3A 4F7DA 3EG5A 4GUAA 1L7BA 3QMPA 4HB0A 4A2QA 4CFSA 2QRHA 4FN4A 4ZVVA 4F4UA 1XXHA 4ZYVA 1ML4A 4TM7A 2QD3A 4LPSA 4R0MA 1KFJB 3IBGA 3PQ5A 4AK9A 2CLFB 4Q66C 4FMDB 3AVWA 2ZWOA 1SCKA 4I1IA 4HXFB 5B1SA 4C0XA 2IGTA 4DC0A 2GVDC 3EEIA 3KBOA 3SZGA 1UBNA 4YASA 3UUWA 3PKIA 2B4AA 1KVQA 5E2AA 4UM5A 1W9MA 4AY3A 4C4TA 2Z8YM 3SPXA 3I3SR 4I4CA 4BO3A 2VUTA 2VVTA 4ZP1A 3QXJA 1QTQA 3SFVA 3TZLA 3AERB 2IOFK 1DQNA 2YHAA 1IATA 3TZQA 4ETWA 3B6KA 4DDHA 1NVWQ 3FSEA 5BWCA 4G0UA 2CDNA 2ZXFA 4S0ZA 2BLLA 2X8WA 2Q1UA 5L3RA 1L4KA 2BY4A 2JLBA 3KEFA 4OHFA 4KJXA 3EVBA 1U90A 1ZUIA 1NVDA 4Z9YA 2OORC 3ORQA 2J3IA 2MYTA 3DF7A 4KK4A 4F86A 4OQDA 1KHTA 4U9HS 4HGQA 4JUFA 2JRLA 4EY3A 3LWDA 3RJ5A 1SCIA 3LU1A 1OFUX 2BPOA 1BIFA 4WN9B 1P2SA 5CFQA 2I34A 3AL3A 2WQ6A 4ND5A 4JV5B 5I3ZA 2GPTA 3AINA 5H8WA 1WUIS 3TLJA 2LD4A 4RZ3A 1IOLA 2FSVC 4YRCA 4GX1A 3DVAA 2GASA 3PUJA 4BX0A 2OCYC 3O8CA 1FA9A 3D5TA 1C0KA 4TUYF 3JZFA 1QZ3A 4M76B 4L8LA 1M1XB 1MO6A 3MLBA 4D42A 1IBMB 3UF0A 1RC0A 2HY7A 3H2BA 4JEMA 1I2AA 2O50A 3LNTA 4MVXA 1J8YF 5JVDA 1KE1A 3PUHA 2PVPA 1CUZA 1H2EA 3IKJA 4UM8B 2GRJA 4R2HA 1F12A 2IWHA 1M83A 1XMQB 1NBME 2ZOSA 2XDAA 2WZQA 3G7NA 3GLHB 3C3AA 2AG8A 2X0EA 3MGAA 5E38A 1Q21A 3PL5A 3ZU6A 1L3BA 1WCWA 4HB3A 5IK2A 1X1BA 1EVLA 1KY2A 3QF4B 3RRNA 4AMYA 4KHPB 3JR3A 1KDRA 1QYIA 4AWAA 4AECA 3V6LA 1QCYA 2WKRA 4RTLA 2IE0A 2C3UA 4OYYA 2BH9A 4EJSA 3HRIA 2W4MA 1POWA 4M1QA 2A0WA 1Z5UA 2Z56A 1GCOA 3NBAA 3QVGA 2J6BA 4AJNA 2Z30A 2IEGA 2MSNA 3KHKA 1JHAA 4BMZA 1W0JD 2NGRA 3UAGA 3LKBA 1QUEA 4YAUA 3SEZA 2C78A 4IDOA 1CQXA 1T9BA 4CL2A 5KQLA 5TPZD 4PANA 3QY9A 2JH8A 4MO2A 3UFBA 5FR1A 2BT4A 2WJHA 4Y2JA 1ZO8A 1R27A 3A9SA 2Y9PB 5ENZA 5JS7A 4GX5A 3NIFB 1ZK4A 2F8LA 3ZVNA 1DEAA 4ZRDA 2IYNA 2C96A 1V96A 2ATVA 4TSFD 1CZHA 5KYYB 3EDYA 1KJQA 2AXNA 2GM9A 1M6VB 2C0QA 3T38A 4HWGA 4CT5A 3VGPA 1PT6A 5EHZA 2KLBA 1ILWA 3WLRA 2IY7A 2D06A 1OV4A 5DNVA 2ZIXB 5FBZA 5JD6A 3WLIA 3ZKWA 2QTVA 3LT4A 2PRZA 3N2ZB 2H4HA 1DIRA 3B60A 3HHEA 4TROA 1DB3A 1HZZA 2P9BA 3FYUB 5FWXB 2A9VA 4NU8X 3RJMA 3ZZUA 3D6AA 3QEKA 3QRWA 1ORVA 2HNBA 3NC1C 4Z4EA 4MR7B 5KYWA 2DHCA 1XTZA 3F96A 3N58A 4BWVA 6CHYA 2OP1A 4GXRA 2BIFA 3BH7A 5CYPA 1UK6A 2VEOA 4RPLA 1F17A 4P3YA 4FFPA 1D9XA 2Q5EA 4CKBB 4R8KA 3CE6A 3DAGA 4UD6A 5A5DA 1DLIA 4Y3UA 2QE7D 1KOFA 3N9IA 1TYAE 5FOUA 1KZHA 3PFGA 3UUGA 1JQJC 2B8JA 3IV6A 3Q3JB 4RJIA 4WLVA 4YHBA 5E7MA 1DRKA 1L7AA 1OMOA 1ZJ4A 3I9NA 1QHIA 4RFVA 1QFZA 3N05A 2IHVA 3LGAA 4WLNA 3HPQA 2IXFA 5JCOA 3I1IA 3HWWA 3R09A 4UTNA 1L4UA 4GWLA 3HSKA 4RY8A 3WBBA 3DCYA 1G8SA 4B40A 1RKVA 1F6DA 5EL0A 4JQYA 5FUMA 3M6UA 3O90A 2H65A 3O3MB 3QQPA 5E0OA 4QXAA 2R7AA 5TLSA 1XZHA 1FSZA 4OUDB 4Q4HB 1XZDA 5EZYA 2E2WA 2FWNA 2Q8QA 2PXHA 2VP9A 1UJCA 4L76A 4D81A 2BGJA 5FTWA 2RHHA 3RIMA 3OMXA 4ZAVA 1INLA 1LLFA 3CZCA 1OF1A 1O6FA 1KXZA 1UC4B 4OFBA 3W8FA 2CNKA 2IZ0A 1XCJA 2IX9A 2OGUA 2WM9B 2XQVA 3GRYA 4YJGA 3TD6A 5I4BA 2Z04A 3B9BA