2MROB

Structure of the complex of ubiquitin and the uba domain from dna-damage-inducible 1 protein (ddi1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyubiquitin-B
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
total genus 13
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mroB00
1C7YA 2EJSA 1VEKA 1OTRA 4G3OA 4DBGB 3GLGE 1HJPA 1VEJA 1BVSA 1XB2B 1EFUB 2DAEA 2L4EA 2L4FA 1ZMVA 2G3QA 1HT1E 1HT2E 1WR1B 1PGYA 2RRUA 2K9DA 2DAGA 3GLIE 2DAMA 3K9PA 2B3TA 1Y8GA 2KNAA 1T43A 2OOBA 1WHCA 1HQYE 1UFZA 2LVQD 2BWBA 1TTEA 2DAKA 1QZEA 3F92A 2KNVA 2CWBA 1JR3E 2OO9A 2JP7A 1YLAA 1IM2A 2JZ0A 1VQ1A 2LVNC 2R0IA 2LVOC 2ZTCA 3FRIA 2KHHA 3BBZA 2JUJA 4F1IA 2DNAA 3E46A 1WGLA 4Q7JA 4UN2B 1KYIA 3GLFE 2ZTDA 1E94E 4HEOA 1ZMUA 2LVPC 1OAIA 1DV0A 1G3IA 3IECA 2OOAA 1AIPC 2DZLA 4GEWA 2LTUA 2EKFA 2MGWA 1MN3A 1DO2A 3K9OA 3H4JA 2K0BX 2DKLA 1WGNA 4R71A 4WP2A 2H5XA 1WJ7A 2L2DA 2MR9A 2LBCA 3GLHE 2DAIA 1V92A 2LVAA 2MROB 3B89A 1T6OA 1XXHE 3LCVB 1NV9A 5JI2E 3T6PA 1P3QQ 2HWJA 2QHOB 1G4AE 1CUKA 1ZMWA 1DO0A 1R4GA 2JY7A 5DFLA 4F2LA 1GO5A 1TR8A 1OKSA 1NV8A 1OQYA 2EKKA 2QSFX 3E21A 1SG9A 1VEGA 2BWEA 1WIVA 2O25A 2JNHA 3FRHA 2DENA 2DI0A 1VDLA 2JY8A 2WZJA 1F4IA 2MJ5B 1IFYA 1Q02A 2CP8A 2JY6B 3FE3A 2HAKA 2JY5A 3LCUA 2KNZA 2JZ1A 1IXSA 3MMPA 3IHPA 1A5TA 1VG5A 1G41A 2DHYA 2QNJA 1ZV1A
chains in the Genus database with same CATH superfamily
3NBIA 5EXXA 2GNOA 5ITYA 5H37D 4GITA 1R7RA 1Z5CA 3GLGE 5BPVA 1JR3D 1VEJA 3KVWA 1TDZA 3J7AS 2MH8A 2DAEA 1OAOC 2G3QA 1JR3A 4LJ4A 3FTFA 4XGIA 3GLIB 2Z4RA 1IY1A 1PJQA 2DWMA 5IT9S 4BBAA 4IBBA 1GVNA 4NL4H 4LZZA 3U6PA 3VKHA 3BXWA 3PNYA 2Z7JA 5EP2A 1NHWC 1OIZA 1S3SA 2DAMA 4IJEA 2B3TA 5FLXS 1Y8GA 3RFWA 1QQWA 2Y21A 1WHCA 4FWDA 3VKGA 2VF7A 4NRWA 1WXQA 2CEAA 2WSCF 2LWXA 3A98B 1QZEA 3F92A 1IY2A 2CWBA 4IJFA 3RGSA 4EIWA 2ZM6M 2OO9A 2L09A 4AZFA 3AV0A 1EIJA 1IM2A 1D0LA 2CHGA 3HJSA 3AFHA 2ZANA 3GLFB 3CF0A 2C5RA 3B74A 1V34A 1H6UA 3KXEC 2OQ4A 2DNAA 5DNYA 3I4YA 4Q7JA 3PFIA 4UN2B 3JR5A 3U6OA 4B3RM 3I4VA 2KDLA 3A46A 3LW5F 1E9RA 4NC6A 4BB9A 3CF2A 1E94E 4PD2A 4I5SA 1GLNA 3KP1E 3PVSA 3GLHA 1SXJA 1ZMUA 1YUBA 2Y20A 1OAIA 4D80A 5DYGA 2GQFA 3IECA 2XZUA 2OOAA 3I04M 1AIPC 1QYRA 4LJ5A 2YFQA 3C3EA 5DYIA 4B7GA 4D82A 3TWMA 4MGIE 2O5RA 4NSOB 1N75A 2BJWA 2C99A 3H4JA 3K9OA 2EUCA 2DKLA 3HU3A 4IBCA 4XK8F 5E26A 1TGUA 3OTOM 2FFJA 2UUBM 2I7PA 3GLHB 1SXJB 2H5XA 4KO8A 4WP2A 4DR4M 4GC9A 3GO8A 1E32A 4ANRA 4LG2A 3UGJA 3GP1A 2DAIA 3GQ3A 1R2YA 2DZNB 2QP9X 1V33A 4JN6A 3LCVB 2KEBA 4LJ9A 3U61B 1QDTA 2M5ZA 4W5WA 4DV4M 3TL4X 3I51A 1QAMA 3NWLA 2C9OA 3VK8A 3SAUA 1NV8A 2EKKA 4IIWA 3T15A 1NJFA 3B9PA 1SG9A 1VEGA 4M9ZA 2BWEA 1WIVA 5IREB 3ZC7B 3HGIA 5ITQA 3B7QA 1EE8A 4G6ZA 4MH0E 3TWKA 1TH4A 1W5TA 4QNRA 4QNMA 4LF5M 2WSFF 4FW9A 2C96A 2MJ5B 1IXZA 1D2NA 1Q02A 1QAOA 3BOSA 3DA1A 3HHXA 3U61A 3HHYA 1XMQM 3FUXA 4LF4M 4QOZC 3EIEA 2JY5A 2V1UA 2KNZA 1DGHA 3QYBA 1A5TA 2VF8A 1VG5A 2XFTA 3TQSA 1C7YA 2R46A 2Y0QA 2EJSA 1OTRA 4NXNM 1PRBA 3FUVA 1XB2B 3W0LB 2Z3XA 3B7ZA 2L4EA 1ZMVA 1QZMA 2YQZA 3DOAA 3RGPA 1HT1E 2FE8A 3CTWB 1PGYA 2LHCA 3K92A 4OVZA 1K3XA 4B3SM 3KOYE 1XC8A 5IZ7D 1TH3A 3TWLA 1IQPA 2KXEA 1G59A 4II7A 3GLIE 3HX3A 3K9PA 2KNAA 4PDGA 2R44A 3L2AA 1GKIA 4QOSA 3GPPA 3SYLA 2QBYA 1HQYE 1UFZA 2JWSA 4MGHA 2BWBA 3SMSA 1TTEA 2I7NA 3R8FA 2DXIA 2DAKA 4GKJM 2YR0A 1JR3E 2O01F 1PJTA 2HCBA 4D81A 5EP4A 3U6DA 1PM5A 4JI1M 3SYKA 3AL0C 1OFHA 5KPZA 1N36M 2D7GA 5IWAM 1Q39A 2LVOC 2XH9A 3GQ5A 2QBYB 3BBZA 1Z6TA 1QUTA 4WURA 1WGLA 2APLA 2HL7A 3FYCA 3GLFE 2Z8YM 2ZTDA 1L2CA 4DUYM 2A5YB 3T1YM 3FUWA 3JR4A 1G8PA 4X65M 3SATA 4B3TM 3Q8XA 3GLFA 3AOEC 3U6LA 3T1HM 4WW0A 3C58A 4IBGA 4AQYM 2F5NA 2AHMA 5L8RF 1DGBA 3DFZA 4MB7A 4Z8XA 4X62M 3LQRA 2HHHM 1DO2A 3Q8GA 4B7FA 2V1CA 4RF0A 4AKGA 1UM8A 4RNAA 4GKKM 1WJ7A 2DVWB 1IN6A 4LF8M 4BLCA 2MR9A 1XXHB 4GC5A 4MM3B 2CHQA 1QDRA 2ZAMA 3MK6A 3HHWA 3J80S 3GLHE 1SXJE 2C9CA 5EXSA 3KS8A 2UXDM 2LVAA 2MROB 3SBJA 3FUTA 3PNVA 3B89A 4REZA 4B3MM 4G4OA 2UXBM 2NQ8C 2CV0A 1SXJD 3VFDA 4JI8M 4IBJA 5JI2E 3T6PA 2HWJA 3SC3A 2QHOB 3GLGB 4TUWA 3B7NA 1CUKA 1NHGC 3ZH9B 2JY7A 5DFLA 3FTDA 3FD9A 3K8ZA 5KPTA 1OKSA 1IN8A 2QSFX 4LRTA 2HKJA 3J2PB 4B08A 3E21A 2KW0A 1IBLM 3ZQJA 1Z5BA 2Y0TA 3HZJA 2O25A 2JNHA 3UJNA 3SAWA 3W0FA 1LV7A 2DENA 3A42A 4FCTA 1IY0A 4ITQA 2JXNA 3KOWE 1IXSB 2WZJA 4GHAA 4LCBA 4LJ8A 1NNUC 5FTKA 4DV6M 4HL4A 1HQCA 2KZSA 2VQEM 2R62A 2Z4SA 3TPZA 1IN5A 2H1RA 3KOXE 4P17A 1VDDA 1NY6A 3TE6A 4AG6A 2M60A 2CP8A 4NXMM 2E5LM 3KFUG 2F5OA 4JI0M 2R45A 2X8AA 5ITXE 3U6EA 1IN7A 3MHVC 1HR0M 4JI6M 1NVMA 1QAQA 1Q3CA 2F5QA 1XNRM 2L7IA 2KRKA 4MGYE 3VLFB 5ITXA 8CATA 5GKNA 4HLQA 4GRIA 4G3OA 4DBGB 4AI6A 1HJPA 3HY5A 2L7HA 3WHLA 2VQFM 1N78A 2L4FA 4L8RC 5C1BA 2UUAM 5EQTA 1K3WA 1WR1B 2RKOA 3FUUA 3SASA 4LFBM 2V6ZM 2RRUA 2CV2A 3ZCBB 3PXGA 4L6V6 4LJAA 3U6QA 2K9DA 3SARA 4JXJA 3KSXA 4IBDA 2OPFA 2DAGA 3FTCA 4L78A 1D0MA 3MJ5A 1L1ZA 2KA6B 4DR3M 1PJJA 1T43A 2OOBA 4AW4A 1XMOM 3CGWA 4RKUF 2LVQD 4I8OA 4KHPM 4DR5M 4NRVA 5C18A 1IBMM 4DV7M 4LRSA 2D7EA 1TDHA 4XBOA 5KPRA 4CJ6A 5ITUA 4LFCM 1TH2A 1IN4A 1JB0F 4DV3M 1GL6A 2R4EA 2JP7A 4M9XA 2UXCM 3LMMA 5EP1A 2JZ0A 2KZUA 3FKEA 2R0IA 1NJGA 3W67A 2KHHA 4FCWA 4JI2M 2QZ4A 4NOOB 2QQ8A 2JUJA 3HU2A 3LVVA 4LGMA 3D8BA 3EIHA 1TF0B 2W82A 3GRRA 2WSEF 1KYIA 4NSRA 3AKZA 1I94M 1IXRC 4JI5M 2YNMD 4R7GA 2XF3A 3DZDA 4LGYA 1RU3A 1QVRA 3HKPA 5EXTA 4DV5M 4PDIA 3SAVA 1J5EM 1NY5A 1KFVA 3A45A 3J7BA 4K0KM 2LVPC 1L8QA 2G5GX 1G3IA 4PCZA 5KQ8A 4GEWA 5EJCA 2LTUA 1MU5A 2CFOA 4LF7M 2LXEA 2EKFA 2MGWA 1MN3A 2XSZD 3HJ8A 4LJ6A 1D0KA 2QENA 2K0BX 4GIPA 4Y28F 1J7KA 1WGNA 4R71A 2XSZA 2UUCM 4JV5M 2R4JA 1PJSA 4AKHA 4FWGA 2KRUA 1ZAEA 4DR6M 3M7GA 4G4NA 4DV1M 4DUZM 1OFIA 4IBFA 3L25A 2XFSA 2LNHC 2N35A 4CGYB 4OVZB 2RGOA 2R6FA 2XZFA 1XXHE 3VDUA 1HNXM 1QUSA 1NNJA 4DR7M 4IBEA 1R2ZA 1P3QQ 2R18A 2VDBB 3IG5A 5E6JA 4AG5A 3KDSE 4FD2A 4P16A 1R4GA 4QHTA 4F2LA 2ZBKB 2DWNA 4DR1M 1GO5A 1XXHA 2BJVA 4OW0A 5KO3A 2XLJA 1N32M 1FNNA 1GL7A 3W68A 2LH0A 1T3TA 5FTMA 3GRVA 1MX0A 3C9PA 3SFZA 4JI7M 2DI0A 1VDLA 1G71A 3GLGA 4OX9M 2JY8A 1Z5AA 1FJGM 4A3VB 3KP0E 3AOEA 3GPYA 3SHFA 4R3DA 1IBKM 3C3DA 1L1TA 4MGZE 1GJSA 4PT5A 3ILKA 1N34M 2F4VM 1IFYA 2VIIA 3NBXX 4M9SA 2JY6B 3FE3A 3L27A 2LHGA 2DZOB 2CRUA 4LZJA 4S12A 3IG8A 4FWHA 2JZ1A 1IXSA 3WHKA 2ZAOA 1G41A 1R5LA 4DV2M 4GHLA 4YHHM 1NV9A 1AUAA 1K82A 1L2DA 1C1KA 1OJLA 1VEKA 2JA2A 5F3WA 1X37A 1I4WA 1BVSA 1EFUB 1SXJC 3UZUA 1YE9A 1HT2E 3T38A 1KSFX 2FOIC 4B7HA 1E9SA 4LF9M 4L4UA 5EP3A 5EXPA 1L2BA 2FNAA 3H4MA 3K2LA 4LFAM 2QPAA 3THGA 1XHBA 3GRUA 4I4LA 4JYAM 3D8LA 4Z6YA 4JI4M 3M6AA 3CF6E 2ERCA 3JAMS 2C98A 2RGHA 2KNVA 3LQQA 5ITRA 5FTLA 1NO1A 3U60A 3L28A 3RE8A 3SMPA 1GABA 1NSFA 4KLNA 3L26A 1YLAA 1W5SA 3KW6A 1LTMA 4FVMA 4QHSA 1VQ1A 2LVNC 3QWLA 2ZTCA 3FRIA 2D7HA 3K1JA 2FS1A 1ZQ9A 3UMMA 2DHRA 4IBIA 3E46A 4F1IA 3L29A 3E4RA 1JQJC 3U60B 1Z59A 1QANA 4RF1A 3U6MA 4L15A 5ITTA 4HEOA 3GQ4A 2R65A 2K6BA 5KQDA 3GPXA 3KS4A 1DV0A 1ORYB 4I81A 2BNKA 2CE7A 2FH0A 2P5TA 4YY3M 4OU7A 2F5PA 3HWSA 2DZLA 2X4AA 3E9SA 3HHZA 4X64M 1HNZM 4FCVA 4LF6M 3J81S 2XGNA 1DGFA 1N77A 3J27B 1MJGM 4DV0M 1N33M 5FSWA 4AKIA 3R9XB 2L2DA 3LVWA 4MGKE 2G8LA 4ZPXA 3QAUA 2Q2EB 4CHTB 2LBCA 2EA0A 3I01M 1V92A 3KSJA 2J5YA 1DGGA 3HJQA 2QCUA 3KOZE 3FTEA 3FYDA 4M0DA 1T6OA 4KODA 4LJ7A 5FTNA 3U5ZA 3AJIB 2XEPA 1G4AE 1ZMWA 3M0EA 1DO0A 7CATA 2K47A 4DR2M 3HU1A 1TR8A 3GRYA 5LMUM 4JI3M 1OQYA 2DWLA 1YSYA 2L6OA 4IBKA 2X49A 4LY6A 4X66M 1PJIA 4KT0F 3FRHA 5LMNM 4G4RA 3AOGA 1HNWM 3V76A 1DGHB 4GMQA 3U5ZB 3U6SA 1GJTA 1XWIA 5JI3E 4G4QA 3VDPA 3UK6A 3QYEA 1F4IA 5FTJA 1Q3BA 2CHVA 3SHGB 2CV1A 2UU9M 4CIZA 2J7NA 2F5SA 5A2QS 3U6CA 1R6BX 4M0WA 4GH9A 2HAKA 5BR8M 1XNQM 2DWZB 3LCUA 4L16A 1OIPA 1J09A 2CUZA 2J7OA 3MMPA 3IHPA 3GPUA 3GLIA 2DHYA 3VK7A 2EO2A 2QNJA 1ZV1A 4CISA
chains in the Genus database with same CATH topology
1C7YA 2EJSA 1VEKA 1OTRA 4G3OA 4DBGB 3GLGE 1HJPA 1VEJA 1BVSA 1XB2B 1EFUB 2DAEA 2L4EA 2L4FA 1ZMVA 2G3QA 1HT1E 1HT2E 1WR1B 1PGYA 2RRUA 2K9DA 2DAGA 3GLIE 2DAMA 3K9PA 2B3TA 1Y8GA 2KNAA 1T43A 2OOBA 1WHCA 1HQYE 1UFZA 2LVQD 2BWBA 1TTEA 2DAKA 1QZEA 3F92A 2KNVA 2CWBA 1JR3E 2OO9A 2JP7A 1YLAA 1IM2A 2JZ0A 1VQ1A 2LVNC 2R0IA 2LVOC 2ZTCA 3FRIA 2KHHA 3BBZA 2JUJA 4F1IA 2DNAA 3E46A 1WGLA 4Q7JA 4UN2B 1KYIA 3GLFE 2ZTDA 1E94E 4HEOA 1ZMUA 2LVPC 1OAIA 1DV0A 1G3IA 3IECA 2OOAA 1AIPC 2DZLA 4GEWA 2LTUA 2EKFA 2MGWA 1MN3A 1DO2A 3K9OA 3H4JA 2K0BX 2DKLA 1WGNA 4R71A 4WP2A 2H5XA 1WJ7A 2L2DA 2MR9A 2LBCA 3GLHE 2DAIA 1V92A 2LVAA 2MROB 3B89A 1T6OA 1XXHE 3LCVB 1NV9A 5JI2E 3T6PA 1P3QQ 2HWJA 2QHOB 1G4AE 1CUKA 1ZMWA 1DO0A 1R4GA 2JY7A 5DFLA 4F2LA 1GO5A 1TR8A 1OKSA 1NV8A 1OQYA 2EKKA 2QSFX 3E21A 1SG9A 1VEGA 2BWEA 1WIVA 2O25A 2JNHA 3FRHA 2DENA 2DI0A 1VDLA 2JY8A 2WZJA 1F4IA 2MJ5B 1IFYA 1Q02A 2CP8A 2JY6B 3FE3A 2HAKA 2JY5A 3LCUA 2KNZA 2JZ1A 1IXSA 3MMPA 3IHPA 1A5TA 1VG5A 1G41A 2DHYA 2QNJA 1ZV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7Y A;  2EJS A;  1VEK A;  1OTR A;  4G3O A;  4DBG B;  3GLG E;  1HJP A;  1VEJ A;  1BVS A;  1XB2 B;  1EFU B;  2DAE A;  2L4E A;  2L4F A;  1ZMV A;  2G3Q A;  1HT1 E;  1HT2 E;  1WR1 B;  1PGY A;  2RRU A;  2K9D A;  2DAG A;  3GLI E;  2DAM A;  3K9P A;  2B3T A;  1Y8G A;  2KNA A;  1T43 A;  2OOB A;  1WHC A;  1HQY E;  1UFZ A;  2LVQ D;  2BWB A;  1TTE A;  2DAK A;  1QZE A;  3F92 A;  2KNV A;  2CWB A;  1JR3 E;  2OO9 A;  2JP7 A;  1YLA A;  1IM2 A;  2JZ0 A;  1VQ1 A;  2LVN C;  2R0I A;  2LVO C;  2ZTC A;  3FRI A;  2KHH A;  3BBZ A;  2JUJ A;  4F1I A;  2DNA A;  3E46 A;  1WGL A;  4Q7J A;  4UN2 B;  1KYI A;  3GLF E;  2ZTD A;  1E94 E;  4HEO A;  1ZMU A;  2LVP C;  1OAI A;  1DV0 A;  1G3I A;  3IEC A;  2OOA A;  1AIP C;  2DZL A;  4GEW A;  2LTU A;  2EKF A;  2MGW A;  1MN3 A;  1DO2 A;  3K9O A;  3H4J A;  2K0B X;  2DKL A;  1WGN A;  4R71 A;  4WP2 A;  2H5X A;  1WJ7 A;  2L2D A;  2MR9 A;  2LBC A;  3GLH E;  2DAI A;  1V92 A;  2LVA A;  2MRO B;  3B89 A;  1T6O A;  1XXH E;  3LCV B;  1NV9 A;  5JI2 E;  3T6P A;  1P3Q Q;  2HWJ A;  2QHO B;  1G4A E;  1CUK A;  1ZMW A;  1DO0 A;  1R4G A;  2JY7 A;  5DFL A;  4F2L A;  1GO5 A;  1TR8 A;  1OKS A;  1NV8 A;  1OQY A;  2EKK A;  2QSF X;  3E21 A;  1SG9 A;  1VEG A;  2BWE A;  1WIV A;  2O25 A;  2JNH A;  3FRH A;  2DEN A;  2DI0 A;  1VDL A;  2JY8 A;  2WZJ A;  1F4I A;  2MJ5 B;  1IFY A;  1Q02 A;  2CP8 A;  2JY6 B;  3FE3 A;  2HAK A;  2JY5 A;  3LCU A;  2KNZ A;  2JZ1 A;  1IXS A;  3MMP A;  3IHP A;  1A5T A;  1VG5 A;  1G41 A;  2DHY A;  2QNJ A;  1ZV1 A; 
#chains in the Genus database with same CATH topology
 3NBI A;  5EXX A;  2GNO A;  5ITY A;  5H37 D;  4GIT A;  1R7R A;  1Z5C A;  3GLG E;  5BPV A;  1JR3 D;  1VEJ A;  3KVW A;  1TDZ A;  3J7A S;  2MH8 A;  2DAE A;  1OAO C;  2G3Q A;  1JR3 A;  4LJ4 A;  3FTF A;  4XGI A;  3GLI B;  2Z4R A;  1IY1 A;  1PJQ A;  2DWM A;  5IT9 S;  4BBA A;  4IBB A;  1GVN A;  4NL4 H;  4LZZ A;  3U6P A;  3VKH A;  3BXW A;  3PNY A;  2Z7J A;  5EP2 A;  1NHW C;  1OIZ A;  1S3S A;  2DAM A;  4IJE A;  2B3T A;  5FLX S;  1Y8G A;  3RFW A;  1QQW A;  2Y21 A;  1WHC A;  4FWD A;  3VKG A;  2VF7 A;  4NRW A;  1WXQ A;  2CEA A;  2WSC F;  2LWX A;  3A98 B;  1QZE A;  3F92 A;  1IY2 A;  2CWB A;  4IJF A;  3RGS A;  4EIW A;  2ZM6 M;  2OO9 A;  2L09 A;  4AZF A;  3AV0 A;  1EIJ A;  1IM2 A;  1D0L A;  2CHG A;  3HJS A;  3AFH A;  2ZAN A;  3GLF B;  3CF0 A;  2C5R A;  3B74 A;  1V34 A;  1H6U A;  3KXE C;  2OQ4 A;  2DNA A;  5DNY A;  3I4Y A;  4Q7J A;  3PFI A;  4UN2 B;  3JR5 A;  3U6O A;  4B3R M;  3I4V A;  2KDL A;  3A46 A;  3LW5 F;  1E9R A;  4NC6 A;  4BB9 A;  3CF2 A;  1E94 E;  4PD2 A;  4I5S A;  1GLN A;  3KP1 E;  3PVS A;  3GLH A;  1SXJ A;  1ZMU A;  1YUB A;  2Y20 A;  1OAI A;  4D80 A;  5DYG A;  2GQF A;  3IEC A;  2XZU A;  2OOA A;  3I04 M;  1AIP C;  1QYR A;  4LJ5 A;  2YFQ A;  3C3E A;  5DYI A;  4B7G A;  4D82 A;  3TWM A;  4MGI E;  2O5R A;  4NSO B;  1N75 A;  2BJW A;  2C99 A;  3H4J A;  3K9O A;  2EUC A;  2DKL A;  3HU3 A;  4IBC A;  4XK8 F;  5E26 A;  1TGU A;  3OTO M;  2FFJ A;  2UUB M;  2I7P A;  3GLH B;  1SXJ B;  2H5X A;  4KO8 A;  4WP2 A;  4DR4 M;  4GC9 A;  3GO8 A;  1E32 A;  4ANR A;  4LG2 A;  3UGJ A;  3GP1 A;  2DAI A;  3GQ3 A;  1R2Y A;  2DZN B;  2QP9 X;  1V33 A;  4JN6 A;  3LCV B;  2KEB A;  4LJ9 A;  3U61 B;  1QDT A;  2M5Z A;  4W5W A;  4DV4 M;  3TL4 X;  3I51 A;  1QAM A;  3NWL A;  2C9O A;  3VK8 A;  3SAU A;  1NV8 A;  2EKK A;  4IIW A;  3T15 A;  1NJF A;  3B9P A;  1SG9 A;  1VEG A;  4M9Z A;  2BWE A;  1WIV A;  5IRE B;  3ZC7 B;  3HGI A;  5ITQ A;  3B7Q A;  1EE8 A;  4G6Z A;  4MH0 E;  3TWK A;  1TH4 A;  1W5T A;  4QNR A;  4QNM A;  4LF5 M;  2WSF F;  4FW9 A;  2C96 A;  2MJ5 B;  1IXZ A;  1D2N A;  1Q02 A;  1QAO A;  3BOS A;  3DA1 A;  3HHX A;  3U61 A;  3HHY A;  1XMQ M;  3FUX A;  4LF4 M;  4QOZ C;  3EIE A;  2JY5 A;  2V1U A;  2KNZ A;  1DGH A;  3QYB A;  1A5T A;  2VF8 A;  1VG5 A;  2XFT A;  3TQS A;  1C7Y A;  2R46 A;  2Y0Q A;  2EJS A;  1OTR A;  4NXN M;  1PRB A;  3FUV A;  1XB2 B;  3W0L B;  2Z3X A;  3B7Z A;  2L4E A;  1ZMV A;  1QZM A;  2YQZ A;  3DOA A;  3RGP A;  1HT1 E;  2FE8 A;  3CTW B;  1PGY A;  2LHC A;  3K92 A;  4OVZ A;  1K3X A;  4B3S M;  3KOY E;  1XC8 A;  5IZ7 D;  1TH3 A;  3TWL A;  1IQP A;  2KXE A;  1G59 A;  4II7 A;  3GLI E;  3HX3 A;  3K9P A;  2KNA A;  4PDG A;  2R44 A;  3L2A A;  1GKI A;  4QOS A;  3GPP A;  3SYL A;  2QBY A;  1HQY E;  1UFZ A;  2JWS A;  4MGH A;  2BWB A;  3SMS A;  1TTE A;  2I7N A;  3R8F A;  2DXI A;  2DAK A;  4GKJ M;  2YR0 A;  1JR3 E;  2O01 F;  1PJT A;  2HCB A;  4D81 A;  5EP4 A;  3U6D A;  1PM5 A;  4JI1 M;  3SYK A;  3AL0 C;  1OFH A;  5KPZ A;  1N36 M;  2D7G A;  5IWA M;  1Q39 A;  2LVO C;  2XH9 A;  3GQ5 A;  2QBY B;  3BBZ A;  1Z6T A;  1QUT A;  4WUR A;  1WGL A;  2APL A;  2HL7 A;  3FYC A;  3GLF E;  2Z8Y M;  2ZTD A;  1L2C A;  4DUY M;  2A5Y B;  3T1Y M;  3FUW A;  3JR4 A;  1G8P A;  4X65 M;  3SAT A;  4B3T M;  3Q8X A;  3GLF A;  3AOE C;  3U6L A;  3T1H M;  4WW0 A;  3C58 A;  4IBG A;  4AQY M;  2F5N A;  2AHM A;  5L8R F;  1DGB A;  3DFZ A;  4MB7 A;  4Z8X A;  4X62 M;  3LQR A;  2HHH M;  1DO2 A;  3Q8G A;  4B7F A;  2V1C A;  4RF0 A;  4AKG A;  1UM8 A;  4RNA A;  4GKK M;  1WJ7 A;  2DVW B;  1IN6 A;  4LF8 M;  4BLC A;  2MR9 A;  1XXH B;  4GC5 A;  4MM3 B;  2CHQ A;  1QDR A;  2ZAM A;  3MK6 A;  3HHW A;  3J80 S;  3GLH E;  1SXJ E;  2C9C A;  5EXS A;  3KS8 A;  2UXD M;  2LVA A;  2MRO B;  3SBJ A;  3FUT A;  3PNV A;  3B89 A;  4REZ A;  4B3M M;  4G4O A;  2UXB M;  2NQ8 C;  2CV0 A;  1SXJ D;  3VFD A;  4JI8 M;  4IBJ A;  5JI2 E;  3T6P A;  2HWJ A;  3SC3 A;  2QHO B;  3GLG B;  4TUW A;  3B7N A;  1CUK A;  1NHG C;  3ZH9 B;  2JY7 A;  5DFL A;  3FTD A;  3FD9 A;  3K8Z A;  5KPT A;  1OKS A;  1IN8 A;  2QSF X;  4LRT A;  2HKJ A;  3J2P B;  4B08 A;  3E21 A;  2KW0 A;  1IBL M;  3ZQJ A;  1Z5B A;  2Y0T A;  3HZJ A;  2O25 A;  2JNH A;  3UJN A;  3SAW A;  3W0F A;  1LV7 A;  2DEN A;  3A42 A;  4FCT A;  1IY0 A;  4ITQ A;  2JXN A;  3KOW E;  1IXS B;  2WZJ A;  4GHA A;  4LCB A;  4LJ8 A;  1NNU C;  5FTK A;  4DV6 M;  4HL4 A;  1HQC A;  2KZS A;  2VQE M;  2R62 A;  2Z4S A;  3TPZ A;  1IN5 A;  2H1R A;  3KOX E;  4P17 A;  1VDD A;  1NY6 A;  3TE6 A;  4AG6 A;  2M60 A;  2CP8 A;  4NXM M;  2E5L M;  3KFU G;  2F5O A;  4JI0 M;  2R45 A;  2X8A A;  5ITX E;  3U6E A;  1IN7 A;  3MHV C;  1HR0 M;  4JI6 M;  1NVM A;  1QAQ A;  1Q3C A;  2F5Q A;  1XNR M;  2L7I A;  2KRK A;  4MGY E;  3VLF B;  5ITX A;  8CAT A;  5GKN A;  4HLQ A;  4GRI A;  4G3O A;  4DBG B;  4AI6 A;  1HJP A;  3HY5 A;  2L7H A;  3WHL A;  2VQF M;  1N78 A;  2L4F A;  4L8R C;  5C1B A;  2UUA M;  5EQT A;  1K3W A;  1WR1 B;  2RKO A;  3FUU A;  3SAS A;  4LFB M;  2V6Z M;  2RRU A;  2CV2 A;  3ZCB B;  3PXG A;  4L6V 6;  4LJA A;  3U6Q A;  2K9D A;  3SAR A;  4JXJ A;  3KSX A;  4IBD A;  2OPF A;  2DAG A;  3FTC A;  4L78 A;  1D0M A;  3MJ5 A;  1L1Z A;  2KA6 B;  4DR3 M;  1PJJ A;  1T43 A;  2OOB A;  4AW4 A;  1XMO M;  3CGW A;  4RKU F;  2LVQ D;  4I8O A;  4KHP M;  4DR5 M;  4NRV A;  5C18 A;  1IBM M;  4DV7 M;  4LRS A;  2D7E A;  1TDH A;  4XBO A;  5KPR A;  4CJ6 A;  5ITU A;  4LFC M;  1TH2 A;  1IN4 A;  1JB0 F;  4DV3 M;  1GL6 A;  2R4E A;  2JP7 A;  4M9X A;  2UXC M;  3LMM A;  5EP1 A;  2JZ0 A;  2KZU A;  3FKE A;  2R0I A;  1NJG A;  3W67 A;  2KHH A;  4FCW A;  4JI2 M;  2QZ4 A;  4NOO B;  2QQ8 A;  2JUJ A;  3HU2 A;  3LVV A;  4LGM A;  3D8B A;  3EIH A;  1TF0 B;  2W82 A;  3GRR A;  2WSE F;  1KYI A;  4NSR A;  3AKZ A;  1I94 M;  1IXR C;  4JI5 M;  2YNM D;  4R7G A;  2XF3 A;  3DZD A;  4LGY A;  1RU3 A;  1QVR A;  3HKP A;  5EXT A;  4DV5 M;  4PDI A;  3SAV A;  1J5E M;  1NY5 A;  1KFV A;  3A45 A;  3J7B A;  4K0K M;  2LVP C;  1L8Q A;  2G5G X;  1G3I A;  4PCZ A;  5KQ8 A;  4GEW A;  5EJC A;  2LTU A;  1MU5 A;  2CFO A;  4LF7 M;  2LXE A;  2EKF A;  2MGW A;  1MN3 A;  2XSZ D;  3HJ8 A;  4LJ6 A;  1D0K A;  2QEN A;  2K0B X;  4GIP A;  4Y28 F;  1J7K A;  1WGN A;  4R71 A;  2XSZ A;  2UUC M;  4JV5 M;  2R4J A;  1PJS A;  4AKH A;  4FWG A;  2KRU A;  1ZAE A;  4DR6 M;  3M7G A;  4G4N A;  4DV1 M;  4DUZ M;  1OFI A;  4IBF A;  3L25 A;  2XFS A;  2LNH C;  2N35 A;  4CGY B;  4OVZ B;  2RGO A;  2R6F A;  2XZF A;  1XXH E;  3VDU A;  1HNX M;  1QUS A;  1NNJ A;  4DR7 M;  4IBE A;  1R2Z A;  1P3Q Q;  2R18 A;  2VDB B;  3IG5 A;  5E6J A;  4AG5 A;  3KDS E;  4FD2 A;  4P16 A;  1R4G A;  4QHT A;  4F2L A;  2ZBK B;  2DWN A;  4DR1 M;  1GO5 A;  1XXH A;  2BJV A;  4OW0 A;  5KO3 A;  2XLJ A;  1N32 M;  1FNN A;  1GL7 A;  3W68 A;  2LH0 A;  1T3T A;  5FTM A;  3GRV A;  1MX0 A;  3C9P A;  3SFZ A;  4JI7 M;  2DI0 A;  1VDL A;  1G71 A;  3GLG A;  4OX9 M;  2JY8 A;  1Z5A A;  1FJG M;  4A3V B;  3KP0 E;  3AOE A;  3GPY A;  3SHF A;  4R3D A;  1IBK M;  3C3D A;  1L1T A;  4MGZ E;  1GJS A;  4PT5 A;  3ILK A;  1N34 M;  2F4V M;  1IFY A;  2VII A;  3NBX X;  4M9S A;  2JY6 B;  3FE3 A;  3L27 A;  2LHG A;  2DZO B;  2CRU A;  4LZJ A;  4S12 A;  3IG8 A;  4FWH A;  2JZ1 A;  1IXS A;  3WHK A;  2ZAO A;  1G41 A;  1R5L A;  4DV2 M;  4GHL A;  4YHH M;  1NV9 A;  1AUA A;  1K82 A;  1L2D A;  1C1K A;  1OJL A;  1VEK A;  2JA2 A;  5F3W A;  1X37 A;  1I4W A;  1BVS A;  1EFU B;  1SXJ C;  3UZU A;  1YE9 A;  1HT2 E;  3T38 A;  1KSF X;  2FOI C;  4B7H A;  1E9S A;  4LF9 M;  4L4U A;  5EP3 A;  5EXP A;  1L2B A;  2FNA A;  3H4M A;  3K2L A;  4LFA M;  2QPA A;  3THG A;  1XHB A;  3GRU A;  4I4L A;  4JYA M;  3D8L A;  4Z6Y A;  4JI4 M;  3M6A A;  3CF6 E;  2ERC A;  3JAM S;  2C98 A;  2RGH A;  2KNV A;  3LQQ A;  5ITR A;  5FTL A;  1NO1 A;  3U60 A;  3L28 A;  3RE8 A;  3SMP A;  1GAB A;  1NSF A;  4KLN A;  3L26 A;  1YLA A;  1W5S A;  3KW6 A;  1LTM A;  4FVM A;  4QHS A;  1VQ1 A;  2LVN C;  3QWL A;  2ZTC A;  3FRI A;  2D7H A;  3K1J A;  2FS1 A;  1ZQ9 A;  3UMM A;  2DHR A;  4IBI A;  3E46 A;  4F1I A;  3L29 A;  3E4R A;  1JQJ C;  3U60 B;  1Z59 A;  1QAN A;  4RF1 A;  3U6M A;  4L15 A;  5ITT A;  4HEO A;  3GQ4 A;  2R65 A;  2K6B A;  5KQD A;  3GPX A;  3KS4 A;  1DV0 A;  1ORY B;  4I81 A;  2BNK A;  2CE7 A;  2FH0 A;  2P5T A;  4YY3 M;  4OU7 A;  2F5P A;  3HWS A;  2DZL A;  2X4A A;  3E9S A;  3HHZ A;  4X64 M;  1HNZ M;  4FCV A;  4LF6 M;  3J81 S;  2XGN A;  1DGF A;  1N77 A;  3J27 B;  1MJG M;  4DV0 M;  1N33 M;  5FSW A;  4AKI A;  3R9X B;  2L2D A;  3LVW A;  4MGK E;  2G8L A;  4ZPX A;  3QAU A;  2Q2E B;  4CHT B;  2LBC A;  2EA0 A;  3I01 M;  1V92 A;  3KSJ A;  2J5Y A;  1DGG A;  3HJQ A;  2QCU A;  3KOZ E;  3FTE A;  3FYD A;  4M0D A;  1T6O A;  4KOD A;  4LJ7 A;  5FTN A;  3U5Z A;  3AJI B;  2XEP A;  1G4A E;  1ZMW A;  3M0E A;  1DO0 A;  7CAT A;  2K47 A;  4DR2 M;  3HU1 A;  1TR8 A;  3GRY A;  5LMU M;  4JI3 M;  1OQY A;  2DWL A;  1YSY A;  2L6O A;  4IBK A;  2X49 A;  4LY6 A;  4X66 M;  1PJI A;  4KT0 F;  3FRH A;  5LMN M;  4G4R A;  3AOG A;  1HNW M;  3V76 A;  1DGH B;  4GMQ A;  3U5Z B;  3U6S A;  1GJT A;  1XWI A;  5JI3 E;  4G4Q A;  3VDP A;  3UK6 A;  3QYE A;  1F4I A;  5FTJ A;  1Q3B A;  2CHV A;  3SHG B;  2CV1 A;  2UU9 M;  4CIZ A;  2J7N A;  2F5S A;  5A2Q S;  3U6C A;  1R6B X;  4M0W A;  4GH9 A;  2HAK A;  5BR8 M;  1XNQ M;  2DWZ B;  3LCU A;  4L16 A;  1OIP A;  1J09 A;  2CUZ A;  2J7O A;  3MMP A;  3IHP A;  3GPU A;  3GLI A;  2DHY A;  3VK7 A;  2EO2 A;  2QNJ A;  1ZV1 A;  4CIS A; 
#chains in the Genus database with same CATH homology
 1C7Y A;  2EJS A;  1VEK A;  1OTR A;  4G3O A;  4DBG B;  3GLG E;  1HJP A;  1VEJ A;  1BVS A;  1XB2 B;  1EFU B;  2DAE A;  2L4E A;  2L4F A;  1ZMV A;  2G3Q A;  1HT1 E;  1HT2 E;  1WR1 B;  1PGY A;  2RRU A;  2K9D A;  2DAG A;  3GLI E;  2DAM A;  3K9P A;  2B3T A;  1Y8G A;  2KNA A;  1T43 A;  2OOB A;  1WHC A;  1HQY E;  1UFZ A;  2LVQ D;  2BWB A;  1TTE A;  2DAK A;  1QZE A;  3F92 A;  2KNV A;  2CWB A;  1JR3 E;  2OO9 A;  2JP7 A;  1YLA A;  1IM2 A;  2JZ0 A;  1VQ1 A;  2LVN C;  2R0I A;  2LVO C;  2ZTC A;  3FRI A;  2KHH A;  3BBZ A;  2JUJ A;  4F1I A;  2DNA A;  3E46 A;  1WGL A;  4Q7J A;  4UN2 B;  1KYI A;  3GLF E;  2ZTD A;  1E94 E;  4HEO A;  1ZMU A;  2LVP C;  1OAI A;  1DV0 A;  1G3I A;  3IEC A;  2OOA A;  1AIP C;  2DZL A;  4GEW A;  2LTU A;  2EKF A;  2MGW A;  1MN3 A;  1DO2 A;  3K9O A;  3H4J A;  2K0B X;  2DKL A;  1WGN A;  4R71 A;  4WP2 A;  2H5X A;  1WJ7 A;  2L2D A;  2MR9 A;  2LBC A;  3GLH E;  2DAI A;  1V92 A;  2LVA A;  2MRO B;  3B89 A;  1T6O A;  1XXH E;  3LCV B;  1NV9 A;  5JI2 E;  3T6P A;  1P3Q Q;  2HWJ A;  2QHO B;  1G4A E;  1CUK A;  1ZMW A;  1DO0 A;  1R4G A;  2JY7 A;  5DFL A;  4F2L A;  1GO5 A;  1TR8 A;  1OKS A;  1NV8 A;  1OQY A;  2EKK A;  2QSF X;  3E21 A;  1SG9 A;  1VEG A;  2BWE A;  1WIV A;  2O25 A;  2JNH A;  3FRH A;  2DEN A;  2DI0 A;  1VDL A;  2JY8 A;  2WZJ A;  1F4I A;  2MJ5 B;  1IFY A;  1Q02 A;  2CP8 A;  2JY6 B;  3FE3 A;  2HAK A;  2JY5 A;  3LCU A;  2KNZ A;  2JZ1 A;  1IXS A;  3MMP A;  3IHP A;  1A5T A;  1VG5 A;  1G41 A;  2DHY A;  2QNJ A;  1ZV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...