2MROB

Structure of the complex of ubiquitin and the uba domain from dna-damage-inducible 1 protein (ddi1)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
44
structure length
44
Chain Sequence
GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/signaling protein
molecule keywords Polyubiquitin-B
total genus 13
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00627 UBA UBA/TS-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2mroB00
2HAKA 3GLGE 2DENA 2EKFA 2LVQD 1TR8A 2DAIA 2WZJA 3FE3A 2LTUA 5DFLA 2DI0A 2JP7A 1UFZA 2DHYA 2KNZA 2DAGA 2LVPC 2JY6B 1BVSA 2DAMA 3GLIE 1DV0A 2EKKA 4F1IA 1T6OA 2K9DA 1IFYA 1DO2A 1T43A 4DBGB 2EJSA 1TTEA 2JUJA 1OAIA 2JY7A 2LBCA 2DNAA 1Q02A 4HEOA 2QSFX 1HT2E 1V92A 1WR1B 4G3OA 2QNJA 1VEJA 1SG9A 1CUKA 1IXSA 1NV9A 1KYIA 2JZ0A 3IECA 2O25A 1C7YA 1HT1E 1JR3E 3LCUA 1R4GA 2BWBA 1Y8GA 1VEGA 2L4FA 1DO0A 3FRHA 1G4AE 1VDLA 3T6PA 1VG5A 2DZLA 2RRUA 1WIVA 3H4JA 1HQYE 3B89A 1NV8A 1VQ1A 2K0BX 2MGWA 2LVAA 1QZEA 1WJ7A 2MROB 4GEWA 3FRIA 4R71A 4Q7JA 1WGLA 2DAKA 3E21A 1YLAA 2KHHA 4F2LA 2JY8A 2CP8A 1IM2A 3BBZA 3E46A 3LCVB 2JNHA 3MMPA 3K9OA 2HWJA 1F4IA 4WP2A 1ZMVA 2JY5A 1ZV1A 2OOBA 1G41A 2MJ5B 2LVNC 2R0IA 1P3QQ 2MR9A 2L4EA 2OOAA 3GLFE 2DAEA 2L2DA 3F92A 1AIPC 3IHPA 2CWBA 1GO5A 2DKLA 4UN2B 2B3TA 1ZMWA 1EFUB 1E94E 1G3IA 1WGNA 2QHOB 1VEKA 1MN3A 2ZTDA 2OO9A 1PGYA 1HJPA 2KNAA 1A5TA 3GLHE 1XB2B 2ZTCA 1XXHE 2BWEA 2JZ1A 1ZMUA 1WHCA 2LVOC 2H5XA 5JI2E 2G3QA 1OKSA 2KNVA 1OQYA 1OTRA 3K9PA
chains in the Genus database with same CATH superfamily
4M9SA 4M9XA 1Z5AA 3GLGE 4HL4A 3FTFA 3MK6A 3IG5A 1H6UA 1D0LA 1TR8A 4M9ZA 4XGIA 2V1UA 4WW0A 4QHSA 3VK8A 3L2AA 2DI0A 2JP7A 4JI4M 4L15A 2DHYA 2Z8YM 4IBJA 4DV4M 1BVSA 2R46A 4FWGA 2Y0TA 5FTKA 4X66M 3J27B 3AOEA 1DV0A 2EKKA 4F1IA 3LVVA 5EP4A 1JR3A 3U60A 3GLGA 2K9DA 3BXWA 5IZ7D 4IJFA 4D81A 1IFYA 4JI5M 2M5ZA 4B7FA 2WSEF 1N36M 3CTWB 2QCUA 3D8LA 2JUJA 3C9PA 1XC8A 3TWLA 3GLGB 2ZAOA 3OTOM 4L6V6 2C5RA 5EXSA 1NVMA 2QSFX 4M0WA 2R44A 4MH0E 3U6LA 1WR1B 3GLIB 4LRTA 4QOSA 2ERCA 2ZBKB 3PNVA 2UXBM 4DV5M 3JR5A 1IXSA 4CISA 1Z59A 3SYKA 4PDIA 2O25A 1C7YA 2ZM6M 2FS1A 1HT1E 3HJ8A 4LJ9A 3HX3A 3PNYA 3VDPA 1R4GA 1R2ZA 1GL6A 1OFIA 1K82A 3K8ZA 1VEGA 3HKPA 1L2DA 4DR5M 1JB0F 3TWKA 4BBAA 1PRBA 2R6FA 5IREB 4AW4A 1IBKM 2R4JA 3QWLA 3DZDA 5ITXE 2DZLA 2HCBA 2M60A 2EA0A 1DGHA 4JI0M 3FUWA 1TF0B 2Y20A 3H4JA 3L27A 2V1CA 3B89A 3KXEC 4DR1M 1L1ZA 3FUUA 4YY3M 4LJ6A 1NSFA 5FTMA 3DOAA 1IQPA 2F5NA 3FRIA 2F5QA 2D7EA 4QHTA 4DR3M 2DAKA 3GLFA 1IY2A 2LH0A 2JY8A 4LF8M 3W0FA 1L2CA 3AL0C 3WHKA 1NJGA 2CP8A 2R65A 4MM3B 2CHQA 2R45A 3LCVB 5EP2A 2VF8A 2JNHA 3MMPA 2KA6B 1XXHB 3U61B 2I7PA 1TGUA 5KQDA 2CV0A 2JY5A 3ZC7B 1Z6TA 3GQ5A 1P3QQ 2MR9A 2HKJA 4NL4H 3GLFE 4JI8M 2XLJA 2L2DA 3IHPA 2KZSA 3SAWA 1GO5A 4LJ8A 1SXJD 1DGGA 5EXTA 4G4QA 3HU3A 1EFUB 2XSZA 3HHZA 4LJ7A 1HNXM 1E94E 1Z5CA 2GQFA 3SATA 1W5SA 4OX9M 1Q3BA 4IBCA 4MGIE 3U6CA 1N34M 1PGYA 2X8AA 5KPZA 3SBJA 1GL7A 5BPVA 2UXCM 3SC3A 1IBMM 5E6JA 4DV6M 1K3WA 3GPUA 3QYEA 1WHCA 3T38A 3QYBA 1IXZA 2H5XA 5E26A 4PDGA 4ZPXA 1OKSA 4DUYM 4AKHA 4I81A 3GPPA 1OTRA 3T6PA 4LRSA 3K9PA 4GC5A 3HY5A 4W5WA 4JN6A 2DENA 3FUVA 2EKFA 2LVQD 5ITXA 3GLHB 4QNRA 2FFJA 4GKKM 2H1RA 2WZJA 1L2BA 1QANA 4AI6A 3KOZE 3FE3A 3KOXE 3SASA 3A45A 4DV3M 3I4YA 3J2PB 4IBDA 3LMMA 1PJIA 4R7GA 2YR0A 1SXJE 2G8LA 2JY6B 3GLIA 3R9XB 4QOZC 1I4WA 4LGYA 1MX0A 1QAOA 2DAMA 5FLXS 1J7KA 1OIPA 1PJQA 3U6PA 1DO2A 1G71A 4DBGB 2CV2A 2ZAMA 1TTEA 1OAIA 2DNAA 1Q02A 2L09A 4HEOA 3V76A 1HNWM 2D7GA 3AFHA 4CIZA 4DV0M 1R7RA 1SXJA 2QPAA 3C3EA 2XZFA 1Q39A 3GRRA 5EXPA 4G3OA 1IXSB 3HJQA 3WHLA 1VEJA 2MH8A 2KZUA 4NRVA 4A3VB 5IWAM 3TE6A 1SXJB 3M7GA 3AOGA 3UJNA 1QAMA 4XK8F 1JR3E 2BWBA 2L7IA 3U5ZA 3SHFA 4AQYM 4LG2A 3E4RA 2R4EA 4LCBA 1G4AE 1VDLA 3FYDA 3U6OA 2E5LM 3PXGA 3U5ZB 7CATA 1Q3CA 4OW0A 1WIVA 4MGKE 4I8OA 1XXHA 1HQYE 3PFIA 1IBLM 4IBBA 1NV8A 1C1KA 1VQ1A 3TWMA 2DWZB 1QZMA 2MGWA 4GMQA 1WJ7A 4IIWA 4R71A 2C99A 2Y0QA 4Q7JA 1GVNA 1N77A 3E21A 2Z4RA 4R3DA 4L78A 4YHHM 1YLAA 2LNHC 3RFWA 1QYRA 1SXJC 4LJ4A 5KQ8A 4LJ5A 2L7HA 3SFZA 3EIHA 3R8FA 3BBZA 3E46A 3D8BA 1JR3D 3J80S 1N32M 1OFHA 3U6EA 4DR4M 3K9OA 2HWJA 3L26A 4B3TM 4ITQA 4WP2A 3W68A 1ZMVA 2HHHM 1F4IA 2Z4SA 2OOBA 2CHVA 1LV7A 4JI6M 2R0IA 3ILKA 2OPFA 3RE8A 4DV2M 3SYLA 3BOSA 3GPXA 2CHGA 3I51A 2WSCF 2O01F 4GKJM 4D82A 4NSRA 3T1HM 1Z5BA 3CGWA 3FTDA 3DA1A 3MHVC 4BB9A 1R2YA 1OJLA 4II7A 1I94M 1IXRC 2J7NA 1DGFA 3HJSA 3NBXX 3UGJA 3KOWE 1G3IA 1WGNA 3HWSA 3KSXA 3I04M 4IBGA 3GLHA 4Y28F 2ZTDA 3VKHA 2KNAA 2LWXA 4HLQA 4D80A 2G5GX 2XF3A 2OQ4A 3U60B 2QZ4A 5A2QS 4B7HA 2K47A 2UUAM 3KS8A 4GITA 4AKGA 3GO8A 3H4MA 4LFBM 2DZOB 3DFZA 1E32A 3HGIA 2X49A 4G6ZA 5KO3A 3VFDA 4KODA 3KDSE 1OQYA 1OIZA 4AG6A 5FTJA 4PT5A 2HAKA 2YFQA 3FTCA 3U6SA 3CF0A 4LF5M 3KVWA 2LTUA 1S3SA 1IN5A 2A5YB 2C98A 4B08A 1TDHA 1R6BX 1UFZA 3KP0E 1XHBA 3SMSA 1TDZA 2FH0A 5C18A 5L8RF 2J7OA 3SHGB 2Y21A 3M6AA 4NSOB 3M0EA 1NNUC 2R18A 2CUZA 2RGHA 2XFTA 1HQCA 1T43A 1T3TA 2EJSA 3KP1E 2LBCA 2JY7A 4KLNA 5GKNA 4L8RC 4OVZB 2UUBM 1FJGM 1E9RA 1G8PA 3GRYA 1PJJA 3EIEA 2FOIC 4I5SA 4PCZA 5ITUA 3RGSA 1VDDA 2F5SA 3HU2A 2CEAA 1HT2E 1V92A 5KPRA 5C1BA 3HHWA 4IBKA 2QNJA 1J5EM 2UXDM 3ZH9B 2Z7JA 5EXXA 1SG9A 1CUKA 3Q8XA 2RKOA 1HR0M 2DWNA 2JZ0A 1JQJC 3Q8GA 2ZANA 3E9SA 4LZJA 1AUAA 2XGNA 3LQRA 3LCUA 2JXNA 3K1JA 1UM8A 3VK7A 2L4FA 3W67A 3CF6E 2JA2A 1QUTA 3FRHA 1IY1A 3JAMS 2VF7A 2DHRA 2VDBB 1TH3A 1VG5A 4NXMM 3B7QA 4FW9A 5ITYA 1PM5A 3CF2A 1E9SA 4LGMA 2QP9X 4K0KM 1V34A 1J09A 2K0BX 1ZAEA 1QZEA 2BJVA 2C9OA 1GKIA 1LTMA 2DVWB 2LVAA 5DYGA 3GPYA 1NJFA 2X4AA 3I01M 1GLNA 2N35A 4BLCA 4RNAA 1KFVA 5ITQA 5LMUM 1W5TA 3FKEA 4CJ6A 3B7NA 3HZJA 4JV5M 2XZUA 1ORYB 2VQFM 4JI7M 4FWDA 2R62A 4QNMA 3RGPA 5BR8M 1ZV1A 4G4NA 5ITTA 2VQEM 2MJ5B 2EUCA 4B3MM 1IN8A 4EIWA 4DR7M 2LXEA 2L4EA 2JWSA 2OOAA 1XNQM 2DAEA 3VKGA 3F92A 1AIPC 3J81S 3KS4A 1NNJA 2DKLA 2QQ8A 3FD9A 2KRUA 2XH9A 3U6MA 2DXIA 2B3TA 4L4UA 1NY6A 1ZMWA 3LQQA 4X62M 2Z3XA 4JI1M 2F5PA 4S12A 2XFSA 3KFUG 4JYAM 4TUWA 1N78A 3K2LA 1RU3A 2QHOB 3IG8A 1KSFX 1VEKA 2CV1A 2OO9A 2GNOA 2QBYA 1A5TA 4MB7A 1QQWA 3NBIA 4XBOA 1XB2B 4GC9A 3FYCA 4RF0A 1QDTA 1HNZM 2ZTCA 1QUSA 1NHGC 1PJTA 1XXHE 2BWEA 2JZ1A 3GP1A 2VIIA 5EJCA 1TH2A 4GIPA 1IN4A 2LVOC 5JI2E 1N75A 3UMMA 3TPZA 1GJSA 3A46A 3B74A 1MJGM 2KEBA 4IBIA 3SAUA 5KPTA 1K3XA 1EE8A 4LF6M 4OU7A 4MGYE 1GJTA 4MGHA 2DAIA 3QAUA 3SMPA 5DYIA 2KW0A 4CGYB 1QVRA 1ZQ9A 3HHXA 5DFLA 4ANRA 1XNRM 4GH9A 4KO8A 4WURA 3AKZA 2KNZA 3LW5F 2DAGA 2LVPC 4FCWA 4FCVA 4NC6A 4G4OA 2W82A 4DR2M 1EIJA 4MGZE 3GLIE 4KHPM 1T6OA 2WSFF 2CE7A 2FE8A 4IJEA 3ZCBB 3SARA 1IN6A 4AKIA 2FNAA 4AZFA 3VDUA 5EQTA 1N33M 2HL7A 4DV7M 5EP3A 1MU5A 1IY0A 2C9CA 1V33A 4PD2A 4DR6M 1YSYA 2APLA 4AG5A 4DV1M 3L29A 4M0DA 4FWHA 4GHLA 4NXNM 1G59A 3T1YM 5ITRA 2P5TA 2KRKA 4X64M 5LMNM 1XWIA 1NV9A 2J5YA 2XSZD 4Z6YA 1KYIA 3IECA 4DUZM 3GRVA 4FVMA 4IBFA 3GQ3A 4NRWA 4LF7M 5DNYA 3A98B 4FD2A 1YE9A 1Y8GA 4KT0F 4LZZA 5IT9S 3I4VA 2O5RA 1DO0A 5EP1A 1NY5A 4Z8XA 3JR4A 3VLFB 3AV0A 3AJIB 4GHAA 3L25A 4L16A 3THGA 3FUXA 5H37D 2DZNB 4NOOB 3TL4X 4LF9M 2AHMA 4B7GA 2RRUA 3TQSA 1OAOC 3A42A 5F3WA 3HU1A 4JXJA 1WXQA 4G4RA 3K92A 4JI2M 2MROB 4GEWA 4CHTB 3GQ4A 2UUCM 4B3RM 1WGLA 2LHCA 2YNMD 2C96A 5FSWA 1XMQM 3FTEA 1GABA 2KHHA 3MJ5A 1FNNA 3LVWA 1D0MA 4GRIA 4F2LA 3GLFB 2UU9M 2F5OA 4B3SM 3B7ZA 2BJWA 1X37A 3FUTA 4LFAM 2KDLA 3UZUA 1QDRA 1IM2A 3J7AS 1DGHB 3U6DA 1L1TA 3NWLA 4IBEA 4LJAA 3UK6A 1YUBA 3U61A 3KSJA 3SAVA 4REZA 2QENA 3L28A 4FCTA 1G41A 3KW6A 8CATA 1IN7A 2LVNC 1XMOM 4RF1A 3KOYE 5FTLA 1DGBA 4LY6A 2DWMA 2NQ8C 1QAQA 1D2NA 3J7BA 2XEPA 3W0LB 4RKUF 2CWBA 3B9PA 3GRUA 2BNKA 2K6BA 3HHYA 4UN2B 3AOEC 2Q2EB 2KXEA 2I7NA 1R5LA 2EO2A 4JI3M 5JI3E 2LHGA 1L8QA 4X65M 4P17A 1NO1A 4I4LA 1MN3A 2QBYB 4LFCM 1HJPA 1PJSA 2CFOA 3C58A 3C3DA 3GLHE 1NHWC 4LF4M 2L6OA 2RGOA 3T15A 2D7HA 3U6QA 1ZMUA 2V6ZM 2DWLA 3PVSA 5FTNA 2G3QA 1TH4A 2CRUA 4OVZA 3ZQJA 1D0KA 2KNVA 2YQZA 4P16A 2F4VM
chains in the Genus database with same CATH topology
2HAKA 3GLGE 2DENA 2EKFA 2LVQD 1TR8A 2DAIA 2WZJA 3FE3A 2LTUA 5DFLA 2DI0A 2JP7A 1UFZA 2DHYA 2KNZA 2DAGA 2LVPC 2JY6B 1BVSA 2DAMA 3GLIE 1DV0A 2EKKA 4F1IA 1T6OA 2K9DA 1IFYA 1DO2A 1T43A 4DBGB 2EJSA 1TTEA 2JUJA 1OAIA 2JY7A 2LBCA 2DNAA 1Q02A 4HEOA 2QSFX 1HT2E 1V92A 1WR1B 4G3OA 2QNJA 1VEJA 1SG9A 1CUKA 1IXSA 1NV9A 1KYIA 2JZ0A 3IECA 2O25A 1C7YA 1HT1E 1JR3E 3LCUA 1R4GA 2BWBA 1Y8GA 1VEGA 2L4FA 1DO0A 3FRHA 1G4AE 1VDLA 3T6PA 1VG5A 2DZLA 2RRUA 1WIVA 3H4JA 1HQYE 3B89A 1NV8A 1VQ1A 2K0BX 2MGWA 2LVAA 1QZEA 1WJ7A 2MROB 4GEWA 3FRIA 4R71A 4Q7JA 1WGLA 2DAKA 3E21A 1YLAA 2KHHA 4F2LA 2JY8A 2CP8A 1IM2A 3BBZA 3E46A 3LCVB 2JNHA 3MMPA 3K9OA 2HWJA 1F4IA 4WP2A 1ZMVA 2JY5A 1ZV1A 2OOBA 1G41A 2MJ5B 2LVNC 2R0IA 1P3QQ 2MR9A 2L4EA 2OOAA 3GLFE 2DAEA 2L2DA 3F92A 1AIPC 3IHPA 2CWBA 1GO5A 2DKLA 4UN2B 2B3TA 1ZMWA 1EFUB 1E94E 1G3IA 1WGNA 2QHOB 1VEKA 1MN3A 2ZTDA 2OO9A 1PGYA 1HJPA 2KNAA 1A5TA 3GLHE 1XB2B 2ZTCA 1XXHE 2BWEA 2JZ1A 1ZMUA 1WHCA 2LVOC 2H5XA 5JI2E 2G3QA 1OKSA 2KNVA 1OQYA 1OTRA 3K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HAK A;  3GLG E;  2DEN A;  2EKF A;  2LVQ D;  1TR8 A;  2DAI A;  2WZJ A;  3FE3 A;  2LTU A;  5DFL A;  2DI0 A;  2JP7 A;  1UFZ A;  2DHY A;  2KNZ A;  2DAG A;  2LVP C;  2JY6 B;  1BVS A;  2DAM A;  3GLI E;  1DV0 A;  2EKK A;  4F1I A;  1T6O A;  2K9D A;  1IFY A;  1DO2 A;  1T43 A;  4DBG B;  2EJS A;  1TTE A;  2JUJ A;  1OAI A;  2JY7 A;  2LBC A;  2DNA A;  1Q02 A;  4HEO A;  2QSF X;  1HT2 E;  1V92 A;  1WR1 B;  4G3O A;  2QNJ A;  1VEJ A;  1SG9 A;  1CUK A;  1IXS A;  1NV9 A;  1KYI A;  2JZ0 A;  3IEC A;  2O25 A;  1C7Y A;  1HT1 E;  1JR3 E;  3LCU A;  1R4G A;  2BWB A;  1Y8G A;  1VEG A;  2L4F A;  1DO0 A;  3FRH A;  1G4A E;  1VDL A;  3T6P A;  1VG5 A;  2DZL A;  2RRU A;  1WIV A;  3H4J A;  1HQY E;  3B89 A;  1NV8 A;  1VQ1 A;  2K0B X;  2MGW A;  2LVA A;  1QZE A;  1WJ7 A;  2MRO B;  4GEW A;  3FRI A;  4R71 A;  4Q7J A;  1WGL A;  2DAK A;  3E21 A;  1YLA A;  2KHH A;  4F2L A;  2JY8 A;  2CP8 A;  1IM2 A;  3BBZ A;  3E46 A;  3LCV B;  2JNH A;  3MMP A;  3K9O A;  2HWJ A;  1F4I A;  4WP2 A;  1ZMV A;  2JY5 A;  1ZV1 A;  2OOB A;  1G41 A;  2MJ5 B;  2LVN C;  2R0I A;  1P3Q Q;  2MR9 A;  2L4E A;  2OOA A;  3GLF E;  2DAE A;  2L2D A;  3F92 A;  1AIP C;  3IHP A;  2CWB A;  1GO5 A;  2DKL A;  4UN2 B;  2B3T A;  1ZMW A;  1EFU B;  1E94 E;  1G3I A;  1WGN A;  2QHO B;  1VEK A;  1MN3 A;  2ZTD A;  2OO9 A;  1PGY A;  1HJP A;  2KNA A;  1A5T A;  3GLH E;  1XB2 B;  2ZTC A;  1XXH E;  2BWE A;  2JZ1 A;  1ZMU A;  1WHC A;  2LVO C;  2H5X A;  5JI2 E;  2G3Q A;  1OKS A;  2KNV A;  1OQY A;  1OTR A;  3K9P A; 
#chains in the Genus database with same CATH topology
 4M9S A;  4M9X A;  1Z5A A;  3GLG E;  4HL4 A;  3FTF A;  3MK6 A;  3IG5 A;  1H6U A;  1D0L A;  1TR8 A;  4M9Z A;  4XGI A;  2V1U A;  4WW0 A;  4QHS A;  3VK8 A;  3L2A A;  2DI0 A;  2JP7 A;  4JI4 M;  4L15 A;  2DHY A;  2Z8Y M;  4IBJ A;  4DV4 M;  1BVS A;  2R46 A;  4FWG A;  2Y0T A;  5FTK A;  4X66 M;  3J27 B;  3AOE A;  1DV0 A;  2EKK A;  4F1I A;  3LVV A;  5EP4 A;  1JR3 A;  3U60 A;  3GLG A;  2K9D A;  3BXW A;  5IZ7 D;  4IJF A;  4D81 A;  1IFY A;  4JI5 M;  2M5Z A;  4B7F A;  2WSE F;  1N36 M;  3CTW B;  2QCU A;  3D8L A;  2JUJ A;  3C9P A;  1XC8 A;  3TWL A;  3GLG B;  2ZAO A;  3OTO M;  4L6V 6;  2C5R A;  5EXS A;  1NVM A;  2QSF X;  4M0W A;  2R44 A;  4MH0 E;  3U6L A;  1WR1 B;  3GLI B;  4LRT A;  4QOS A;  2ERC A;  2ZBK B;  3PNV A;  2UXB M;  4DV5 M;  3JR5 A;  1IXS A;  4CIS A;  1Z59 A;  3SYK A;  4PDI A;  2O25 A;  1C7Y A;  2ZM6 M;  2FS1 A;  1HT1 E;  3HJ8 A;  4LJ9 A;  3HX3 A;  3PNY A;  3VDP A;  1R4G A;  1R2Z A;  1GL6 A;  1OFI A;  1K82 A;  3K8Z A;  1VEG A;  3HKP A;  1L2D A;  4DR5 M;  1JB0 F;  3TWK A;  4BBA A;  1PRB A;  2R6F A;  5IRE B;  4AW4 A;  1IBK M;  2R4J A;  3QWL A;  3DZD A;  5ITX E;  2DZL A;  2HCB A;  2M60 A;  2EA0 A;  1DGH A;  4JI0 M;  3FUW A;  1TF0 B;  2Y20 A;  3H4J A;  3L27 A;  2V1C A;  3B89 A;  3KXE C;  4DR1 M;  1L1Z A;  3FUU A;  4YY3 M;  4LJ6 A;  1NSF A;  5FTM A;  3DOA A;  1IQP A;  2F5N A;  3FRI A;  2F5Q A;  2D7E A;  4QHT A;  4DR3 M;  2DAK A;  3GLF A;  1IY2 A;  2LH0 A;  2JY8 A;  4LF8 M;  3W0F A;  1L2C A;  3AL0 C;  3WHK A;  1NJG A;  2CP8 A;  2R65 A;  4MM3 B;  2CHQ A;  2R45 A;  3LCV B;  5EP2 A;  2VF8 A;  2JNH A;  3MMP A;  2KA6 B;  1XXH B;  3U61 B;  2I7P A;  1TGU A;  5KQD A;  2CV0 A;  2JY5 A;  3ZC7 B;  1Z6T A;  3GQ5 A;  1P3Q Q;  2MR9 A;  2HKJ A;  4NL4 H;  3GLF E;  4JI8 M;  2XLJ A;  2L2D A;  3IHP A;  2KZS A;  3SAW A;  1GO5 A;  4LJ8 A;  1SXJ D;  1DGG A;  5EXT A;  4G4Q A;  3HU3 A;  1EFU B;  2XSZ A;  3HHZ A;  4LJ7 A;  1HNX M;  1E94 E;  1Z5C A;  2GQF A;  3SAT A;  1W5S A;  4OX9 M;  1Q3B A;  4IBC A;  4MGI E;  3U6C A;  1N34 M;  1PGY A;  2X8A A;  5KPZ A;  3SBJ A;  1GL7 A;  5BPV A;  2UXC M;  3SC3 A;  1IBM M;  5E6J A;  4DV6 M;  1K3W A;  3GPU A;  3QYE A;  1WHC A;  3T38 A;  3QYB A;  1IXZ A;  2H5X A;  5E26 A;  4PDG A;  4ZPX A;  1OKS A;  4DUY M;  4AKH A;  4I81 A;  3GPP A;  1OTR A;  3T6P A;  4LRS A;  3K9P A;  4GC5 A;  3HY5 A;  4W5W A;  4JN6 A;  2DEN A;  3FUV A;  2EKF A;  2LVQ D;  5ITX A;  3GLH B;  4QNR A;  2FFJ A;  4GKK M;  2H1R A;  2WZJ A;  1L2B A;  1QAN A;  4AI6 A;  3KOZ E;  3FE3 A;  3KOX E;  3SAS A;  3A45 A;  4DV3 M;  3I4Y A;  3J2P B;  4IBD A;  3LMM A;  1PJI A;  4R7G A;  2YR0 A;  1SXJ E;  2G8L A;  2JY6 B;  3GLI A;  3R9X B;  4QOZ C;  1I4W A;  4LGY A;  1MX0 A;  1QAO A;  2DAM A;  5FLX S;  1J7K A;  1OIP A;  1PJQ A;  3U6P A;  1DO2 A;  1G71 A;  4DBG B;  2CV2 A;  2ZAM A;  1TTE A;  1OAI A;  2DNA A;  1Q02 A;  2L09 A;  4HEO A;  3V76 A;  1HNW M;  2D7G A;  3AFH A;  4CIZ A;  4DV0 M;  1R7R A;  1SXJ A;  2QPA A;  3C3E A;  2XZF A;  1Q39 A;  3GRR A;  5EXP A;  4G3O A;  1IXS B;  3HJQ A;  3WHL A;  1VEJ A;  2MH8 A;  2KZU A;  4NRV A;  4A3V B;  5IWA M;  3TE6 A;  1SXJ B;  3M7G A;  3AOG A;  3UJN A;  1QAM A;  4XK8 F;  1JR3 E;  2BWB A;  2L7I A;  3U5Z A;  3SHF A;  4AQY M;  4LG2 A;  3E4R A;  2R4E A;  4LCB A;  1G4A E;  1VDL A;  3FYD A;  3U6O A;  2E5L M;  3PXG A;  3U5Z B;  7CAT A;  1Q3C A;  4OW0 A;  1WIV A;  4MGK E;  4I8O A;  1XXH A;  1HQY E;  3PFI A;  1IBL M;  4IBB A;  1NV8 A;  1C1K A;  1VQ1 A;  3TWM A;  2DWZ B;  1QZM A;  2MGW A;  4GMQ A;  1WJ7 A;  4IIW A;  4R71 A;  2C99 A;  2Y0Q A;  4Q7J A;  1GVN A;  1N77 A;  3E21 A;  2Z4R A;  4R3D A;  4L78 A;  4YHH M;  1YLA A;  2LNH C;  3RFW A;  1QYR A;  1SXJ C;  4LJ4 A;  5KQ8 A;  4LJ5 A;  2L7H A;  3SFZ A;  3EIH A;  3R8F A;  3BBZ A;  3E46 A;  3D8B A;  1JR3 D;  3J80 S;  1N32 M;  1OFH A;  3U6E A;  4DR4 M;  3K9O A;  2HWJ A;  3L26 A;  4B3T M;  4ITQ A;  4WP2 A;  3W68 A;  1ZMV A;  2HHH M;  1F4I A;  2Z4S A;  2OOB A;  2CHV A;  1LV7 A;  4JI6 M;  2R0I A;  3ILK A;  2OPF A;  3RE8 A;  4DV2 M;  3SYL A;  3BOS A;  3GPX A;  2CHG A;  3I51 A;  2WSC F;  2O01 F;  4GKJ M;  4D82 A;  4NSR A;  3T1H M;  1Z5B A;  3CGW A;  3FTD A;  3DA1 A;  3MHV C;  4BB9 A;  1R2Y A;  1OJL A;  4II7 A;  1I94 M;  1IXR C;  2J7N A;  1DGF A;  3HJS A;  3NBX X;  3UGJ A;  3KOW E;  1G3I A;  1WGN A;  3HWS A;  3KSX A;  3I04 M;  4IBG A;  3GLH A;  4Y28 F;  2ZTD A;  3VKH A;  2KNA A;  2LWX A;  4HLQ A;  4D80 A;  2G5G X;  2XF3 A;  2OQ4 A;  3U60 B;  2QZ4 A;  5A2Q S;  4B7H A;  2K47 A;  2UUA M;  3KS8 A;  4GIT A;  4AKG A;  3GO8 A;  3H4M A;  4LFB M;  2DZO B;  3DFZ A;  1E32 A;  3HGI A;  2X49 A;  4G6Z A;  5KO3 A;  3VFD A;  4KOD A;  3KDS E;  1OQY A;  1OIZ A;  4AG6 A;  5FTJ A;  4PT5 A;  2HAK A;  2YFQ A;  3FTC A;  3U6S A;  3CF0 A;  4LF5 M;  3KVW A;  2LTU A;  1S3S A;  1IN5 A;  2A5Y B;  2C98 A;  4B08 A;  1TDH A;  1R6B X;  1UFZ A;  3KP0 E;  1XHB A;  3SMS A;  1TDZ A;  2FH0 A;  5C18 A;  5L8R F;  2J7O A;  3SHG B;  2Y21 A;  3M6A A;  4NSO B;  3M0E A;  1NNU C;  2R18 A;  2CUZ A;  2RGH A;  2XFT A;  1HQC A;  1T43 A;  1T3T A;  2EJS A;  3KP1 E;  2LBC A;  2JY7 A;  4KLN A;  5GKN A;  4L8R C;  4OVZ B;  2UUB M;  1FJG M;  1E9R A;  1G8P A;  3GRY A;  1PJJ A;  3EIE A;  2FOI C;  4I5S A;  4PCZ A;  5ITU A;  3RGS A;  1VDD A;  2F5S A;  3HU2 A;  2CEA A;  1HT2 E;  1V92 A;  5KPR A;  5C1B A;  3HHW A;  4IBK A;  2QNJ A;  1J5E M;  2UXD M;  3ZH9 B;  2Z7J A;  5EXX A;  1SG9 A;  1CUK A;  3Q8X A;  2RKO A;  1HR0 M;  2DWN A;  2JZ0 A;  1JQJ C;  3Q8G A;  2ZAN A;  3E9S A;  4LZJ A;  1AUA A;  2XGN A;  3LQR A;  3LCU A;  2JXN A;  3K1J A;  1UM8 A;  3VK7 A;  2L4F A;  3W67 A;  3CF6 E;  2JA2 A;  1QUT A;  3FRH A;  1IY1 A;  3JAM S;  2VF7 A;  2DHR A;  2VDB B;  1TH3 A;  1VG5 A;  4NXM M;  3B7Q A;  4FW9 A;  5ITY A;  1PM5 A;  3CF2 A;  1E9S A;  4LGM A;  2QP9 X;  4K0K M;  1V34 A;  1J09 A;  2K0B X;  1ZAE A;  1QZE A;  2BJV A;  2C9O A;  1GKI A;  1LTM A;  2DVW B;  2LVA A;  5DYG A;  3GPY A;  1NJF A;  2X4A A;  3I01 M;  1GLN A;  2N35 A;  4BLC A;  4RNA A;  1KFV A;  5ITQ A;  5LMU M;  1W5T A;  3FKE A;  4CJ6 A;  3B7N A;  3HZJ A;  4JV5 M;  2XZU A;  1ORY B;  2VQF M;  4JI7 M;  4FWD A;  2R62 A;  4QNM A;  3RGP A;  5BR8 M;  1ZV1 A;  4G4N A;  5ITT A;  2VQE M;  2MJ5 B;  2EUC A;  4B3M M;  1IN8 A;  4EIW A;  4DR7 M;  2LXE A;  2L4E A;  2JWS A;  2OOA A;  1XNQ M;  2DAE A;  3VKG A;  3F92 A;  1AIP C;  3J81 S;  3KS4 A;  1NNJ A;  2DKL A;  2QQ8 A;  3FD9 A;  2KRU A;  2XH9 A;  3U6M A;  2DXI A;  2B3T A;  4L4U A;  1NY6 A;  1ZMW A;  3LQQ A;  4X62 M;  2Z3X A;  4JI1 M;  2F5P A;  4S12 A;  2XFS A;  3KFU G;  4JYA M;  4TUW A;  1N78 A;  3K2L A;  1RU3 A;  2QHO B;  3IG8 A;  1KSF X;  1VEK A;  2CV1 A;  2OO9 A;  2GNO A;  2QBY A;  1A5T A;  4MB7 A;  1QQW A;  3NBI A;  4XBO A;  1XB2 B;  4GC9 A;  3FYC A;  4RF0 A;  1QDT A;  1HNZ M;  2ZTC A;  1QUS A;  1NHG C;  1PJT A;  1XXH E;  2BWE A;  2JZ1 A;  3GP1 A;  2VII A;  5EJC A;  1TH2 A;  4GIP A;  1IN4 A;  2LVO C;  5JI2 E;  1N75 A;  3UMM A;  3TPZ A;  1GJS A;  3A46 A;  3B74 A;  1MJG M;  2KEB A;  4IBI A;  3SAU A;  5KPT A;  1K3X A;  1EE8 A;  4LF6 M;  4OU7 A;  4MGY E;  1GJT A;  4MGH A;  2DAI A;  3QAU A;  3SMP A;  5DYI A;  2KW0 A;  4CGY B;  1QVR A;  1ZQ9 A;  3HHX A;  5DFL A;  4ANR A;  1XNR M;  4GH9 A;  4KO8 A;  4WUR A;  3AKZ A;  2KNZ A;  3LW5 F;  2DAG A;  2LVP C;  4FCW A;  4FCV A;  4NC6 A;  4G4O A;  2W82 A;  4DR2 M;  1EIJ A;  4MGZ E;  3GLI E;  4KHP M;  1T6O A;  2WSF F;  2CE7 A;  2FE8 A;  4IJE A;  3ZCB B;  3SAR A;  1IN6 A;  4AKI A;  2FNA A;  4AZF A;  3VDU A;  5EQT A;  1N33 M;  2HL7 A;  4DV7 M;  5EP3 A;  1MU5 A;  1IY0 A;  2C9C A;  1V33 A;  4PD2 A;  4DR6 M;  1YSY A;  2APL A;  4AG5 A;  4DV1 M;  3L29 A;  4M0D A;  4FWH A;  4GHL A;  4NXN M;  1G59 A;  3T1Y M;  5ITR A;  2P5T A;  2KRK A;  4X64 M;  5LMN M;  1XWI A;  1NV9 A;  2J5Y A;  2XSZ D;  4Z6Y A;  1KYI A;  3IEC A;  4DUZ M;  3GRV A;  4FVM A;  4IBF A;  3GQ3 A;  4NRW A;  4LF7 M;  5DNY A;  3A98 B;  4FD2 A;  1YE9 A;  1Y8G A;  4KT0 F;  4LZZ A;  5IT9 S;  3I4V A;  2O5R A;  1DO0 A;  5EP1 A;  1NY5 A;  4Z8X A;  3JR4 A;  3VLF B;  3AV0 A;  3AJI B;  4GHA A;  3L25 A;  4L16 A;  3THG A;  3FUX A;  5H37 D;  2DZN B;  4NOO B;  3TL4 X;  4LF9 M;  2AHM A;  4B7G A;  2RRU A;  3TQS A;  1OAO C;  3A42 A;  5F3W A;  3HU1 A;  4JXJ A;  1WXQ A;  4G4R A;  3K92 A;  4JI2 M;  2MRO B;  4GEW A;  4CHT B;  3GQ4 A;  2UUC M;  4B3R M;  1WGL A;  2LHC A;  2YNM D;  2C96 A;  5FSW A;  1XMQ M;  3FTE A;  1GAB A;  2KHH A;  3MJ5 A;  1FNN A;  3LVW A;  1D0M A;  4GRI A;  4F2L A;  3GLF B;  2UU9 M;  2F5O A;  4B3S M;  3B7Z A;  2BJW A;  1X37 A;  3FUT A;  4LFA M;  2KDL A;  3UZU A;  1QDR A;  1IM2 A;  3J7A S;  1DGH B;  3U6D A;  1L1T A;  3NWL A;  4IBE A;  4LJA A;  3UK6 A;  1YUB A;  3U61 A;  3KSJ A;  3SAV A;  4REZ A;  2QEN A;  3L28 A;  4FCT A;  1G41 A;  3KW6 A;  8CAT A;  1IN7 A;  2LVN C;  1XMO M;  4RF1 A;  3KOY E;  5FTL A;  1DGB A;  4LY6 A;  2DWM A;  2NQ8 C;  1QAQ A;  1D2N A;  3J7B A;  2XEP A;  3W0L B;  4RKU F;  2CWB A;  3B9P A;  3GRU A;  2BNK A;  2K6B A;  3HHY A;  4UN2 B;  3AOE C;  2Q2E B;  2KXE A;  2I7N A;  1R5L A;  2EO2 A;  4JI3 M;  5JI3 E;  2LHG A;  1L8Q A;  4X65 M;  4P17 A;  1NO1 A;  4I4L A;  1MN3 A;  2QBY B;  4LFC M;  1HJP A;  1PJS A;  2CFO A;  3C58 A;  3C3D A;  3GLH E;  1NHW C;  4LF4 M;  2L6O A;  2RGO A;  3T15 A;  2D7H A;  3U6Q A;  1ZMU A;  2V6Z M;  2DWL A;  3PVS A;  5FTN A;  2G3Q A;  1TH4 A;  2CRU A;  4OVZ A;  3ZQJ A;  1D0K A;  2KNV A;  2YQZ A;  4P16 A;  2F4V M; 
#chains in the Genus database with same CATH homology
 2HAK A;  3GLG E;  2DEN A;  2EKF A;  2LVQ D;  1TR8 A;  2DAI A;  2WZJ A;  3FE3 A;  2LTU A;  5DFL A;  2DI0 A;  2JP7 A;  1UFZ A;  2DHY A;  2KNZ A;  2DAG A;  2LVP C;  2JY6 B;  1BVS A;  2DAM A;  3GLI E;  1DV0 A;  2EKK A;  4F1I A;  1T6O A;  2K9D A;  1IFY A;  1DO2 A;  1T43 A;  4DBG B;  2EJS A;  1TTE A;  2JUJ A;  1OAI A;  2JY7 A;  2LBC A;  2DNA A;  1Q02 A;  4HEO A;  2QSF X;  1HT2 E;  1V92 A;  1WR1 B;  4G3O A;  2QNJ A;  1VEJ A;  1SG9 A;  1CUK A;  1IXS A;  1NV9 A;  1KYI A;  2JZ0 A;  3IEC A;  2O25 A;  1C7Y A;  1HT1 E;  1JR3 E;  3LCU A;  1R4G A;  2BWB A;  1Y8G A;  1VEG A;  2L4F A;  1DO0 A;  3FRH A;  1G4A E;  1VDL A;  3T6P A;  1VG5 A;  2DZL A;  2RRU A;  1WIV A;  3H4J A;  1HQY E;  3B89 A;  1NV8 A;  1VQ1 A;  2K0B X;  2MGW A;  2LVA A;  1QZE A;  1WJ7 A;  2MRO B;  4GEW A;  3FRI A;  4R71 A;  4Q7J A;  1WGL A;  2DAK A;  3E21 A;  1YLA A;  2KHH A;  4F2L A;  2JY8 A;  2CP8 A;  1IM2 A;  3BBZ A;  3E46 A;  3LCV B;  2JNH A;  3MMP A;  3K9O A;  2HWJ A;  1F4I A;  4WP2 A;  1ZMV A;  2JY5 A;  1ZV1 A;  2OOB A;  1G41 A;  2MJ5 B;  2LVN C;  2R0I A;  1P3Q Q;  2MR9 A;  2L4E A;  2OOA A;  3GLF E;  2DAE A;  2L2D A;  3F92 A;  1AIP C;  3IHP A;  2CWB A;  1GO5 A;  2DKL A;  4UN2 B;  2B3T A;  1ZMW A;  1EFU B;  1E94 E;  1G3I A;  1WGN A;  2QHO B;  1VEK A;  1MN3 A;  2ZTD A;  2OO9 A;  1PGY A;  1HJP A;  2KNA A;  1A5T A;  3GLH E;  1XB2 B;  2ZTC A;  1XXH E;  2BWE A;  2JZ1 A;  1ZMU A;  1WHC A;  2LVO C;  2H5X A;  5JI2 E;  2G3Q A;  1OKS A;  2KNV A;  1OQY A;  1OTR A;  3K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...