2MRPA

Nmr solution structure of the ubiquitin like domain (ubl) of dna-damage-inducible 1 protein (ddi1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
DLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA damage-inducible protein 1
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding protein
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mrpA00
1V5TA 2ZPNA 3UGBB 3AU5A 1S1QB 4IG7B 3PVLA 1WZ0A 3KUZA 1ZW7A 3D32A 2V3SA 4MH0E 2MP2B 4FBJB 3A1QB 1UZXB 4MEMA 3VAWA 1G6JA 2MRPA 2OOBB 2MP2A 2MWSB 5LLIA 3Q3FA 4XZ4A 2PJHA 2LGXA 4FADA 1WYWB 1KM7A 2M17A 1F9JA 2OJRA 3DVNU 4DBGA 3WA0A 2DENB 5L95C 1UH6A 5D6JB 2KQ7A 3M62B 2ZNVC 3PRZA 3JW0X 5E6NA 2IBIB 3KYCD 1WFYA 3PS6A 2KWUB 3VH3B 3ZNHB 5CTRC 1EF1A 5JHBA 1C3TA 1KJTA 3DBSA 1CMXB 1NDDA 3L0WB 5E6PA 3QIJA 3NZUA 2D2QA 4FHJA 3IBEA 3L16A 3PSEB 3IVFA 4PS7A 5JZEB 1R4NI 1WJ4A 2CHWA 2AYOB 2GOWA 2KQSA 1D3ZA 1Z5SB 3V60A 1L2NA 3EC8A 5AZHA 5CHWA 2I1JA 1WMHB 1Z2MA 1OEYA 3UQBA 5AEKB 2K8BA 4MJSA 1WMHA 1LM8B 3U8ZA 3PREA 4GDKA 4MGKE 5GMVA 2WDTB 4XX5A 2UYZB 1BT0A 4ICVA 4IM2A 4FLHA 4XC2A 2JUOA 3ZDTA 4HPLB 2LWPA 4G0NB 4FA6A 2K8CA 2L0TA 3DOWA 1WJNA 3JVZX 2JRIB 4M8MA 3ZRFA 2DX5B 3AU4A 1E7UA 2N9PC 3L17A 3MTNB 4J6IA 3V6CB 2KTFA 4MSQB 4I6LB 2IYDB 2NS5A 2XK5B 2NBWB 2J0KA 2M8SA 5CHVC 4HPMB 5DCNA 3ZO5B 4DHZE 1WE7A 5CX3A 2KMAA 5IAAC 1GJZA 4MM3A 2IZVB 4F7ZA 3WAOA 2DAFA 3V61A 3ECIA 4E71A 4HDQA 4AOFA 2KDEB 2LVQA 1WGYA 2FUHB 4AJWA 4TV3A 2LUEA 2K6DB 3W1YA 3RYTA 3VUXA 4W9EA 2EMTA 3X23A 3N32A 2C7MB 2L3ZA 3KYDD 3W1SA 4DHJB 2GBMA 3U7DA 2Z0EB 4JIOU 2K6QA 3IG3A 1UD7A 3LDZE 4B6WA 1XT9B 2KTRB 3KUDB 4URKA 2KOXA 4IW0A 1WX9A 3H7PA 2EKEC 4GU2A 2KJ6A 2KTRA 4PYZA 3PT2B 4E74A 4WAAA 2Y5BB 3JSVA 5TR5A 3WALA 2DZIA 2HJ8A 3I3TB 2A4ZA 5HKHA 2BGFA 3RZWC 4EUTA 3LJ3A 3HM3A 3MHSD 1V80A 2N7DA 2NPTB 2M4NA 1J8CA 2J7QB 2ZVNA 2I1KA 4BVUC 5DPWA 2NPTA 3GZNI 3WIMA 2FIDA 1RRBA 1YX5B 1JRUA 2DHZA 1WZ3A 2IY0B 1WX7A 3VXWA 1OEYJ 1WGHA 2HTHA 2L7RA 4JQWC 3B08A 2C7HA 4G3XB 3L10B 3AULA 2N4FA 4KIKB 1RFAA 1WRDB 2PPHA 3C0RB 4ANVA 4TUUA 4JLCA 4KIKA 5C23A 3VTVA 5FR6A 3U30A 2LI5A 4DXAB 1I42A 1SGHA 2MBBB 3KW5B 2NR2A 4A3OA 1TGZB 2LJ5A 4GOCA 3ML8A 5AZFA 3CSTA 1P98A 2FCNA 3TIXA 3ZTCA 4GXBA 2AWTA 2L05A 2NCNA 2PE9A 4BBNC 1WGRA 4K1RB 3TL5A 1OTRB 2DYMA 3A1QA 3KUCB 3N30A 1YJ1A 4K7UA 2Z0DB 2JT4B 2RSUA 4ICUA 4IWOA 3ZUNA 2KFJA 1E8YA 2GMIC 4TQ0A 1S3SG 4BOZB 1VCBA 3ZIMA 2KDBA 2KWCA 5IA7A 2XEWA 2KKCA 2BYEA 5G55A 1EF5A 1OGWA 2NVUI 2O6VD 3A9JB 1UGMA 1WY8A 2KFKB 3KVFB 3PRMB 4N9F4 1GNUA 2IO3B 2KJRA 2MBQA 2ZNVB 2JRHA 3QJZA 3HHMA 3ZKJC 3PGEA 3ZRCA 3EECA 1WE6A 4HLEA 3HIZA 3ZNZB 2RD0A 2D11A 2N1WA 4EZLA 2BPSA 2YLMA 4ANUA 4DWFA 1Y8RC 1V5OA 4DHZB 5D2MB 3EFUA 1EO6A 3O65B 4GB9A 4M8NA 5AZGA 2C7NB 2R2QA 4NJ7A 4BKSD 2K25A 2GBKA 1XQQA 3DBRI 4ZRKA 4I6NB 4KZCA 2L76A 3ALBA 1J19A 4HCPB 2KZRA 3CMMB 1UBQA 1X1MA 2KNBA 3UIPB 1P0RA 3QARA 1QZEA 3RD2A 3WANA 4LDTD 3IHPC 2MA9B 4B95A 4OVVA 3VHTC 2CS4A 4F8CB 2VRRB 3ZVVA 1KLVA 1TTNA 2BWFA 2IO1B 1R4MI 2BYFA 4LCDE 2UWQA 2V1YA 1TZ1A 2KLGA 4WJPA 4WQOB 2EMSA 1WGGA 2AL3A 1GG3A 4IM3A 4IWQA 2K1FA 2M0XA 4IM0A 3APCA 2XK5A 4IUMB 4X57B 2BKFA 2ZCCA 3VQIA 2ZCBA 4FJVB 4II2B 3V62A 3RZFA 3PZDA 3BY4B 4KDLB 3ZLZA 2JVCA 2KJHB 2MQJA 3QA8A 3A4RA 2MCNB 3B1LX 2KC2A 3DDCB 3SU8X 2D3GA 2HE7A 3QHTA 5BO4B 3R7RA 2MLBA 3A4SC 3GOEA 3UIOB 4I6PA 3R7QA 3NOBA 2G45B 4K7SA 4ANWA 4ASWC 1YIWA 3DQVA 1NBFC 3DCGA 4GDLB 2G4SA 4RM8A 3RULA 1HE8A 3R66C 1AARA 4GDLA 3HM6X 1IPGA 5JHAA 4HJKA 3PHWB 2LRUA 3NZSA 3W1SC 3H9DA 1WXVA 2L8JA 1WF9A 2IY1B 4RM9A 5KHOA 4HCNB 2GBNA 1WH3A 2BWES 2J0JA 2BKRB 3APFA 3R3MA 3L13A 2FAZA 4AWJA 4G11A 1ZKHA 2ASQA 3H7SA 4EZKA 4KV2A 1UBIA 2BF8B 2O6VB 2WWZA 3NY5A 3EHVA 2G4DB 1IP9A 2IO2B 4WWNA 4GN1A 3NS8A 2D10A 4RMAA 3QAQA 2LVOA 4W9HA 1P1AA 3T8MA 5DPSA 1GUAB 3PLVA 4FHKA 1V2YA 2K39A 3UQAA 2DYOA 2FCSA 4W9CA 2JF5A 3VVWB 1L7YA 4MGIE 3WAMA 2GBRA 2NBVB 1YX6B 4MSMB 3AXCA 4WWPA 3SHQA 4MGYE 1MG8A 2LGYA 5LXHA 3QWZB 2ZEQA 3X0WA 3OJ4B 3SD5A 2L0FA 4OVUA 3PLUA 3DBLI 1J0GA 3MJWA 4F1SA 2BYVE 1P9DU 4PS3A 3ENEA 1T0YA 1IYFA 4DK5A 2DZJA 5D7GA 3PHXB 4BBNF 2KWVB 3A33B 4AJYB 4A20A 2ZPYA 4KZ0A 4HWIB 2ZZPB 2WX1A 2O2VB 2LXAA 4FN2A 1WR6E 2FIFA 2O2VA 3OJ3A 4FJZA 4NY0A 3DBHI 3QQ8B 4YL8A 3WAPA 1WR1A 2KANA 4KDIC 4B9KA 3VDZA 1E8XA 4FULA 2ZJDA 1NI2A 4WJOA 2CHXA 1V81A 4DHJD 1E5WA 1Q5WB 2M1MA 2A5UA 2FCQA 3A9JA 4K7WA 5LXIB 2KX3A 3N3KB 2N9XA 2KFKA 4NJ6A 2PEAA 4IWPA 3L54A 4BFRA 5DPTA 2KMCA 2LVPA 1C1YB 2AL6A 2KDIA 2D07B 4GIVA 1RAXA 5G2NA 3ZNID 2CU1A 3ML9A 2QHOA 4P7IA 1WM2A 1UELA 4NQLB 2KLCA 2KD0A 5EDSA 1TBEA 2FCMA 4NQKE 4W9KA 1EUVB 4E3CA 1RLFA 3DVNV 3BINA 2LGDA 4TKNA 2N1VA 1PQSA 3L08A 4HK2A 1VD2A 4ZRJA 2MBHA 3DPDA 4LJOB 2J0MA 4HDOA 2KXJA 2LRWA 2KN5A 1E8WA 4M0WB 4PS8A 1SE9A 3K9PB 5E6OA 2LD9A 3DVGY 5DPRA 4ANXA 3PTFC 4MDKE 1H8CA 2C60A 5J18A 1V9JA 2KX0A 4KSLC 4MJSB 5J17A 1Q1OA 3ZW3A 1E8ZA 4KSKC 5D94A 4GDKB 1WIAA 1WGDA 2KDFB 4PYUA 3HK0A 3M3JA 3KH0A 2WX0A 2LZ6A 2YVCA 3PPAA 1WXMA 2R2OA 2JZZA 4EEWA 4IC7B 4JGHB 4EFOA 2LASA 4FJYA 2MBEA 3OAWA 4EOYA 2KO3A 1I35A 2C9WB 1H4RA 2MW5A 3VUYA 1LQBA 4NPNA 5L83A 4EZJA 3M63B 1YQBA 3DVGX 3ONSA 1K8RB 2LXCA 1WM3A 1ZGUB 4ZRIA 2JXXA 2RGFA 3QX1A 2REXA 1YD8U 3M95A 3Q3JA 4AP4C 4DDID 2DYBA 3UINB 2MX2A 5JH5C 2CHZA 2MSED 2B3AA 3S2AA 5KHQA 1WJUA 1WJ6A 3JYUA 3VTWA 1GC6A 4G50A 4KVGB 2JWZA 2RR9A 3VFKA 4CO7A 4EKUA 3T9LA 3K9OB 3TMPB 5C1ZA 2GBJA 3H6NA 2JPHA 1U4AA 2KK8A 4HXDA 1OQYA 3IFWB 3ZDMC 4W9IA 4WJNA 5CHFA 4LJPB 1P3QU 1M94A 2K8HA 4CYEA 2DZKA 5J2RA 1KOTA 2O6VA 3CSFA 3PV1A 4MGZE 4WJQA 4II3B 4TQ1A 3TJPA 3SDLC 2MBOA 3H7PB 2W9NA 2N7EA 3TCAA 3UF8A 2FNJB 3QK0A 3JSVB 3NHEB 1Q0WB 3AI5A 1V6EA 1WXAA 3B0AA 1V86A 2XBBC 3QCAA 2JZ3B 4W9DA 3ZNGC 2Z59B 1XD3B 1LFDA 4HVBA 2DAJA 2KC1A 4BKGA 3P2BA 4WWOA 4CHKA 2NBUA 1FXTB 2G3QB 4W9LA 3OLMD 4BKSA 3QC8B 2JY6A 4DDGD 3PRPB 1A5RA 4ZDVA 3RCZA 2C5LC 3RT3B 2ZVOA 2RPQA 1GC7A 4LDTB 4W9JA 4JL9A 4BKTA 4MELA 2AEHA 3VH4B 2N9EB 1E7VA 2DZMA 2PE6B 2WYQA 4GSWA 4BOSC 1V49A 1WXSA 1SIFA 4GGQA 1E90A 4W9FA 2L00B 2HD5B 2IO0B 2KHWB 4ZYNA 1WI0A 2V4LA 3ZTDA 4A3PA 4NNJB 4K81A 3APDA 4GMVA 3A9KB 4NAWB 4W9GA 3RUIB 2CKHB 1WX8A 4AUQC 3A9KA 4NAWA 1LXDA 3CF6E 3VUWA 2CR5A 3V6EB 3H1UA 1ISNA 2KVRA 3VTUA 3TBLD
chains in the Genus database with same CATH superfamily
2ZPNA 1ZW7A 2MP2B 1PYWD 4FBJB 1UZXB 4MEMA 1G6JA 2OOBB 1L4DB 4XZ4A 2PJHA 2LGXA 1TJEA 1WYWB 1KM7A 2M17A 2OJRA 3ZXRA 3WA0A 2DENB 3PRZA 1VRAB 2ZNVC 3KYCD 4HROA 5CTRC 4S0RA 4LTUA 1KJTA 3IAS1 3L0WB 5E6PA 3IBEA 2PLPA 3AH7A 2KQSA 1D3ZA 4EE2A 1WMHB 1Z2MA 4ZRPA 2K8BA 3Q8EA 1J7CA 4GDKA 4XC2A 2JUOA 3ZDTA 2LWPA 3OWEB 2PVOD 1WJNA 3MC0B 4AS1A 1SJHD 3TSSA 2DNFA 3AN1A 5G5GA 2K22A 2NBWB 4NAMA 4HPMB 2QILA 1WE7A 1GJZA 4MM3A 1SSNA 3WAOA 2K9XA 2E6XA 4E71A 4AOFA 3NVWA 1FO4A 3I57A 3FKYA 4TV3A 2K6DB 3RYTA 3VUXA 3KYDD 3U7DA 4JIOU 1DOXA 3IG3A 4LLGM 2LEKA 2KTRB 2NMQA 2JZPA 3H7PA 1FMAD 3PT2B 1E0ZA 4E74A 4WAAA 3JSVA 1DYQA 2DZIA 2ACZB 5E6JA 3HM3A 1V80A 2N7DA 1J8CA 2JYTA 3WIMA 2FIDA 1RRBA 1YX5B 4KGRA 1ROEA 2IY0B 4YTPB 1FXIA 2HTHA 3DBLB 2QJLA 4RGOS 2YEPB 2SEBD 4KIKB 1RFAA 1WRDB 4TUUA 1C4PA 3Q8BA 5C23A 3U30A 4RF1A 4XWTA 4PT5A 1XCQL 3CSTA 1P98A 1E6EB 2UU7A 2WXMA 4BBNC 1OTRB 2Z0DB 4P16A 4ICUA 4IWOA 3RNFC 4TQ0A 3RNAC 2KWCA 4ZHOA 4ARCA 4HJGE 1F1HA 2KJRA 3HHMA 1STEA 3IXSA 3RPFC 4M00A 4YTNB 2G9HD 2D11A 2N1WA 1B9RA 1TS3A 1C77A 2Z8LA 3I63C 1Y8RC 3DWMA 4DWFA 3TEWA 1V5OA 2LHDA 1FD6A 3O65B 4GB9A 5AZGA 2C7NB 2GBKA 1XQQA 2L76A 4TMAB 1X1MA 2KNBA 3UIPB 1NYQA 3RD2A 2MA9B 3SFEB 2CS4A 4F8CB 4PK1A 2KWDA 4P1BC 3Q14C 1T0SC 1C9FA 2EMSA 1I4RA 4X57B 2AX5A 2ZCBA 3C8YA 3ZLZA 4LNKA 4N6EB 5IN7A 1CQVA 3A4RA 1XXGA 3SU8X 3QHTA 3UIOB 2WU2B 2WXRA 3R7QA 2G45B 4ASWC 3DQVA 3RULA 2G4SA 5EE0A 2INDC 3MC8A 3PHWB 2LRUA 2BS3B 3NZSA 2L8JA 1WF9A 4KX6B 4HCNB 2GBNA 2J0JA 2BWES 2WDVB 3APFA 2W54A 3HVZA 4KV2A 4ZRQA 1UWXA 1UBIA 2GRIA 2WWZA 4KKIA 4RCOA 3NY5A 2G4DB 3AE7B 2D10A 1TKEA 5DPSA 3UQAA 5FR3A 1F77A 2INCC 1QF6A 4MGIE 1HQRD 4C4VA 4WWPA 2NBVB 3SHQA 1DGJA 4MGYE 1MG8A 3QWZB 2ZEQA 3X0WA 1BUIC 3OJ4B 3AE9B 1JWAD 3DBLI 3MJWA 4F1SA 4HKQA 4QAYA 3B9JA 3W5VB 4BBNF 2ZW0A 1SE4A 3RNEC 2ZZPB 4US9A 2LXAA 4NY0A 4YL8A 2KACA 2N9KA 3VDZA 4WJOA 1V81A 1E5WA 3LYYA 2GB1A 1P7FA 2A5UA 4YXDB 4XE0A 2N9XA 2PEAA 4IWPA 1FNWA 3L54A 5DPTA 1C1YB 4JX1C 2KDIA 4US8A 4JE3B 2LUMA 2QHOA 4P7IA 1R4NB 5H8YE 1TBEA 2KMMA 1ZPSA 4TKNA 3U2SC 3GB1A 2J42A 2LRWA 1SE9A 2LD9A 5DPRA 3AV8A 2K0PA 1UF0A 5J18A 5EE3A 1WGDA 2KDFB 4PYUA 3HK0A 3M3JA 3NRZA 2LZ6A 2R2OA 1TS2A 2JZZA 3VRBB 4C00A 2LASA 2MBEA 4EOYA 2KO3A 5EE1A 1H4RA 1BMLC 4JPSA 2AQ1B 2MJ3A 4R3DA 2OJWA 1UNSA 3LXFA 2LXCA 4K3BA 3R8BA 3Q3JA 4ITKA 4BZAA 2WS3B 2DWQA 3P63A 2VZKB 2CHZA 2DBYA 4HKZE 3S2AA 1SB3C 3NVZA 1GC6A 3DHIC 3T9LA 3K9OB 2WDRB 3ETRA 1L0YB 2KK8A 1TIFA 3ZDMC 4W9IA 3TEXA 3N1YC 5CHFA 1P3QU 4TSSA 4TQ1A 1SBBB 3BVGA 3TCAA 4YSZB 3GE8C 3QCAA 2JZ3B 3ZNGC 1IGCA 1LFDA 2KC1A 3RFZB 3P2BA 4WWOA 1T0RC 1FXTB 2G3QB 2KN4A 2J53A 1V97A 2JY6A 4A90A 5FKAC 1FXAA 4N59A 2WP9B 4MELA 2WYQA 4GSWA 4BOSC 1WXSA 1E90A 2KHWB 3ZTDA 4K81A 3APDA 1T3QA 1SXTA 3A9KA 2CR5A 1ISNA 2KVRA 3BK1A 1V5TA 3UGBB 4B0EA 3AU5A 3KWVA 3A1QB 5AUIA 1FRRA 2MWSB 5LLIA 2NTSA 1F9JA 2KQ7A 3M62B 1EWYC 2J4XA 3RI7C 1QOFA 2KWUB 5JHBA 2KVZA 1D5MC 3QIJA 3AMZA 4FHJA 3PSEB 4PS7A 2L52A 3DBRB 5JZEB 1R4NI 2CHWA 1T6BX 1Z5SB 3V60A 1L2NA 1KLGD 3EC8A 5CHWA 2I1JA 1ZDXA 3U8ZA 3PREA 4MGKE 2WU5B 2WDTB 4IM2A 3U52E 1YN4A 3Q8FA 3ZRFA 1PGXA 3C19A 3AM9A 4Q2JA 2N9PC 3BK2A 3V6CB 2KTFA 2QCZA 4MSQB 2IYDB 4MM3B 4RGMA 4DHZE 5CX3A 5IAAC 4F7ZA 3TEZA 5IP4D 3BVZA 3ECIA 1HTOA 2WHIA 5AUKA 1I4PA 2G1EA 2LVQA 2PKOA 4AJWA 1HZ6A 1T5XD 2LUEA 1MVKA 4GLSC 2N0SB 2Z0EB 2K6QA 3LDZE 1XT9B 2HTME 3KUDB 2KOXA 4PYZA 2WXNA 2IGGA 5BYRA 3WALA 3I3TB 4YSXB 2BGFA 3RZWC 2BS4B 2I1KA 1NYRA 2NPTA 2WQYB 1JRUA 2DHZA 1MJDA 1L4ZB 1WZ3A 3VXWA 2DLBA 1WGHA 4LK0M 4RNAA 3L10B 4JLCA 2LI5A 4DXAB 1JWSD 2MBBB 1JMLA 1TGZB 2LJ5A 3U4EG 1WSPA 3ML8A 2FCNA 5BYSA 4GXBA 2NCNA 1JRPA 3TL5A 2DYMA 2K5PA 3A1QA 4K7UA 1L0XB 1YJ1A 3Q3OC 2JT4B 4P1CC 2KFJA 4A9AA 1S3SG 1TZOA 3ZIMA 3UI3A 2XEWA 2KKCA 2BYEA 2NVUI 3N20C 1UGMA 3PRMB 3KVFB 1GNUA 2H89B 3ZKJC 2VH1A 4EZLA 1K51A 1VDVA 4ANUA 2LHEA 1XCTL 3GP7A 5D2MB 2IJ0A 1D4BA 3IT6B 3DBRI 4ZRKA 3CMMB 1P0RA 4YT0B 1QZEA 3WANA 4B95A 3VHTC 1N63A 1D5XC 1KLVA 2BWFA 4WURA 2BYFA 1YN5A 4LCDE 4WQOB 1WGGA 4D2KA 4IM3A 5MPOA 3VQIA 2LGIA 3ZJTA 2IPKD 2M19A 3PZDA 3BY4B 4KGTA 2KJHB 2CJNA 2MQJA 3DDCB 4YSYB 2BYTA 4K7SA 4ANWA 2RDHA 2QDFA 3HM6X 4ZYSA 1IPGA 4JWSC 1WXVA 2IY1B 5KHOA 3R3MA 2FAZA 1B1ZA 3H7SA 1WWTA 4RFBA 4WWNA 5BMIA 3T8MA 4FHKA 5BYQA 2FCSA 4C4VB 4W9CA 4WIPA 3VVWB 2W55A 1L7YA 3WAMA 1JROA 2GBRA 4MSMB 3MFGA 3AEAB 3AE3B 2OHFA 3MP9A 2JYEA 2INPE 2DZJA 5HI1A 2WNMA 1XO3A 5BMGA 1JWMD 3RNCC 4FN2A 4ARIA 4HPPA 4FJZA 5H92C 3Q6BA 4UDUC 3BVMA 3EGRA 1WGKA 2ZJDA 2CHXA 4DHJD 4K7WA 3N3KB 2LVPA 4GIVA 5G2NA 1VR9A 3BYTB 5G5HA 3ML9A 2WLBA 1XF5L 1FPYA 2FCMA 1ET9A 4E3CA 3SEBA 3BINA 2LGDA 2WXOA 3L08A 4RGNA 4BAXA 1VD2A 2IDYA 3AEDB 1K53A 1YNTE 3U7ZA 2J0MA 2BB5A 4HDOA 1JWUD 4PS8A 3HUIA 5E6OA 3DVGY 5LNK1 1H8CA 2C60A 2NTTA 1RYJA 1MG4A 1BXTA 2KX0A 1Q1OA 2WXLA 3ZW3A 4KSKC 3KH0A 5D3DA 2I2YA 4N58A 2KDMA 4JGHB 4S17A 4EFOA 1TYGB 3OAWA 2C9WB 1WYGA 1FCLA 1LQBA 3DVGX 1WM3A 2RGFA 3MJ5A 1WXQA 1YD8U 3M95A 2DYBA 3UINB 1I4GA 1C78A 5JH5C 1N62A 1AWDA 2BBCA 3VTWA 4KVGB 2RR9A 4CO7A 4EKUA 1KLUD 1J7AA 1RM6C 2JPHA 1U4AA 3IAM1 4HXDA 4B0MA 4WJNA 1KOTA 5J2RA 4JWUC 2R61A 3PV1A 4WJQA 2ZW1A 2M0AA 3GZNB 3NHEB 1Q0WB 1V6EA 4W9DA 2XBBC 2Z59B 1F52A 4IDIA 4CHKA 2NBUA 1M4VA 3BIID 4DQOC 2I38A 1I4XA 3PRPB 4WWMA 3RT3B 2RPQA 1MPEA 2BT6A 2WXJA 3VH4B 2N9EB 4LNNA 4A8XC 2DZMA 4W9FA 3E9SA 1A70A 2IO0B 5HFYA 1YJJA 4W9GA 3A9KB 4NAWA 3VUWA 1LXDA 1D6EC 2Y5PA 3CF6E 2QEJC 1JQ4A 3W2DA 3TBLD 4LNFA 1YQ3B 3PVLA 3D32A 2V3SA 4IKGA 3VAWA 1V8CA 4YTMB 1QILA 3Q3FA 4A6QA 1OQRA 2XNAC 3DVNU 4DBGA 2JWUA 2WXPA 2VH2A 5E6NA 2IBIB 1WFYA 2D3BA 3VH3B 1EF1A 5TSSA 1PGAA 1CMXB 1MHHE 4ZHPA 1I4HA 1WJ4A 4LNOA 4P6VF 5AZHA 4L1BA 1OEYA 3ZJVA 5AEKB 4REZA 4USAA 1LM8B 5GMVA 1XLQA 2UYZB 4ICVA 4G0NB 1JALA 2K8CA 3DOWA 4J3OD 3DWGC 4M8MA 3L4PA 3RNBC 1E7UA 1YJIA 3L17A 3MTNB 2V0GA 3AEBB 1HZ5A 4I6LB 2XK5B 2NS5A 5C3JB 2J0KA 2M8SA 5CHVC 5DCNA 3ZO5B 2DAFA 1QLBB 2FE8A 3V61A 2KT7A 2KYWA 1WGYA 1XLNA 2EELA 3W1YA 3V3XA 4W9EA 3X23A 2C7MB 5JXVA 2L3ZA 3W1SA 2GBMA 3TUOA 1UD7A 2L32A 4URKA 4IW0A 1WX9A 4GU2A 2EKEC 3P42A 3ZJUA 2QMTA 2HJ8A 1SIJA 2WXIA 5HKHA 3N1XC 1SE3A 1Q10A 2NPTB 2M4NA 3GZNI 1KH0A 1TKGA 3RN9C 2L7RA 3B08A 2C7HA 3KQ4A 3C0RB 4C80A 1NI3A 4ZOHC 1I42A 3AEGB 2PVGC 3KW5B 2NR2A 4A3OA 4GOCA 2X38A 4RGTA 5AZFA 2QIEB 3TIXA 1N6ZA 3Q8CA 3ZTCA 3KLSX 2AWTA 2L05A 2FUG1 2ONQA 2PE9A 3KUCB 3N30A 1YOVB 2RSUA 3TEYA 1ZP0B 1E8YA 4BOZB 1VCBA 2K3UA 2KDBA 2JXTA 1OGWA 2O6VD 4N9F4 2MBQA 3QJZA 3T3NA 1C4CA 3PGEA 3R2IA 4XGAB 3ZRCA 2GLSA 4HLEA 3ZNZB 3PO0A 2RD0A 3Q3MC 1KFYB 2YLMA 3AE8B 1GAQB 1EO6A 1C4AA 2Y5CA 2R2QA 3ZXVA 1KF6B 2BW2A 2K25A 1N5WA 2WXFA 4I6NB 3NS1A 4KZCA 1NEKB 3ALBA 1J19A 4HCPB 2KZRA 2WXHA 4LDTD 1SJED 1ZXIA 1EWCA 1TT5B 4OVVA 1XLPA 1ESFA 2VRRB 1V1OA 3ZVVA 1TTNA 2RPVA 4NJCA 1DOYA 1ET6A 2UWQA 2V1YA 1GG3A 2M0XA 4IM0A 3N1ZC 2RDGA 2XK5A 3AEEB 4IUMB 4KKJA 1FNUA 3FILB 1E9MA 3V62A 1ZE3D 3B2GA 2MCNB 1MHXA 5BO4B 3R7RA 1F2RI 1NENB 4RH6A 1IGDA 1YIWA 3DCGA 2M56B 3R66C 4GDLA 2V3NA 4HJKA 1AYFA 3W1SC 1FCCC 4OZAA 4RM9A 4H2AA 2JU6X 1E10A 1WH3A 3P4QB 2BKRB 4K3CA 4G11A 2ASQA 3AECB 2O6VB 2BB6A 2D5GA 3EHVA 3NS8A 2LVOA 1P1AA 2INNE 1LO5D 1GUAB 3PLVA 1V2YA 2K39A 1I7HA 1YX6B 2LGYA 2MJDA 5LXHA 3GE3C 2D3AA 2L0FA 4OVUA 3PLUA 1J0GA 3CWIA 3V05A 4C7ZA 3B2FA 1P9DU 1TS4A 3ENEA 1T0YA 1JW9D 4DK5A 5D7GA 4OW0A 4MH8A 2KWVB 3A33B 2MHJA 4A20A 2WX1A 1WR6E 2EKIA 2O2VA 1QQRA 3QQ8B 1WR1A 4B9KA 1E8XA 4FULA 5T8IA 2BTEA 3AE2B 2M1MA 2BS2B 5LXIB 1V1PB 4BFRA 2WXGA 2AL6A 3W9CB 2D07B 1RAXA 1XEEA 4OHJA 2RMMA 1MFWA 1WM2A 1FFUA 5EDSA 1PGBA 2AQ2B 2KD0A 1EUVB 1RLFA 3DVNV 1PQSA 4HK2A 3GS2A 2KQ4X 3KWLA 2MBHA 1E8WA 3VRAB 4M0WA 4ANXA 4MDKE 1V9JA 5J17A 4MJSB 1WIAA 3PPAA 2WX0A 3FC4A 1SEBD 1EU3A 1EU4A 4IC7B 4EEWA 1N5XA 1E7PB 2MW5A 3MC9A 3FILA 3AE6B 3P4RB 4NPNA 1ZDVA 2LMCA 3E56A 3ONSA 1K8RB 2CJOA 1ZGUB 1F2RC 4ZRIA 2JXXA 3QX1A 3NZ3A 1C76A 4RF0A 3W5UB 2QC8A 4L23A 1OQYA 1TY0A 3IFWB 2IGHA 1N60A 4CYEA 4LJPB 1M94A 2DZKA 2J52A 2O6VA 4A55A 4II3B 3SDLC 3UF8A 3B0AA 1WXAA 2D3CA 2H88B 1XD3B 2MH7A 3AE5B 2DAJA 4DXFA 1GOZA 4BKGA 1OQQA 1MI0A 4W9LA 2KAJA 2HJ1A 3QC8B 3VR8B 1A5RA 4ZDVA 3RCZA 2C5LC 1C79A 1GC7A 1VJKA 4JL9A 2Q5WD 4BKTA 2AEHA 1E7VA 4GGQA 1IBXA 1P7EA 1SIFA 4ZYNA 4A3PA 1WI0A 2V4LA 4NAWB 1F0ZA 4AUQC 3J9CA 3V6EB 3H1UA 2V9HA 2LJIA 5C2TB 3Q8AA 1YN3A 3VTUA 1S1QB 4IG7B 1WZ0A 3KUZA 4MH0E 2MRPA 3AEFB 2MP2A 3IT4B 2MJEA 1V1PA 4XWWA 4FADA 5L95C 1UH6A 5D6JB 3JW0X 2XN9C 3PS6A 3ZNHB 2QSDA 4WAFA 1C3TA 3DBSA 1NDDA 1AN8A 1GPXA 3NZUA 2D2QA 4O1NA 3L16A 3IVFA 3HRDD 5IOIA 2GOWA 2AYOB 1KTKA 1FM0D 2CU3A 3MHZA 2V3PA 3UQBA 1K52A 4MJSA 1WMHA 4XX5A 1BT0A 1LGRA 4FLHA 1R4MB 1K50A 4HPLB 3I5JC 1PDXA 1HXYD 4FA6A 4HRSA 2HDEA 2L0TA 3JVZX 2JRIB 2W3RA 2DX5B 4XDCA 3AU4A 3AE4B 4J6IA 3H8HA 1Y56A 2OEDA 1ZUD2 1N61A 3LB8C 2KMAA 2IZVB 3EUB2 4HDQA 2W82A 2KDEB 2FUHB 1L6VA 2AQ3B 2EMTA 3FAHA 3N32A 4DHJB 5HG2A 1KRHA 2E3TA 1VZ6A 5IO9A 4B6WA 1RFKA 4MACA 2KJ6A 2KTRA 5EE9A 4HEA1 2Y5BB 5TR5A 4XYCA 2A4ZA 1D5ZC 4EUTA 3LJ3A 3MHSD 1J7BA 2J7QB 2ZVNA 1I4QA 4BVUC 5DPWA 1SE2A 3NVVA 1FRDA 1TKYA 2PIAA 1WX7A 1OEYJ 4JQWC 4G3XB 1AW7A 1GB1A 3AULA 2PMVA 2N4FA 1NVID 2PPHA 4ANVA 3O13A 2V4IB 4KIKA 3VTVA 5FR6A 1SGHA 3N9YC 2WGSA 3BYYB 2W3SA 3DBHB 2VZKD 2L1AA 1WGRA 4K1RB 4C7YA 1L6UA 1RWSA 3ZUNA 4XDDA 2GMIC 5IA7A 5G55A 3VR9B 1EF5A 4NZLB 1GB4A 3A9JB 2L83A 1WY8A 2KFKB 2IO3B 2ZNVB 2JRHA 4OZCA 3NUHB 1ACCA 1VZ7A 3EECA 1WE6A 3EFCA 1IUEA 3HIZA 3P4PB 2BPSA 1JWBD 5I4DA 3AE1B 4DHZB 3EFUA 1WRIA 4M8NA 1HA5A 2JX5A 3URYA 4NJ7A 4BKSD 2PW9A 1QOGA 1UBQA 3QARA 3BWUD 3IHPC 1QT9A 2ICIA 3AB5A 2IO1B 1R4MI 4WJPA 1TZ1A 2KLGA 2AL3A 4IWQA 2K1FA 4FXCA 2SAKA 3APCA 2BKFA 2ZCCA 1QOAA 4FJVB 4II2B 3RZFA 3CIRB 1HEZE 3NVYA 3EA6A 2JSVX 3R2TA 4KDLB 2JVCA 4OVZA 3QA8A 3B1LX 2KC2A 2D3GA 2HE7A 4M01A 2MLBA 3A4SC 3GOEA 4I6PA 3NOBA 1NBFC 4GDLB 4RM8A 1HE8A 2BQQA 3BZDB 1AARA 5JHAA 3H9DA 2ON8A 1EM7A 1UGJA 3P1MA 3L13A 4AWJA 1ZKHA 5D3IB 4EZKA 2BF8B 4M02A 1IP9A 2IO2B 3Q2AC 4GN1A 4RMAA 3QAQA 3NG0A 4W9HA 3ZYYX 3SR6A 2DYOA 1L5PA 2JF5A 3T3OA 2B76B 3WCQA 3AXCA 5BMHA 3HVDA 3SD5A 1FFVA 2BYVE 1FNVA 4PS3A 4ACFA 1ZXHA 1IYFA 3PHXB 4YWGG 4AJYB 2ZPYA 1SF0A 4KZ0A 4HWIB 2O2VB 2PTLA 2FIFA 3OJ3A 4IOIE 1DOIA 4C56C 3DBHI 3WAPA 2LGSA 4KDIC 2KANA 3I9V1 3Q3NC 1NI2A 1Q5WB 2FCQA 3A9JA 2KX3A 1CZPA 1CK1A 2KFKA 4NJ6A 1L0VB 3PZ7A 2KMCA 3ZQ4A 1HTQA 1ENFA 2FBWB 3ZNID 2CU1A 3ABVB 1UELA 4NQLB 2KLCA 4WH4A 4NQKE 4W9KA 3SFDB 2N1VA 4LNIA 1QKZA 3DHHC 4ZRJA 1YQ4B 3DPDA 4LJOB 5HHDG 5GXGB 2KXJA 4M0WB 2KN5A 3K9PB 3PTFC 1YMHE 2TSSA 4KSLC 1E8ZA 5D94A 1OFFA 4GDKB 2YVCA 4OZBA 1WXMA 4FJYA 3RMKC 1JCKB 1I35A 2BVCA 4KGSA 3VUYA 2LFIA 5L83A 4EZJA 3M63B 1YQBA 1XLOA 5IKCM 1UWMA 2GI9A 2REXA 4AP4C 4DDID 2MX2A 2MSED 2X8XX 2B3AA 3OG5A 5KHQA 2N7JA 1WJUA 1WJ6A 3JYUA 2WXQA 4G50A 2RDBC 4L2YA 2JWZA 3VFKA 1FEHA 1R7SA 3TMPB 5C1ZA 2GBJA 3H6NA 1UUPA 1PUTA 2WXKA 4DXGA 2K8HA 2JQRB 3CSFA 4MGZE 3NJTA 3TJPA 2MBOA 3H7PB 1TS5A 2N7EA 2IGDA 2W9NA 2FNJB 3QK0A 3JSVB 3AI5A 3Q69A 2MEKA 1V86A 2Y3AA 3DHGC 1PFDA 4HVBA 1TY2A 3P4SB 3OLMD 4BKSA 2N9LA 4DDGD 4MT5A 1ZOYB 2YEPF 3PZ8A 2ZVOA 4LDTB 4W9JA 3ZGZA 3RNGC 1IBXB 1FIQA 1QOBA 2PE6B 1V49A 2HD5B 2L00B 2WDQB 4AQ7A 4NNJB 1CJEA 4GMVA 3RUIB 1VLBA 1VZ8A 2CKHB 1WX8A 4WQMA 4CQNA 1T0QC 5FK9C
chains in the Genus database with same CATH topology
1V5TA 2ZPNA 3UGBB 3AU5A 1S1QB 4IG7B 3PVLA 1WZ0A 3KUZA 1ZW7A 3D32A 2V3SA 4MH0E 2MP2B 4FBJB 3A1QB 1UZXB 4MEMA 3VAWA 1G6JA 2MRPA 2OOBB 2MP2A 2MWSB 5LLIA 3Q3FA 4XZ4A 2PJHA 2LGXA 4FADA 1WYWB 1KM7A 2M17A 1F9JA 2OJRA 3DVNU 4DBGA 3WA0A 2DENB 5L95C 1UH6A 5D6JB 2KQ7A 3M62B 2ZNVC 3PRZA 3JW0X 5E6NA 2IBIB 3KYCD 1WFYA 3PS6A 2KWUB 3VH3B 3ZNHB 5CTRC 1EF1A 5JHBA 1C3TA 1KJTA 3DBSA 1CMXB 1NDDA 3L0WB 5E6PA 3QIJA 3NZUA 2D2QA 4FHJA 3IBEA 3L16A 3PSEB 3IVFA 4PS7A 5JZEB 1R4NI 1WJ4A 2CHWA 2AYOB 2GOWA 2KQSA 1D3ZA 1Z5SB 3V60A 1L2NA 3EC8A 5AZHA 5CHWA 2I1JA 1WMHB 1Z2MA 1OEYA 3UQBA 5AEKB 2K8BA 4MJSA 1WMHA 1LM8B 3U8ZA 3PREA 4GDKA 4MGKE 5GMVA 2WDTB 4XX5A 2UYZB 1BT0A 4ICVA 4IM2A 4FLHA 4XC2A 2JUOA 3ZDTA 4HPLB 2LWPA 4G0NB 4FA6A 2K8CA 2L0TA 3DOWA 1WJNA 3JVZX 2JRIB 4M8MA 3ZRFA 2DX5B 3AU4A 1E7UA 2N9PC 3L17A 3MTNB 4J6IA 3V6CB 2KTFA 4MSQB 4I6LB 2IYDB 2NS5A 2XK5B 2NBWB 2J0KA 2M8SA 5CHVC 4HPMB 5DCNA 3ZO5B 4DHZE 1WE7A 5CX3A 2KMAA 5IAAC 1GJZA 4MM3A 2IZVB 4F7ZA 3WAOA 2DAFA 3V61A 3ECIA 4E71A 4HDQA 4AOFA 2KDEB 2LVQA 1WGYA 2FUHB 4AJWA 4TV3A 2LUEA 2K6DB 3W1YA 3RYTA 3VUXA 4W9EA 2EMTA 3X23A 3N32A 2C7MB 2L3ZA 3KYDD 3W1SA 4DHJB 2GBMA 3U7DA 2Z0EB 4JIOU 2K6QA 3IG3A 1UD7A 3LDZE 4B6WA 1XT9B 2KTRB 3KUDB 4URKA 2KOXA 4IW0A 1WX9A 3H7PA 2EKEC 4GU2A 2KJ6A 2KTRA 4PYZA 3PT2B 4E74A 4WAAA 2Y5BB 3JSVA 5TR5A 3WALA 2DZIA 2HJ8A 3I3TB 2A4ZA 5HKHA 2BGFA 3RZWC 4EUTA 3LJ3A 3HM3A 3MHSD 1V80A 2N7DA 2NPTB 2M4NA 1J8CA 2J7QB 2ZVNA 2I1KA 4BVUC 5DPWA 2NPTA 3GZNI 3WIMA 2FIDA 1RRBA 1YX5B 1JRUA 2DHZA 1WZ3A 2IY0B 1WX7A 3VXWA 1OEYJ 1WGHA 2HTHA 2L7RA 4JQWC 3B08A 2C7HA 4G3XB 3L10B 3AULA 2N4FA 4KIKB 1RFAA 1WRDB 2PPHA 3C0RB 4ANVA 4TUUA 4JLCA 4KIKA 5C23A 3VTVA 5FR6A 3U30A 2LI5A 4DXAB 1I42A 1SGHA 2MBBB 3KW5B 2NR2A 4A3OA 1TGZB 2LJ5A 4GOCA 3ML8A 5AZFA 3CSTA 1P98A 2FCNA 3TIXA 3ZTCA 4GXBA 2AWTA 2L05A 2NCNA 2PE9A 4BBNC 1WGRA 4K1RB 3TL5A 1OTRB 2DYMA 3A1QA 3KUCB 3N30A 1YJ1A 4K7UA 2Z0DB 2JT4B 2RSUA 4ICUA 4IWOA 3ZUNA 2KFJA 1E8YA 2GMIC 4TQ0A 1S3SG 4BOZB 1VCBA 3ZIMA 2KDBA 2KWCA 5IA7A 2XEWA 2KKCA 2BYEA 5G55A 1EF5A 1OGWA 2NVUI 2O6VD 3A9JB 1UGMA 1WY8A 2KFKB 3KVFB 3PRMB 4N9F4 1GNUA 2IO3B 2KJRA 2MBQA 2ZNVB 2JRHA 3QJZA 3HHMA 3ZKJC 3PGEA 3ZRCA 3EECA 1WE6A 4HLEA 3HIZA 3ZNZB 2RD0A 2D11A 2N1WA 4EZLA 2BPSA 2YLMA 4ANUA 4DWFA 1Y8RC 1V5OA 4DHZB 5D2MB 3EFUA 1EO6A 3O65B 4GB9A 4M8NA 5AZGA 2C7NB 2R2QA 4NJ7A 4BKSD 2K25A 2GBKA 1XQQA 3DBRI 4ZRKA 4I6NB 4KZCA 2L76A 3ALBA 1J19A 4HCPB 2KZRA 3CMMB 1UBQA 1X1MA 2KNBA 3UIPB 1P0RA 3QARA 1QZEA 3RD2A 3WANA 4LDTD 3IHPC 2MA9B 4B95A 4OVVA 3VHTC 2CS4A 4F8CB 2VRRB 3ZVVA 1KLVA 1TTNA 2BWFA 2IO1B 1R4MI 2BYFA 4LCDE 2UWQA 2V1YA 1TZ1A 2KLGA 4WJPA 4WQOB 2EMSA 1WGGA 2AL3A 1GG3A 4IM3A 4IWQA 2K1FA 2M0XA 4IM0A 3APCA 2XK5A 4IUMB 4X57B 2BKFA 2ZCCA 3VQIA 2ZCBA 4FJVB 4II2B 3V62A 3RZFA 3PZDA 3BY4B 4KDLB 3ZLZA 2JVCA 2KJHB 2MQJA 3QA8A 3A4RA 2MCNB 3B1LX 2KC2A 3DDCB 3SU8X 2D3GA 2HE7A 3QHTA 5BO4B 3R7RA 2MLBA 3A4SC 3GOEA 3UIOB 4I6PA 3R7QA 3NOBA 2G45B 4K7SA 4ANWA 4ASWC 1YIWA 3DQVA 1NBFC 3DCGA 4GDLB 2G4SA 4RM8A 3RULA 1HE8A 3R66C 1AARA 4GDLA 3HM6X 1IPGA 5JHAA 4HJKA 3PHWB 2LRUA 3NZSA 3W1SC 3H9DA 1WXVA 2L8JA 1WF9A 2IY1B 4RM9A 5KHOA 4HCNB 2GBNA 1WH3A 2BWES 2J0JA 2BKRB 3APFA 3R3MA 3L13A 2FAZA 4AWJA 4G11A 1ZKHA 2ASQA 3H7SA 4EZKA 4KV2A 1UBIA 2BF8B 2O6VB 2WWZA 3NY5A 3EHVA 2G4DB 1IP9A 2IO2B 4WWNA 4GN1A 3NS8A 2D10A 4RMAA 3QAQA 2LVOA 4W9HA 1P1AA 3T8MA 5DPSA 1GUAB 3PLVA 4FHKA 1V2YA 2K39A 3UQAA 2DYOA 2FCSA 4W9CA 2JF5A 3VVWB 1L7YA 4MGIE 3WAMA 2GBRA 2NBVB 1YX6B 4MSMB 3AXCA 4WWPA 3SHQA 4MGYE 1MG8A 2LGYA 5LXHA 3QWZB 2ZEQA 3X0WA 3OJ4B 3SD5A 2L0FA 4OVUA 3PLUA 3DBLI 1J0GA 3MJWA 4F1SA 2BYVE 1P9DU 4PS3A 3ENEA 1T0YA 1IYFA 4DK5A 2DZJA 5D7GA 3PHXB 4BBNF 2KWVB 3A33B 4AJYB 4A20A 2ZPYA 4KZ0A 4HWIB 2ZZPB 2WX1A 2O2VB 2LXAA 4FN2A 1WR6E 2FIFA 2O2VA 3OJ3A 4FJZA 4NY0A 3DBHI 3QQ8B 4YL8A 3WAPA 1WR1A 2KANA 4KDIC 4B9KA 3VDZA 1E8XA 4FULA 2ZJDA 1NI2A 4WJOA 2CHXA 1V81A 4DHJD 1E5WA 1Q5WB 2M1MA 2A5UA 2FCQA 3A9JA 4K7WA 5LXIB 2KX3A 3N3KB 2N9XA 2KFKA 4NJ6A 2PEAA 4IWPA 3L54A 4BFRA 5DPTA 2KMCA 2LVPA 1C1YB 2AL6A 2KDIA 2D07B 4GIVA 1RAXA 5G2NA 3ZNID 2CU1A 3ML9A 2QHOA 4P7IA 1WM2A 1UELA 4NQLB 2KLCA 2KD0A 5EDSA 1TBEA 2FCMA 4NQKE 4W9KA 1EUVB 4E3CA 1RLFA 3DVNV 3BINA 2LGDA 4TKNA 2N1VA 1PQSA 3L08A 4HK2A 1VD2A 4ZRJA 2MBHA 3DPDA 4LJOB 2J0MA 4HDOA 2KXJA 2LRWA 2KN5A 1E8WA 4M0WB 4PS8A 1SE9A 3K9PB 5E6OA 2LD9A 3DVGY 5DPRA 4ANXA 3PTFC 4MDKE 1H8CA 2C60A 5J18A 1V9JA 2KX0A 4KSLC 4MJSB 5J17A 1Q1OA 3ZW3A 1E8ZA 4KSKC 5D94A 4GDKB 1WIAA 1WGDA 2KDFB 4PYUA 3HK0A 3M3JA 3KH0A 2WX0A 2LZ6A 2YVCA 3PPAA 1WXMA 2R2OA 2JZZA 4EEWA 4IC7B 4JGHB 4EFOA 2LASA 4FJYA 2MBEA 3OAWA 4EOYA 2KO3A 1I35A 2C9WB 1H4RA 2MW5A 3VUYA 1LQBA 4NPNA 5L83A 4EZJA 3M63B 1YQBA 3DVGX 3ONSA 1K8RB 2LXCA 1WM3A 1ZGUB 4ZRIA 2JXXA 2RGFA 3QX1A 2REXA 1YD8U 3M95A 3Q3JA 4AP4C 4DDID 2DYBA 3UINB 2MX2A 5JH5C 2CHZA 2MSED 2B3AA 3S2AA 5KHQA 1WJUA 1WJ6A 3JYUA 3VTWA 1GC6A 4G50A 4KVGB 2JWZA 2RR9A 3VFKA 4CO7A 4EKUA 3T9LA 3K9OB 3TMPB 5C1ZA 2GBJA 3H6NA 2JPHA 1U4AA 2KK8A 4HXDA 1OQYA 3IFWB 3ZDMC 4W9IA 4WJNA 5CHFA 4LJPB 1P3QU 1M94A 2K8HA 4CYEA 2DZKA 5J2RA 1KOTA 2O6VA 3CSFA 3PV1A 4MGZE 4WJQA 4II3B 4TQ1A 3TJPA 3SDLC 2MBOA 3H7PB 2W9NA 2N7EA 3TCAA 3UF8A 2FNJB 3QK0A 3JSVB 3NHEB 1Q0WB 3AI5A 1V6EA 1WXAA 3B0AA 1V86A 2XBBC 3QCAA 2JZ3B 4W9DA 3ZNGC 2Z59B 1XD3B 1LFDA 4HVBA 2DAJA 2KC1A 4BKGA 3P2BA 4WWOA 4CHKA 2NBUA 1FXTB 2G3QB 4W9LA 3OLMD 4BKSA 3QC8B 2JY6A 4DDGD 3PRPB 1A5RA 4ZDVA 3RCZA 2C5LC 3RT3B 2ZVOA 2RPQA 1GC7A 4LDTB 4W9JA 4JL9A 4BKTA 4MELA 2AEHA 3VH4B 2N9EB 1E7VA 2DZMA 2PE6B 2WYQA 4GSWA 4BOSC 1V49A 1WXSA 1SIFA 4GGQA 1E90A 4W9FA 2L00B 2HD5B 2IO0B 2KHWB 4ZYNA 1WI0A 2V4LA 3ZTDA 4A3PA 4NNJB 4K81A 3APDA 4GMVA 3A9KB 4NAWB 4W9GA 3RUIB 2CKHB 1WX8A 4AUQC 3A9KA 4NAWA 1LXDA 3CF6E 3VUWA 2CR5A 3V6EB 3H1UA 1ISNA 2KVRA 3VTUA 3TBLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5T A;  2ZPN A;  3UGB B;  3AU5 A;  1S1Q B;  4IG7 B;  3PVL A;  1WZ0 A;  3KUZ A;  1ZW7 A;  3D32 A;  2V3S A;  4MH0 E;  2MP2 B;  4FBJ B;  3A1Q B;  1UZX B;  4MEM A;  3VAW A;  1G6J A;  2MRP A;  2OOB B;  2MP2 A;  2MWS B;  5LLI A;  3Q3F A;  4XZ4 A;  2PJH A;  2LGX A;  4FAD A;  1WYW B;  1KM7 A;  2M17 A;  1F9J A;  2OJR A;  3DVN U;  4DBG A;  3WA0 A;  2DEN B;  5L95 C;  1UH6 A;  5D6J B;  2KQ7 A;  3M62 B;  2ZNV C;  3PRZ A;  3JW0 X;  5E6N A;  2IBI B;  3KYC D;  1WFY A;  3PS6 A;  2KWU B;  3VH3 B;  3ZNH B;  5CTR C;  1EF1 A;  5JHB A;  1C3T A;  1KJT A;  3DBS A;  1CMX B;  1NDD A;  3L0W B;  5E6P A;  3QIJ A;  3NZU A;  2D2Q A;  4FHJ A;  3IBE A;  3L16 A;  3PSE B;  3IVF A;  4PS7 A;  5JZE B;  1R4N I;  1WJ4 A;  2CHW A;  2AYO B;  2GOW A;  2KQS A;  1D3Z A;  1Z5S B;  3V60 A;  1L2N A;  3EC8 A;  5AZH A;  5CHW A;  2I1J A;  1WMH B;  1Z2M A;  1OEY A;  3UQB A;  5AEK B;  2K8B A;  4MJS A;  1WMH A;  1LM8 B;  3U8Z A;  3PRE A;  4GDK A;  4MGK E;  5GMV A;  2WDT B;  4XX5 A;  2UYZ B;  1BT0 A;  4ICV A;  4IM2 A;  4FLH A;  4XC2 A;  2JUO A;  3ZDT A;  4HPL B;  2LWP A;  4G0N B;  4FA6 A;  2K8C A;  2L0T A;  3DOW A;  1WJN A;  3JVZ X;  2JRI B;  4M8M A;  3ZRF A;  2DX5 B;  3AU4 A;  1E7U A;  2N9P C;  3L17 A;  3MTN B;  4J6I A;  3V6C B;  2KTF A;  4MSQ B;  4I6L B;  2IYD B;  2NS5 A;  2XK5 B;  2NBW B;  2J0K A;  2M8S A;  5CHV C;  4HPM B;  5DCN A;  3ZO5 B;  4DHZ E;  1WE7 A;  5CX3 A;  2KMA A;  5IAA C;  1GJZ A;  4MM3 A;  2IZV B;  4F7Z A;  3WAO A;  2DAF A;  3V61 A;  3ECI A;  4E71 A;  4HDQ A;  4AOF A;  2KDE B;  2LVQ A;  1WGY A;  2FUH B;  4AJW A;  4TV3 A;  2LUE A;  2K6D B;  3W1Y A;  3RYT A;  3VUX A;  4W9E A;  2EMT A;  3X23 A;  3N32 A;  2C7M B;  2L3Z A;  3KYD D;  3W1S A;  4DHJ B;  2GBM A;  3U7D A;  2Z0E B;  4JIO U;  2K6Q A;  3IG3 A;  1UD7 A;  3LDZ E;  4B6W A;  1XT9 B;  2KTR B;  3KUD B;  4URK A;  2KOX A;  4IW0 A;  1WX9 A;  3H7P A;  2EKE C;  4GU2 A;  2KJ6 A;  2KTR A;  4PYZ A;  3PT2 B;  4E74 A;  4WAA A;  2Y5B B;  3JSV A;  5TR5 A;  3WAL A;  2DZI A;  2HJ8 A;  3I3T B;  2A4Z A;  5HKH A;  2BGF A;  3RZW C;  4EUT A;  3LJ3 A;  3HM3 A;  3MHS D;  1V80 A;  2N7D A;  2NPT B;  2M4N A;  1J8C A;  2J7Q B;  2ZVN A;  2I1K A;  4BVU C;  5DPW A;  2NPT A;  3GZN I;  3WIM A;  2FID A;  1RRB A;  1YX5 B;  1JRU A;  2DHZ A;  1WZ3 A;  2IY0 B;  1WX7 A;  3VXW A;  1OEY J;  1WGH A;  2HTH A;  2L7R A;  4JQW C;  3B08 A;  2C7H A;  4G3X B;  3L10 B;  3AUL A;  2N4F A;  4KIK B;  1RFA A;  1WRD B;  2PPH A;  3C0R B;  4ANV A;  4TUU A;  4JLC A;  4KIK A;  5C23 A;  3VTV A;  5FR6 A;  3U30 A;  2LI5 A;  4DXA B;  1I42 A;  1SGH A;  2MBB B;  3KW5 B;  2NR2 A;  4A3O A;  1TGZ B;  2LJ5 A;  4GOC A;  3ML8 A;  5AZF A;  3CST A;  1P98 A;  2FCN A;  3TIX A;  3ZTC A;  4GXB A;  2AWT A;  2L05 A;  2NCN A;  2PE9 A;  4BBN C;  1WGR A;  4K1R B;  3TL5 A;  1OTR B;  2DYM A;  3A1Q A;  3KUC B;  3N30 A;  1YJ1 A;  4K7U A;  2Z0D B;  2JT4 B;  2RSU A;  4ICU A;  4IWO A;  3ZUN A;  2KFJ A;  1E8Y A;  2GMI C;  4TQ0 A;  1S3S G;  4BOZ B;  1VCB A;  3ZIM A;  2KDB A;  2KWC A;  5IA7 A;  2XEW A;  2KKC A;  2BYE A;  5G55 A;  1EF5 A;  1OGW A;  2NVU I;  2O6V D;  3A9J B;  1UGM A;  1WY8 A;  2KFK B;  3KVF B;  3PRM B;  4N9F 4;  1GNU A;  2IO3 B;  2KJR A;  2MBQ A;  2ZNV B;  2JRH A;  3QJZ A;  3HHM A;  3ZKJ C;  3PGE A;  3ZRC A;  3EEC A;  1WE6 A;  4HLE A;  3HIZ A;  3ZNZ B;  2RD0 A;  2D11 A;  2N1W A;  4EZL A;  2BPS A;  2YLM A;  4ANU A;  4DWF A;  1Y8R C;  1V5O A;  4DHZ B;  5D2M B;  3EFU A;  1EO6 A;  3O65 B;  4GB9 A;  4M8N A;  5AZG A;  2C7N B;  2R2Q A;  4NJ7 A;  4BKS D;  2K25 A;  2GBK A;  1XQQ A;  3DBR I;  4ZRK A;  4I6N B;  4KZC A;  2L76 A;  3ALB A;  1J19 A;  4HCP B;  2KZR A;  3CMM B;  1UBQ A;  1X1M A;  2KNB A;  3UIP B;  1P0R A;  3QAR A;  1QZE A;  3RD2 A;  3WAN A;  4LDT D;  3IHP C;  2MA9 B;  4B95 A;  4OVV A;  3VHT C;  2CS4 A;  4F8C B;  2VRR B;  3ZVV A;  1KLV A;  1TTN A;  2BWF A;  2IO1 B;  1R4M I;  2BYF A;  4LCD E;  2UWQ A;  2V1Y A;  1TZ1 A;  2KLG A;  4WJP A;  4WQO B;  2EMS A;  1WGG A;  2AL3 A;  1GG3 A;  4IM3 A;  4IWQ A;  2K1F A;  2M0X A;  4IM0 A;  3APC A;  2XK5 A;  4IUM B;  4X57 B;  2BKF A;  2ZCC A;  3VQI A;  2ZCB A;  4FJV B;  4II2 B;  3V62 A;  3RZF A;  3PZD A;  3BY4 B;  4KDL B;  3ZLZ A;  2JVC A;  2KJH B;  2MQJ A;  3QA8 A;  3A4R A;  2MCN B;  3B1L X;  2KC2 A;  3DDC B;  3SU8 X;  2D3G A;  2HE7 A;  3QHT A;  5BO4 B;  3R7R A;  2MLB A;  3A4S C;  3GOE A;  3UIO B;  4I6P A;  3R7Q A;  3NOB A;  2G45 B;  4K7S A;  4ANW A;  4ASW C;  1YIW A;  3DQV A;  1NBF C;  3DCG A;  4GDL B;  2G4S A;  4RM8 A;  3RUL A;  1HE8 A;  3R66 C;  1AAR A;  4GDL A;  3HM6 X;  1IPG A;  5JHA A;  4HJK A;  3PHW B;  2LRU A;  3NZS A;  3W1S C;  3H9D A;  1WXV A;  2L8J A;  1WF9 A;  2IY1 B;  4RM9 A;  5KHO A;  4HCN B;  2GBN A;  1WH3 A;  2BWE S;  2J0J A;  2BKR B;  3APF A;  3R3M A;  3L13 A;  2FAZ A;  4AWJ A;  4G11 A;  1ZKH A;  2ASQ A;  3H7S A;  4EZK A;  4KV2 A;  1UBI A;  2BF8 B;  2O6V B;  2WWZ A;  3NY5 A;  3EHV A;  2G4D B;  1IP9 A;  2IO2 B;  4WWN A;  4GN1 A;  3NS8 A;  2D10 A;  4RMA A;  3QAQ A;  2LVO A;  4W9H A;  1P1A A;  3T8M A;  5DPS A;  1GUA B;  3PLV A;  4FHK A;  1V2Y A;  2K39 A;  3UQA A;  2DYO A;  2FCS A;  4W9C A;  2JF5 A;  3VVW B;  1L7Y A;  4MGI E;  3WAM A;  2GBR A;  2NBV B;  1YX6 B;  4MSM B;  3AXC A;  4WWP A;  3SHQ A;  4MGY E;  1MG8 A;  2LGY A;  5LXH A;  3QWZ B;  2ZEQ A;  3X0W A;  3OJ4 B;  3SD5 A;  2L0F A;  4OVU A;  3PLU A;  3DBL I;  1J0G A;  3MJW A;  4F1S A;  2BYV E;  1P9D U;  4PS3 A;  3ENE A;  1T0Y A;  1IYF A;  4DK5 A;  2DZJ A;  5D7G A;  3PHX B;  4BBN F;  2KWV B;  3A33 B;  4AJY B;  4A20 A;  2ZPY A;  4KZ0 A;  4HWI B;  2ZZP B;  2WX1 A;  2O2V B;  2LXA A;  4FN2 A;  1WR6 E;  2FIF A;  2O2V A;  3OJ3 A;  4FJZ A;  4NY0 A;  3DBH I;  3QQ8 B;  4YL8 A;  3WAP A;  1WR1 A;  2KAN A;  4KDI C;  4B9K A;  3VDZ A;  1E8X A;  4FUL A;  2ZJD A;  1NI2 A;  4WJO A;  2CHX A;  1V81 A;  4DHJ D;  1E5W A;  1Q5W B;  2M1M A;  2A5U A;  2FCQ A;  3A9J A;  4K7W A;  5LXI B;  2KX3 A;  3N3K B;  2N9X A;  2KFK A;  4NJ6 A;  2PEA A;  4IWP A;  3L54 A;  4BFR A;  5DPT A;  2KMC A;  2LVP A;  1C1Y B;  2AL6 A;  2KDI A;  2D07 B;  4GIV A;  1RAX A;  5G2N A;  3ZNI D;  2CU1 A;  3ML9 A;  2QHO A;  4P7I A;  1WM2 A;  1UEL A;  4NQL B;  2KLC A;  2KD0 A;  5EDS A;  1TBE A;  2FCM A;  4NQK E;  4W9K A;  1EUV B;  4E3C A;  1RLF A;  3DVN V;  3BIN A;  2LGD A;  4TKN A;  2N1V A;  1PQS A;  3L08 A;  4HK2 A;  1VD2 A;  4ZRJ A;  2MBH A;  3DPD A;  4LJO B;  2J0M A;  4HDO A;  2KXJ A;  2LRW A;  2KN5 A;  1E8W A;  4M0W B;  4PS8 A;  1SE9 A;  3K9P B;  5E6O A;  2LD9 A;  3DVG Y;  5DPR A;  4ANX A;  3PTF C;  4MDK E;  1H8C A;  2C60 A;  5J18 A;  1V9J A;  2KX0 A;  4KSL C;  4MJS B;  5J17 A;  1Q1O A;  3ZW3 A;  1E8Z A;  4KSK C;  5D94 A;  4GDK B;  1WIA A;  1WGD A;  2KDF B;  4PYU A;  3HK0 A;  3M3J A;  3KH0 A;  2WX0 A;  2LZ6 A;  2YVC A;  3PPA A;  1WXM A;  2R2O A;  2JZZ A;  4EEW A;  4IC7 B;  4JGH B;  4EFO A;  2LAS A;  4FJY A;  2MBE A;  3OAW A;  4EOY A;  2KO3 A;  1I35 A;  2C9W B;  1H4R A;  2MW5 A;  3VUY A;  1LQB A;  4NPN A;  5L83 A;  4EZJ A;  3M63 B;  1YQB A;  3DVG X;  3ONS A;  1K8R B;  2LXC A;  1WM3 A;  1ZGU B;  4ZRI A;  2JXX A;  2RGF A;  3QX1 A;  2REX A;  1YD8 U;  3M95 A;  3Q3J A;  4AP4 C;  4DDI D;  2DYB A;  3UIN B;  2MX2 A;  5JH5 C;  2CHZ A;  2MSE D;  2B3A A;  3S2A A;  5KHQ A;  1WJU A;  1WJ6 A;  3JYU A;  3VTW A;  1GC6 A;  4G50 A;  4KVG B;  2JWZ A;  2RR9 A;  3VFK A;  4CO7 A;  4EKU A;  3T9L A;  3K9O B;  3TMP B;  5C1Z A;  2GBJ A;  3H6N A;  2JPH A;  1U4A A;  2KK8 A;  4HXD A;  1OQY A;  3IFW B;  3ZDM C;  4W9I A;  4WJN A;  5CHF A;  4LJP B;  1P3Q U;  1M94 A;  2K8H A;  4CYE A;  2DZK A;  5J2R A;  1KOT A;  2O6V A;  3CSF A;  3PV1 A;  4MGZ E;  4WJQ A;  4II3 B;  4TQ1 A;  3TJP A;  3SDL C;  2MBO A;  3H7P B;  2W9N A;  2N7E A;  3TCA A;  3UF8 A;  2FNJ B;  3QK0 A;  3JSV B;  3NHE B;  1Q0W B;  3AI5 A;  1V6E A;  1WXA A;  3B0A A;  1V86 A;  2XBB C;  3QCA A;  2JZ3 B;  4W9D A;  3ZNG C;  2Z59 B;  1XD3 B;  1LFD A;  4HVB A;  2DAJ A;  2KC1 A;  4BKG A;  3P2B A;  4WWO A;  4CHK A;  2NBU A;  1FXT B;  2G3Q B;  4W9L A;  3OLM D;  4BKS A;  3QC8 B;  2JY6 A;  4DDG D;  3PRP B;  1A5R A;  4ZDV A;  3RCZ A;  2C5L C;  3RT3 B;  2ZVO A;  2RPQ A;  1GC7 A;  4LDT B;  4W9J A;  4JL9 A;  4BKT A;  4MEL A;  2AEH A;  3VH4 B;  2N9E B;  1E7V A;  2DZM A;  2PE6 B;  2WYQ A;  4GSW A;  4BOS C;  1V49 A;  1WXS A;  1SIF A;  4GGQ A;  1E90 A;  4W9F A;  2L00 B;  2HD5 B;  2IO0 B;  2KHW B;  4ZYN A;  1WI0 A;  2V4L A;  3ZTD A;  4A3P A;  4NNJ B;  4K81 A;  3APD A;  4GMV A;  3A9K B;  4NAW B;  4W9G A;  3RUI B;  2CKH B;  1WX8 A;  4AUQ C;  3A9K A;  4NAW A;  1LXD A;  3CF6 E;  3VUW A;  2CR5 A;  3V6E B;  3H1U A;  1ISN A;  2KVR A;  3VTU A;  3TBL D; 
#chains in the Genus database with same CATH topology
 2ZPN A;  1ZW7 A;  2MP2 B;  1PYW D;  4FBJ B;  1UZX B;  4MEM A;  1G6J A;  2OOB B;  1L4D B;  4XZ4 A;  2PJH A;  2LGX A;  1TJE A;  1WYW B;  1KM7 A;  2M17 A;  2OJR A;  3ZXR A;  3WA0 A;  2DEN B;  3PRZ A;  1VRA B;  2ZNV C;  3KYC D;  4HRO A;  5CTR C;  4S0R A;  4LTU A;  1KJT A;  3IAS 1;  3L0W B;  5E6P A;  3IBE A;  2PLP A;  3AH7 A;  2KQS A;  1D3Z A;  4EE2 A;  1WMH B;  1Z2M A;  4ZRP A;  2K8B A;  3Q8E A;  1J7C A;  4GDK A;  4XC2 A;  2JUO A;  3ZDT A;  2LWP A;  3OWE B;  2PVO D;  1WJN A;  3MC0 B;  4AS1 A;  1SJH D;  3TSS A;  2DNF A;  3AN1 A;  5G5G A;  2K22 A;  2NBW B;  4NAM A;  4HPM B;  2QIL A;  1WE7 A;  1GJZ A;  4MM3 A;  1SSN A;  3WAO A;  2K9X A;  2E6X A;  4E71 A;  4AOF A;  3NVW A;  1FO4 A;  3I57 A;  3FKY A;  4TV3 A;  2K6D B;  3RYT A;  3VUX A;  3KYD D;  3U7D A;  4JIO U;  1DOX A;  3IG3 A;  4LLG M;  2LEK A;  2KTR B;  2NMQ A;  2JZP A;  3H7P A;  1FMA D;  3PT2 B;  1E0Z A;  4E74 A;  4WAA A;  3JSV A;  1DYQ A;  2DZI A;  2ACZ B;  5E6J A;  3HM3 A;  1V80 A;  2N7D A;  1J8C A;  2JYT A;  3WIM A;  2FID A;  1RRB A;  1YX5 B;  4KGR A;  1ROE A;  2IY0 B;  4YTP B;  1FXI A;  2HTH A;  3DBL B;  2QJL A;  4RGO S;  2YEP B;  2SEB D;  4KIK B;  1RFA A;  1WRD B;  4TUU A;  1C4P A;  3Q8B A;  5C23 A;  3U30 A;  4RF1 A;  4XWT A;  4PT5 A;  1XCQ L;  3CST A;  1P98 A;  1E6E B;  2UU7 A;  2WXM A;  4BBN C;  1OTR B;  2Z0D B;  4P16 A;  4ICU A;  4IWO A;  3RNF C;  4TQ0 A;  3RNA C;  2KWC A;  4ZHO A;  4ARC A;  4HJG E;  1F1H A;  2KJR A;  3HHM A;  1STE A;  3IXS A;  3RPF C;  4M00 A;  4YTN B;  2G9H D;  2D11 A;  2N1W A;  1B9R A;  1TS3 A;  1C77 A;  2Z8L A;  3I63 C;  1Y8R C;  3DWM A;  4DWF A;  3TEW A;  1V5O A;  2LHD A;  1FD6 A;  3O65 B;  4GB9 A;  5AZG A;  2C7N B;  2GBK A;  1XQQ A;  2L76 A;  4TMA B;  1X1M A;  2KNB A;  3UIP B;  1NYQ A;  3RD2 A;  2MA9 B;  3SFE B;  2CS4 A;  4F8C B;  4PK1 A;  2KWD A;  4P1B C;  3Q14 C;  1T0S C;  1C9F A;  2EMS A;  1I4R A;  4X57 B;  2AX5 A;  2ZCB A;  3C8Y A;  3ZLZ A;  4LNK A;  4N6E B;  5IN7 A;  1CQV A;  3A4R A;  1XXG A;  3SU8 X;  3QHT A;  3UIO B;  2WU2 B;  2WXR A;  3R7Q A;  2G45 B;  4ASW C;  3DQV A;  3RUL A;  2G4S A;  5EE0 A;  2IND C;  3MC8 A;  3PHW B;  2LRU A;  2BS3 B;  3NZS A;  2L8J A;  1WF9 A;  4KX6 B;  4HCN B;  2GBN A;  2J0J A;  2BWE S;  2WDV B;  3APF A;  2W54 A;  3HVZ A;  4KV2 A;  4ZRQ A;  1UWX A;  1UBI A;  2GRI A;  2WWZ A;  4KKI A;  4RCO A;  3NY5 A;  2G4D B;  3AE7 B;  2D10 A;  1TKE A;  5DPS A;  3UQA A;  5FR3 A;  1F77 A;  2INC C;  1QF6 A;  4MGI E;  1HQR D;  4C4V A;  4WWP A;  2NBV B;  3SHQ A;  1DGJ A;  4MGY E;  1MG8 A;  3QWZ B;  2ZEQ A;  3X0W A;  1BUI C;  3OJ4 B;  3AE9 B;  1JWA D;  3DBL I;  3MJW A;  4F1S A;  4HKQ A;  4QAY A;  3B9J A;  3W5V B;  4BBN F;  2ZW0 A;  1SE4 A;  3RNE C;  2ZZP B;  4US9 A;  2LXA A;  4NY0 A;  4YL8 A;  2KAC A;  2N9K A;  3VDZ A;  4WJO A;  1V81 A;  1E5W A;  3LYY A;  2GB1 A;  1P7F A;  2A5U A;  4YXD B;  4XE0 A;  2N9X A;  2PEA A;  4IWP A;  1FNW A;  3L54 A;  5DPT A;  1C1Y B;  4JX1 C;  2KDI A;  4US8 A;  4JE3 B;  2LUM A;  2QHO A;  4P7I A;  1R4N B;  5H8Y E;  1TBE A;  2KMM A;  1ZPS A;  4TKN A;  3U2S C;  3GB1 A;  2J42 A;  2LRW A;  1SE9 A;  2LD9 A;  5DPR A;  3AV8 A;  2K0P A;  1UF0 A;  5J18 A;  5EE3 A;  1WGD A;  2KDF B;  4PYU A;  3HK0 A;  3M3J A;  3NRZ A;  2LZ6 A;  2R2O A;  1TS2 A;  2JZZ A;  3VRB B;  4C00 A;  2LAS A;  2MBE A;  4EOY A;  2KO3 A;  5EE1 A;  1H4R A;  1BML C;  4JPS A;  2AQ1 B;  2MJ3 A;  4R3D A;  2OJW A;  1UNS A;  3LXF A;  2LXC A;  4K3B A;  3R8B A;  3Q3J A;  4ITK A;  4BZA A;  2WS3 B;  2DWQ A;  3P63 A;  2VZK B;  2CHZ A;  2DBY A;  4HKZ E;  3S2A A;  1SB3 C;  3NVZ A;  1GC6 A;  3DHI C;  3T9L A;  3K9O B;  2WDR B;  3ETR A;  1L0Y B;  2KK8 A;  1TIF A;  3ZDM C;  4W9I A;  3TEX A;  3N1Y C;  5CHF A;  1P3Q U;  4TSS A;  4TQ1 A;  1SBB B;  3BVG A;  3TCA A;  4YSZ B;  3GE8 C;  3QCA A;  2JZ3 B;  3ZNG C;  1IGC A;  1LFD A;  2KC1 A;  3RFZ B;  3P2B A;  4WWO A;  1T0R C;  1FXT B;  2G3Q B;  2KN4 A;  2J53 A;  1V97 A;  2JY6 A;  4A90 A;  5FKA C;  1FXA A;  4N59 A;  2WP9 B;  4MEL A;  2WYQ A;  4GSW A;  4BOS C;  1WXS A;  1E90 A;  2KHW B;  3ZTD A;  4K81 A;  3APD A;  1T3Q A;  1SXT A;  3A9K A;  2CR5 A;  1ISN A;  2KVR A;  3BK1 A;  1V5T A;  3UGB B;  4B0E A;  3AU5 A;  3KWV A;  3A1Q B;  5AUI A;  1FRR A;  2MWS B;  5LLI A;  2NTS A;  1F9J A;  2KQ7 A;  3M62 B;  1EWY C;  2J4X A;  3RI7 C;  1QOF A;  2KWU B;  5JHB A;  2KVZ A;  1D5M C;  3QIJ A;  3AMZ A;  4FHJ A;  3PSE B;  4PS7 A;  2L52 A;  3DBR B;  5JZE B;  1R4N I;  2CHW A;  1T6B X;  1Z5S B;  3V60 A;  1L2N A;  1KLG D;  3EC8 A;  5CHW A;  2I1J A;  1ZDX A;  3U8Z A;  3PRE A;  4MGK E;  2WU5 B;  2WDT B;  4IM2 A;  3U52 E;  1YN4 A;  3Q8F A;  3ZRF A;  1PGX A;  3C19 A;  3AM9 A;  4Q2J A;  2N9P C;  3BK2 A;  3V6C B;  2KTF A;  2QCZ A;  4MSQ B;  2IYD B;  4MM3 B;  4RGM A;  4DHZ E;  5CX3 A;  5IAA C;  4F7Z A;  3TEZ A;  5IP4 D;  3BVZ A;  3ECI A;  1HTO A;  2WHI A;  5AUK A;  1I4P A;  2G1E A;  2LVQ A;  2PKO A;  4AJW A;  1HZ6 A;  1T5X D;  2LUE A;  1MVK A;  4GLS C;  2N0S B;  2Z0E B;  2K6Q A;  3LDZ E;  1XT9 B;  2HTM E;  3KUD B;  2KOX A;  4PYZ A;  2WXN A;  2IGG A;  5BYR A;  3WAL A;  3I3T B;  4YSX B;  2BGF A;  3RZW C;  2BS4 B;  2I1K A;  1NYR A;  2NPT A;  2WQY B;  1JRU A;  2DHZ A;  1MJD A;  1L4Z B;  1WZ3 A;  3VXW A;  2DLB A;  1WGH A;  4LK0 M;  4RNA A;  3L10 B;  4JLC A;  2LI5 A;  4DXA B;  1JWS D;  2MBB B;  1JML A;  1TGZ B;  2LJ5 A;  3U4E G;  1WSP A;  3ML8 A;  2FCN A;  5BYS A;  4GXB A;  2NCN A;  1JRP A;  3TL5 A;  2DYM A;  2K5P A;  3A1Q A;  4K7U A;  1L0X B;  1YJ1 A;  3Q3O C;  2JT4 B;  4P1C C;  2KFJ A;  4A9A A;  1S3S G;  1TZO A;  3ZIM A;  3UI3 A;  2XEW A;  2KKC A;  2BYE A;  2NVU I;  3N20 C;  1UGM A;  3PRM B;  3KVF B;  1GNU A;  2H89 B;  3ZKJ C;  2VH1 A;  4EZL A;  1K51 A;  1VDV A;  4ANU A;  2LHE A;  1XCT L;  3GP7 A;  5D2M B;  2IJ0 A;  1D4B A;  3IT6 B;  3DBR I;  4ZRK A;  3CMM B;  1P0R A;  4YT0 B;  1QZE A;  3WAN A;  4B95 A;  3VHT C;  1N63 A;  1D5X C;  1KLV A;  2BWF A;  4WUR A;  2BYF A;  1YN5 A;  4LCD E;  4WQO B;  1WGG A;  4D2K A;  4IM3 A;  5MPO A;  3VQI A;  2LGI A;  3ZJT A;  2IPK D;  2M19 A;  3PZD A;  3BY4 B;  4KGT A;  2KJH B;  2CJN A;  2MQJ A;  3DDC B;  4YSY B;  2BYT A;  4K7S A;  4ANW A;  2RDH A;  2QDF A;  3HM6 X;  4ZYS A;  1IPG A;  4JWS C;  1WXV A;  2IY1 B;  5KHO A;  3R3M A;  2FAZ A;  1B1Z A;  3H7S A;  1WWT A;  4RFB A;  4WWN A;  5BMI A;  3T8M A;  4FHK A;  5BYQ A;  2FCS A;  4C4V B;  4W9C A;  4WIP A;  3VVW B;  2W55 A;  1L7Y A;  3WAM A;  1JRO A;  2GBR A;  4MSM B;  3MFG A;  3AEA B;  3AE3 B;  2OHF A;  3MP9 A;  2JYE A;  2INP E;  2DZJ A;  5HI1 A;  2WNM A;  1XO3 A;  5BMG A;  1JWM D;  3RNC C;  4FN2 A;  4ARI A;  4HPP A;  4FJZ A;  5H92 C;  3Q6B A;  4UDU C;  3BVM A;  3EGR A;  1WGK A;  2ZJD A;  2CHX A;  4DHJ D;  4K7W A;  3N3K B;  2LVP A;  4GIV A;  5G2N A;  1VR9 A;  3BYT B;  5G5H A;  3ML9 A;  2WLB A;  1XF5 L;  1FPY A;  2FCM A;  1ET9 A;  4E3C A;  3SEB A;  3BIN A;  2LGD A;  2WXO A;  3L08 A;  4RGN A;  4BAX A;  1VD2 A;  2IDY A;  3AED B;  1K53 A;  1YNT E;  3U7Z A;  2J0M A;  2BB5 A;  4HDO A;  1JWU D;  4PS8 A;  3HUI A;  5E6O A;  3DVG Y;  5LNK 1;  1H8C A;  2C60 A;  2NTT A;  1RYJ A;  1MG4 A;  1BXT A;  2KX0 A;  1Q1O A;  2WXL A;  3ZW3 A;  4KSK C;  3KH0 A;  5D3D A;  2I2Y A;  4N58 A;  2KDM A;  4JGH B;  4S17 A;  4EFO A;  1TYG B;  3OAW A;  2C9W B;  1WYG A;  1FCL A;  1LQB A;  3DVG X;  1WM3 A;  2RGF A;  3MJ5 A;  1WXQ A;  1YD8 U;  3M95 A;  2DYB A;  3UIN B;  1I4G A;  1C78 A;  5JH5 C;  1N62 A;  1AWD A;  2BBC A;  3VTW A;  4KVG B;  2RR9 A;  4CO7 A;  4EKU A;  1KLU D;  1J7A A;  1RM6 C;  2JPH A;  1U4A A;  3IAM 1;  4HXD A;  4B0M A;  4WJN A;  1KOT A;  5J2R A;  4JWU C;  2R61 A;  3PV1 A;  4WJQ A;  2ZW1 A;  2M0A A;  3GZN B;  3NHE B;  1Q0W B;  1V6E A;  4W9D A;  2XBB C;  2Z59 B;  1F52 A;  4IDI A;  4CHK A;  2NBU A;  1M4V A;  3BII D;  4DQO C;  2I38 A;  1I4X A;  3PRP B;  4WWM A;  3RT3 B;  2RPQ A;  1MPE A;  2BT6 A;  2WXJ A;  3VH4 B;  2N9E B;  4LNN A;  4A8X C;  2DZM A;  4W9F A;  3E9S A;  1A70 A;  2IO0 B;  5HFY A;  1YJJ A;  4W9G A;  3A9K B;  4NAW A;  3VUW A;  1LXD A;  1D6E C;  2Y5P A;  3CF6 E;  2QEJ C;  1JQ4 A;  3W2D A;  3TBL D;  4LNF A;  1YQ3 B;  3PVL A;  3D32 A;  2V3S A;  4IKG A;  3VAW A;  1V8C A;  4YTM B;  1QIL A;  3Q3F A;  4A6Q A;  1OQR A;  2XNA C;  3DVN U;  4DBG A;  2JWU A;  2WXP A;  2VH2 A;  5E6N A;  2IBI B;  1WFY A;  2D3B A;  3VH3 B;  1EF1 A;  5TSS A;  1PGA A;  1CMX B;  1MHH E;  4ZHP A;  1I4H A;  1WJ4 A;  4LNO A;  4P6V F;  5AZH A;  4L1B A;  1OEY A;  3ZJV A;  5AEK B;  4REZ A;  4USA A;  1LM8 B;  5GMV A;  1XLQ A;  2UYZ B;  4ICV A;  4G0N B;  1JAL A;  2K8C A;  3DOW A;  4J3O D;  3DWG C;  4M8M A;  3L4P A;  3RNB C;  1E7U A;  1YJI A;  3L17 A;  3MTN B;  2V0G A;  3AEB B;  1HZ5 A;  4I6L B;  2XK5 B;  2NS5 A;  5C3J B;  2J0K A;  2M8S A;  5CHV C;  5DCN A;  3ZO5 B;  2DAF A;  1QLB B;  2FE8 A;  3V61 A;  2KT7 A;  2KYW A;  1WGY A;  1XLN A;  2EEL A;  3W1Y A;  3V3X A;  4W9E A;  3X23 A;  2C7M B;  5JXV A;  2L3Z A;  3W1S A;  2GBM A;  3TUO A;  1UD7 A;  2L32 A;  4URK A;  4IW0 A;  1WX9 A;  4GU2 A;  2EKE C;  3P42 A;  3ZJU A;  2QMT A;  2HJ8 A;  1SIJ A;  2WXI A;  5HKH A;  3N1X C;  1SE3 A;  1Q10 A;  2NPT B;  2M4N A;  3GZN I;  1KH0 A;  1TKG A;  3RN9 C;  2L7R A;  3B08 A;  2C7H A;  3KQ4 A;  3C0R B;  4C80 A;  1NI3 A;  4ZOH C;  1I42 A;  3AEG B;  2PVG C;  3KW5 B;  2NR2 A;  4A3O A;  4GOC A;  2X38 A;  4RGT A;  5AZF A;  2QIE B;  3TIX A;  1N6Z A;  3Q8C A;  3ZTC A;  3KLS X;  2AWT A;  2L05 A;  2FUG 1;  2ONQ A;  2PE9 A;  3KUC B;  3N30 A;  1YOV B;  2RSU A;  3TEY A;  1ZP0 B;  1E8Y A;  4BOZ B;  1VCB A;  2K3U A;  2KDB A;  2JXT A;  1OGW A;  2O6V D;  4N9F 4;  2MBQ A;  3QJZ A;  3T3N A;  1C4C A;  3PGE A;  3R2I A;  4XGA B;  3ZRC A;  2GLS A;  4HLE A;  3ZNZ B;  3PO0 A;  2RD0 A;  3Q3M C;  1KFY B;  2YLM A;  3AE8 B;  1GAQ B;  1EO6 A;  1C4A A;  2Y5C A;  2R2Q A;  3ZXV A;  1KF6 B;  2BW2 A;  2K25 A;  1N5W A;  2WXF A;  4I6N B;  3NS1 A;  4KZC A;  1NEK B;  3ALB A;  1J19 A;  4HCP B;  2KZR A;  2WXH A;  4LDT D;  1SJE D;  1ZXI A;  1EWC A;  1TT5 B;  4OVV A;  1XLP A;  1ESF A;  2VRR B;  1V1O A;  3ZVV A;  1TTN A;  2RPV A;  4NJC A;  1DOY A;  1ET6 A;  2UWQ A;  2V1Y A;  1GG3 A;  2M0X A;  4IM0 A;  3N1Z C;  2RDG A;  2XK5 A;  3AEE B;  4IUM B;  4KKJ A;  1FNU A;  3FIL B;  1E9M A;  3V62 A;  1ZE3 D;  3B2G A;  2MCN B;  1MHX A;  5BO4 B;  3R7R A;  1F2R I;  1NEN B;  4RH6 A;  1IGD A;  1YIW A;  3DCG A;  2M56 B;  3R66 C;  4GDL A;  2V3N A;  4HJK A;  1AYF A;  3W1S C;  1FCC C;  4OZA A;  4RM9 A;  4H2A A;  2JU6 X;  1E10 A;  1WH3 A;  3P4Q B;  2BKR B;  4K3C A;  4G11 A;  2ASQ A;  3AEC B;  2O6V B;  2BB6 A;  2D5G A;  3EHV A;  3NS8 A;  2LVO A;  1P1A A;  2INN E;  1LO5 D;  1GUA B;  3PLV A;  1V2Y A;  2K39 A;  1I7H A;  1YX6 B;  2LGY A;  2MJD A;  5LXH A;  3GE3 C;  2D3A A;  2L0F A;  4OVU A;  3PLU A;  1J0G A;  3CWI A;  3V05 A;  4C7Z A;  3B2F A;  1P9D U;  1TS4 A;  3ENE A;  1T0Y A;  1JW9 D;  4DK5 A;  5D7G A;  4OW0 A;  4MH8 A;  2KWV B;  3A33 B;  2MHJ A;  4A20 A;  2WX1 A;  1WR6 E;  2EKI A;  2O2V A;  1QQR A;  3QQ8 B;  1WR1 A;  4B9K A;  1E8X A;  4FUL A;  5T8I A;  2BTE A;  3AE2 B;  2M1M A;  2BS2 B;  5LXI B;  1V1P B;  4BFR A;  2WXG A;  2AL6 A;  3W9C B;  2D07 B;  1RAX A;  1XEE A;  4OHJ A;  2RMM A;  1MFW A;  1WM2 A;  1FFU A;  5EDS A;  1PGB A;  2AQ2 B;  2KD0 A;  1EUV B;  1RLF A;  3DVN V;  1PQS A;  4HK2 A;  3GS2 A;  2KQ4 X;  3KWL A;  2MBH A;  1E8W A;  3VRA B;  4M0W A;  4ANX A;  4MDK E;  1V9J A;  5J17 A;  4MJS B;  1WIA A;  3PPA A;  2WX0 A;  3FC4 A;  1SEB D;  1EU3 A;  1EU4 A;  4IC7 B;  4EEW A;  1N5X A;  1E7P B;  2MW5 A;  3MC9 A;  3FIL A;  3AE6 B;  3P4R B;  4NPN A;  1ZDV A;  2LMC A;  3E56 A;  3ONS A;  1K8R B;  2CJO A;  1ZGU B;  1F2R C;  4ZRI A;  2JXX A;  3QX1 A;  3NZ3 A;  1C76 A;  4RF0 A;  3W5U B;  2QC8 A;  4L23 A;  1OQY A;  1TY0 A;  3IFW B;  2IGH A;  1N60 A;  4CYE A;  4LJP B;  1M94 A;  2DZK A;  2J52 A;  2O6V A;  4A55 A;  4II3 B;  3SDL C;  3UF8 A;  3B0A A;  1WXA A;  2D3C A;  2H88 B;  1XD3 B;  2MH7 A;  3AE5 B;  2DAJ A;  4DXF A;  1GOZ A;  4BKG A;  1OQQ A;  1MI0 A;  4W9L A;  2KAJ A;  2HJ1 A;  3QC8 B;  3VR8 B;  1A5R A;  4ZDV A;  3RCZ A;  2C5L C;  1C79 A;  1GC7 A;  1VJK A;  4JL9 A;  2Q5W D;  4BKT A;  2AEH A;  1E7V A;  4GGQ A;  1IBX A;  1P7E A;  1SIF A;  4ZYN A;  4A3P A;  1WI0 A;  2V4L A;  4NAW B;  1F0Z A;  4AUQ C;  3J9C A;  3V6E B;  3H1U A;  2V9H A;  2LJI A;  5C2T B;  3Q8A A;  1YN3 A;  3VTU A;  1S1Q B;  4IG7 B;  1WZ0 A;  3KUZ A;  4MH0 E;  2MRP A;  3AEF B;  2MP2 A;  3IT4 B;  2MJE A;  1V1P A;  4XWW A;  4FAD A;  5L95 C;  1UH6 A;  5D6J B;  3JW0 X;  2XN9 C;  3PS6 A;  3ZNH B;  2QSD A;  4WAF A;  1C3T A;  3DBS A;  1NDD A;  1AN8 A;  1GPX A;  3NZU A;  2D2Q A;  4O1N A;  3L16 A;  3IVF A;  3HRD D;  5IOI A;  2GOW A;  2AYO B;  1KTK A;  1FM0 D;  2CU3 A;  3MHZ A;  2V3P A;  3UQB A;  1K52 A;  4MJS A;  1WMH A;  4XX5 A;  1BT0 A;  1LGR A;  4FLH A;  1R4M B;  1K50 A;  4HPL B;  3I5J C;  1PDX A;  1HXY D;  4FA6 A;  4HRS A;  2HDE A;  2L0T A;  3JVZ X;  2JRI B;  2W3R A;  2DX5 B;  4XDC A;  3AU4 A;  3AE4 B;  4J6I A;  3H8H A;  1Y56 A;  2OED A;  1ZUD 2;  1N61 A;  3LB8 C;  2KMA A;  2IZV B;  3EUB 2;  4HDQ A;  2W82 A;  2KDE B;  2FUH B;  1L6V A;  2AQ3 B;  2EMT A;  3FAH A;  3N32 A;  4DHJ B;  5HG2 A;  1KRH A;  2E3T A;  1VZ6 A;  5IO9 A;  4B6W A;  1RFK A;  4MAC A;  2KJ6 A;  2KTR A;  5EE9 A;  4HEA 1;  2Y5B B;  5TR5 A;  4XYC A;  2A4Z A;  1D5Z C;  4EUT A;  3LJ3 A;  3MHS D;  1J7B A;  2J7Q B;  2ZVN A;  1I4Q A;  4BVU C;  5DPW A;  1SE2 A;  3NVV A;  1FRD A;  1TKY A;  2PIA A;  1WX7 A;  1OEY J;  4JQW C;  4G3X B;  1AW7 A;  1GB1 A;  3AUL A;  2PMV A;  2N4F A;  1NVI D;  2PPH A;  4ANV A;  3O13 A;  2V4I B;  4KIK A;  3VTV A;  5FR6 A;  1SGH A;  3N9Y C;  2WGS A;  3BYY B;  2W3S A;  3DBH B;  2VZK D;  2L1A A;  1WGR A;  4K1R B;  4C7Y A;  1L6U A;  1RWS A;  3ZUN A;  4XDD A;  2GMI C;  5IA7 A;  5G55 A;  3VR9 B;  1EF5 A;  4NZL B;  1GB4 A;  3A9J B;  2L83 A;  1WY8 A;  2KFK B;  2IO3 B;  2ZNV B;  2JRH A;  4OZC A;  3NUH B;  1ACC A;  1VZ7 A;  3EEC A;  1WE6 A;  3EFC A;  1IUE A;  3HIZ A;  3P4P B;  2BPS A;  1JWB D;  5I4D A;  3AE1 B;  4DHZ B;  3EFU A;  1WRI A;  4M8N A;  1HA5 A;  2JX5 A;  3URY A;  4NJ7 A;  4BKS D;  2PW9 A;  1QOG A;  1UBQ A;  3QAR A;  3BWU D;  3IHP C;  1QT9 A;  2ICI A;  3AB5 A;  2IO1 B;  1R4M I;  4WJP A;  1TZ1 A;  2KLG A;  2AL3 A;  4IWQ A;  2K1F A;  4FXC A;  2SAK A;  3APC A;  2BKF A;  2ZCC A;  1QOA A;  4FJV B;  4II2 B;  3RZF A;  3CIR B;  1HEZ E;  3NVY A;  3EA6 A;  2JSV X;  3R2T A;  4KDL B;  2JVC A;  4OVZ A;  3QA8 A;  3B1L X;  2KC2 A;  2D3G A;  2HE7 A;  4M01 A;  2MLB A;  3A4S C;  3GOE A;  4I6P A;  3NOB A;  1NBF C;  4GDL B;  4RM8 A;  1HE8 A;  2BQQ A;  3BZD B;  1AAR A;  5JHA A;  3H9D A;  2ON8 A;  1EM7 A;  1UGJ A;  3P1M A;  3L13 A;  4AWJ A;  1ZKH A;  5D3I B;  4EZK A;  2BF8 B;  4M02 A;  1IP9 A;  2IO2 B;  3Q2A C;  4GN1 A;  4RMA A;  3QAQ A;  3NG0 A;  4W9H A;  3ZYY X;  3SR6 A;  2DYO A;  1L5P A;  2JF5 A;  3T3O A;  2B76 B;  3WCQ A;  3AXC A;  5BMH A;  3HVD A;  3SD5 A;  1FFV A;  2BYV E;  1FNV A;  4PS3 A;  4ACF A;  1ZXH A;  1IYF A;  3PHX B;  4YWG G;  4AJY B;  2ZPY A;  1SF0 A;  4KZ0 A;  4HWI B;  2O2V B;  2PTL A;  2FIF A;  3OJ3 A;  4IOI E;  1DOI A;  4C56 C;  3DBH I;  3WAP A;  2LGS A;  4KDI C;  2KAN A;  3I9V 1;  3Q3N C;  1NI2 A;  1Q5W B;  2FCQ A;  3A9J A;  2KX3 A;  1CZP A;  1CK1 A;  2KFK A;  4NJ6 A;  1L0V B;  3PZ7 A;  2KMC A;  3ZQ4 A;  1HTQ A;  1ENF A;  2FBW B;  3ZNI D;  2CU1 A;  3ABV B;  1UEL A;  4NQL B;  2KLC A;  4WH4 A;  4NQK E;  4W9K A;  3SFD B;  2N1V A;  4LNI A;  1QKZ A;  3DHH C;  4ZRJ A;  1YQ4 B;  3DPD A;  4LJO B;  5HHD G;  5GXG B;  2KXJ A;  4M0W B;  2KN5 A;  3K9P B;  3PTF C;  1YMH E;  2TSS A;  4KSL C;  1E8Z A;  5D94 A;  1OFF A;  4GDK B;  2YVC A;  4OZB A;  1WXM A;  4FJY A;  3RMK C;  1JCK B;  1I35 A;  2BVC A;  4KGS A;  3VUY A;  2LFI A;  5L83 A;  4EZJ A;  3M63 B;  1YQB A;  1XLO A;  5IKC M;  1UWM A;  2GI9 A;  2REX A;  4AP4 C;  4DDI D;  2MX2 A;  2MSE D;  2X8X X;  2B3A A;  3OG5 A;  5KHQ A;  2N7J A;  1WJU A;  1WJ6 A;  3JYU A;  2WXQ A;  4G50 A;  2RDB C;  4L2Y A;  2JWZ A;  3VFK A;  1FEH A;  1R7S A;  3TMP B;  5C1Z A;  2GBJ A;  3H6N A;  1UUP A;  1PUT A;  2WXK A;  4DXG A;  2K8H A;  2JQR B;  3CSF A;  4MGZ E;  3NJT A;  3TJP A;  2MBO A;  3H7P B;  1TS5 A;  2N7E A;  2IGD A;  2W9N A;  2FNJ B;  3QK0 A;  3JSV B;  3AI5 A;  3Q69 A;  2MEK A;  1V86 A;  2Y3A A;  3DHG C;  1PFD A;  4HVB A;  1TY2 A;  3P4S B;  3OLM D;  4BKS A;  2N9L A;  4DDG D;  4MT5 A;  1ZOY B;  2YEP F;  3PZ8 A;  2ZVO A;  4LDT B;  4W9J A;  3ZGZ A;  3RNG C;  1IBX B;  1FIQ A;  1QOB A;  2PE6 B;  1V49 A;  2HD5 B;  2L00 B;  2WDQ B;  4AQ7 A;  4NNJ B;  1CJE A;  4GMV A;  3RUI B;  1VLB A;  1VZ8 A;  2CKH B;  1WX8 A;  4WQM A;  4CQN A;  1T0Q C;  5FK9 C; 
#chains in the Genus database with same CATH homology
 1V5T A;  2ZPN A;  3UGB B;  3AU5 A;  1S1Q B;  4IG7 B;  3PVL A;  1WZ0 A;  3KUZ A;  1ZW7 A;  3D32 A;  2V3S A;  4MH0 E;  2MP2 B;  4FBJ B;  3A1Q B;  1UZX B;  4MEM A;  3VAW A;  1G6J A;  2MRP A;  2OOB B;  2MP2 A;  2MWS B;  5LLI A;  3Q3F A;  4XZ4 A;  2PJH A;  2LGX A;  4FAD A;  1WYW B;  1KM7 A;  2M17 A;  1F9J A;  2OJR A;  3DVN U;  4DBG A;  3WA0 A;  2DEN B;  5L95 C;  1UH6 A;  5D6J B;  2KQ7 A;  3M62 B;  2ZNV C;  3PRZ A;  3JW0 X;  5E6N A;  2IBI B;  3KYC D;  1WFY A;  3PS6 A;  2KWU B;  3VH3 B;  3ZNH B;  5CTR C;  1EF1 A;  5JHB A;  1C3T A;  1KJT A;  3DBS A;  1CMX B;  1NDD A;  3L0W B;  5E6P A;  3QIJ A;  3NZU A;  2D2Q A;  4FHJ A;  3IBE A;  3L16 A;  3PSE B;  3IVF A;  4PS7 A;  5JZE B;  1R4N I;  1WJ4 A;  2CHW A;  2AYO B;  2GOW A;  2KQS A;  1D3Z A;  1Z5S B;  3V60 A;  1L2N A;  3EC8 A;  5AZH A;  5CHW A;  2I1J A;  1WMH B;  1Z2M A;  1OEY A;  3UQB A;  5AEK B;  2K8B A;  4MJS A;  1WMH A;  1LM8 B;  3U8Z A;  3PRE A;  4GDK A;  4MGK E;  5GMV A;  2WDT B;  4XX5 A;  2UYZ B;  1BT0 A;  4ICV A;  4IM2 A;  4FLH A;  4XC2 A;  2JUO A;  3ZDT A;  4HPL B;  2LWP A;  4G0N B;  4FA6 A;  2K8C A;  2L0T A;  3DOW A;  1WJN A;  3JVZ X;  2JRI B;  4M8M A;  3ZRF A;  2DX5 B;  3AU4 A;  1E7U A;  2N9P C;  3L17 A;  3MTN B;  4J6I A;  3V6C B;  2KTF A;  4MSQ B;  4I6L B;  2IYD B;  2NS5 A;  2XK5 B;  2NBW B;  2J0K A;  2M8S A;  5CHV C;  4HPM B;  5DCN A;  3ZO5 B;  4DHZ E;  1WE7 A;  5CX3 A;  2KMA A;  5IAA C;  1GJZ A;  4MM3 A;  2IZV B;  4F7Z A;  3WAO A;  2DAF A;  3V61 A;  3ECI A;  4E71 A;  4HDQ A;  4AOF A;  2KDE B;  2LVQ A;  1WGY A;  2FUH B;  4AJW A;  4TV3 A;  2LUE A;  2K6D B;  3W1Y A;  3RYT A;  3VUX A;  4W9E A;  2EMT A;  3X23 A;  3N32 A;  2C7M B;  2L3Z A;  3KYD D;  3W1S A;  4DHJ B;  2GBM A;  3U7D A;  2Z0E B;  4JIO U;  2K6Q A;  3IG3 A;  1UD7 A;  3LDZ E;  4B6W A;  1XT9 B;  2KTR B;  3KUD B;  4URK A;  2KOX A;  4IW0 A;  1WX9 A;  3H7P A;  2EKE C;  4GU2 A;  2KJ6 A;  2KTR A;  4PYZ A;  3PT2 B;  4E74 A;  4WAA A;  2Y5B B;  3JSV A;  5TR5 A;  3WAL A;  2DZI A;  2HJ8 A;  3I3T B;  2A4Z A;  5HKH A;  2BGF A;  3RZW C;  4EUT A;  3LJ3 A;  3HM3 A;  3MHS D;  1V80 A;  2N7D A;  2NPT B;  2M4N A;  1J8C A;  2J7Q B;  2ZVN A;  2I1K A;  4BVU C;  5DPW A;  2NPT A;  3GZN I;  3WIM A;  2FID A;  1RRB A;  1YX5 B;  1JRU A;  2DHZ A;  1WZ3 A;  2IY0 B;  1WX7 A;  3VXW A;  1OEY J;  1WGH A;  2HTH A;  2L7R A;  4JQW C;  3B08 A;  2C7H A;  4G3X B;  3L10 B;  3AUL A;  2N4F A;  4KIK B;  1RFA A;  1WRD B;  2PPH A;  3C0R B;  4ANV A;  4TUU A;  4JLC A;  4KIK A;  5C23 A;  3VTV A;  5FR6 A;  3U30 A;  2LI5 A;  4DXA B;  1I42 A;  1SGH A;  2MBB B;  3KW5 B;  2NR2 A;  4A3O A;  1TGZ B;  2LJ5 A;  4GOC A;  3ML8 A;  5AZF A;  3CST A;  1P98 A;  2FCN A;  3TIX A;  3ZTC A;  4GXB A;  2AWT A;  2L05 A;  2NCN A;  2PE9 A;  4BBN C;  1WGR A;  4K1R B;  3TL5 A;  1OTR B;  2DYM A;  3A1Q A;  3KUC B;  3N30 A;  1YJ1 A;  4K7U A;  2Z0D B;  2JT4 B;  2RSU A;  4ICU A;  4IWO A;  3ZUN A;  2KFJ A;  1E8Y A;  2GMI C;  4TQ0 A;  1S3S G;  4BOZ B;  1VCB A;  3ZIM A;  2KDB A;  2KWC A;  5IA7 A;  2XEW A;  2KKC A;  2BYE A;  5G55 A;  1EF5 A;  1OGW A;  2NVU I;  2O6V D;  3A9J B;  1UGM A;  1WY8 A;  2KFK B;  3KVF B;  3PRM B;  4N9F 4;  1GNU A;  2IO3 B;  2KJR A;  2MBQ A;  2ZNV B;  2JRH A;  3QJZ A;  3HHM A;  3ZKJ C;  3PGE A;  3ZRC A;  3EEC A;  1WE6 A;  4HLE A;  3HIZ A;  3ZNZ B;  2RD0 A;  2D11 A;  2N1W A;  4EZL A;  2BPS A;  2YLM A;  4ANU A;  4DWF A;  1Y8R C;  1V5O A;  4DHZ B;  5D2M B;  3EFU A;  1EO6 A;  3O65 B;  4GB9 A;  4M8N A;  5AZG A;  2C7N B;  2R2Q A;  4NJ7 A;  4BKS D;  2K25 A;  2GBK A;  1XQQ A;  3DBR I;  4ZRK A;  4I6N B;  4KZC A;  2L76 A;  3ALB A;  1J19 A;  4HCP B;  2KZR A;  3CMM B;  1UBQ A;  1X1M A;  2KNB A;  3UIP B;  1P0R A;  3QAR A;  1QZE A;  3RD2 A;  3WAN A;  4LDT D;  3IHP C;  2MA9 B;  4B95 A;  4OVV A;  3VHT C;  2CS4 A;  4F8C B;  2VRR B;  3ZVV A;  1KLV A;  1TTN A;  2BWF A;  2IO1 B;  1R4M I;  2BYF A;  4LCD E;  2UWQ A;  2V1Y A;  1TZ1 A;  2KLG A;  4WJP A;  4WQO B;  2EMS A;  1WGG A;  2AL3 A;  1GG3 A;  4IM3 A;  4IWQ A;  2K1F A;  2M0X A;  4IM0 A;  3APC A;  2XK5 A;  4IUM B;  4X57 B;  2BKF A;  2ZCC A;  3VQI A;  2ZCB A;  4FJV B;  4II2 B;  3V62 A;  3RZF A;  3PZD A;  3BY4 B;  4KDL B;  3ZLZ A;  2JVC A;  2KJH B;  2MQJ A;  3QA8 A;  3A4R A;  2MCN B;  3B1L X;  2KC2 A;  3DDC B;  3SU8 X;  2D3G A;  2HE7 A;  3QHT A;  5BO4 B;  3R7R A;  2MLB A;  3A4S C;  3GOE A;  3UIO B;  4I6P A;  3R7Q A;  3NOB A;  2G45 B;  4K7S A;  4ANW A;  4ASW C;  1YIW A;  3DQV A;  1NBF C;  3DCG A;  4GDL B;  2G4S A;  4RM8 A;  3RUL A;  1HE8 A;  3R66 C;  1AAR A;  4GDL A;  3HM6 X;  1IPG A;  5JHA A;  4HJK A;  3PHW B;  2LRU A;  3NZS A;  3W1S C;  3H9D A;  1WXV A;  2L8J A;  1WF9 A;  2IY1 B;  4RM9 A;  5KHO A;  4HCN B;  2GBN A;  1WH3 A;  2BWE S;  2J0J A;  2BKR B;  3APF A;  3R3M A;  3L13 A;  2FAZ A;  4AWJ A;  4G11 A;  1ZKH A;  2ASQ A;  3H7S A;  4EZK A;  4KV2 A;  1UBI A;  2BF8 B;  2O6V B;  2WWZ A;  3NY5 A;  3EHV A;  2G4D B;  1IP9 A;  2IO2 B;  4WWN A;  4GN1 A;  3NS8 A;  2D10 A;  4RMA A;  3QAQ A;  2LVO A;  4W9H A;  1P1A A;  3T8M A;  5DPS A;  1GUA B;  3PLV A;  4FHK A;  1V2Y A;  2K39 A;  3UQA A;  2DYO A;  2FCS A;  4W9C A;  2JF5 A;  3VVW B;  1L7Y A;  4MGI E;  3WAM A;  2GBR A;  2NBV B;  1YX6 B;  4MSM B;  3AXC A;  4WWP A;  3SHQ A;  4MGY E;  1MG8 A;  2LGY A;  5LXH A;  3QWZ B;  2ZEQ A;  3X0W A;  3OJ4 B;  3SD5 A;  2L0F A;  4OVU A;  3PLU A;  3DBL I;  1J0G A;  3MJW A;  4F1S A;  2BYV E;  1P9D U;  4PS3 A;  3ENE A;  1T0Y A;  1IYF A;  4DK5 A;  2DZJ A;  5D7G A;  3PHX B;  4BBN F;  2KWV B;  3A33 B;  4AJY B;  4A20 A;  2ZPY A;  4KZ0 A;  4HWI B;  2ZZP B;  2WX1 A;  2O2V B;  2LXA A;  4FN2 A;  1WR6 E;  2FIF A;  2O2V A;  3OJ3 A;  4FJZ A;  4NY0 A;  3DBH I;  3QQ8 B;  4YL8 A;  3WAP A;  1WR1 A;  2KAN A;  4KDI C;  4B9K A;  3VDZ A;  1E8X A;  4FUL A;  2ZJD A;  1NI2 A;  4WJO A;  2CHX A;  1V81 A;  4DHJ D;  1E5W A;  1Q5W B;  2M1M A;  2A5U A;  2FCQ A;  3A9J A;  4K7W A;  5LXI B;  2KX3 A;  3N3K B;  2N9X A;  2KFK A;  4NJ6 A;  2PEA A;  4IWP A;  3L54 A;  4BFR A;  5DPT A;  2KMC A;  2LVP A;  1C1Y B;  2AL6 A;  2KDI A;  2D07 B;  4GIV A;  1RAX A;  5G2N A;  3ZNI D;  2CU1 A;  3ML9 A;  2QHO A;  4P7I A;  1WM2 A;  1UEL A;  4NQL B;  2KLC A;  2KD0 A;  5EDS A;  1TBE A;  2FCM A;  4NQK E;  4W9K A;  1EUV B;  4E3C A;  1RLF A;  3DVN V;  3BIN A;  2LGD A;  4TKN A;  2N1V A;  1PQS A;  3L08 A;  4HK2 A;  1VD2 A;  4ZRJ A;  2MBH A;  3DPD A;  4LJO B;  2J0M A;  4HDO A;  2KXJ A;  2LRW A;  2KN5 A;  1E8W A;  4M0W B;  4PS8 A;  1SE9 A;  3K9P B;  5E6O A;  2LD9 A;  3DVG Y;  5DPR A;  4ANX A;  3PTF C;  4MDK E;  1H8C A;  2C60 A;  5J18 A;  1V9J A;  2KX0 A;  4KSL C;  4MJS B;  5J17 A;  1Q1O A;  3ZW3 A;  1E8Z A;  4KSK C;  5D94 A;  4GDK B;  1WIA A;  1WGD A;  2KDF B;  4PYU A;  3HK0 A;  3M3J A;  3KH0 A;  2WX0 A;  2LZ6 A;  2YVC A;  3PPA A;  1WXM A;  2R2O A;  2JZZ A;  4EEW A;  4IC7 B;  4JGH B;  4EFO A;  2LAS A;  4FJY A;  2MBE A;  3OAW A;  4EOY A;  2KO3 A;  1I35 A;  2C9W B;  1H4R A;  2MW5 A;  3VUY A;  1LQB A;  4NPN A;  5L83 A;  4EZJ A;  3M63 B;  1YQB A;  3DVG X;  3ONS A;  1K8R B;  2LXC A;  1WM3 A;  1ZGU B;  4ZRI A;  2JXX A;  2RGF A;  3QX1 A;  2REX A;  1YD8 U;  3M95 A;  3Q3J A;  4AP4 C;  4DDI D;  2DYB A;  3UIN B;  2MX2 A;  5JH5 C;  2CHZ A;  2MSE D;  2B3A A;  3S2A A;  5KHQ A;  1WJU A;  1WJ6 A;  3JYU A;  3VTW A;  1GC6 A;  4G50 A;  4KVG B;  2JWZ A;  2RR9 A;  3VFK A;  4CO7 A;  4EKU A;  3T9L A;  3K9O B;  3TMP B;  5C1Z A;  2GBJ A;  3H6N A;  2JPH A;  1U4A A;  2KK8 A;  4HXD A;  1OQY A;  3IFW B;  3ZDM C;  4W9I A;  4WJN A;  5CHF A;  4LJP B;  1P3Q U;  1M94 A;  2K8H A;  4CYE A;  2DZK A;  5J2R A;  1KOT A;  2O6V A;  3CSF A;  3PV1 A;  4MGZ E;  4WJQ A;  4II3 B;  4TQ1 A;  3TJP A;  3SDL C;  2MBO A;  3H7P B;  2W9N A;  2N7E A;  3TCA A;  3UF8 A;  2FNJ B;  3QK0 A;  3JSV B;  3NHE B;  1Q0W B;  3AI5 A;  1V6E A;  1WXA A;  3B0A A;  1V86 A;  2XBB C;  3QCA A;  2JZ3 B;  4W9D A;  3ZNG C;  2Z59 B;  1XD3 B;  1LFD A;  4HVB A;  2DAJ A;  2KC1 A;  4BKG A;  3P2B A;  4WWO A;  4CHK A;  2NBU A;  1FXT B;  2G3Q B;  4W9L A;  3OLM D;  4BKS A;  3QC8 B;  2JY6 A;  4DDG D;  3PRP B;  1A5R A;  4ZDV A;  3RCZ A;  2C5L C;  3RT3 B;  2ZVO A;  2RPQ A;  1GC7 A;  4LDT B;  4W9J A;  4JL9 A;  4BKT A;  4MEL A;  2AEH A;  3VH4 B;  2N9E B;  1E7V A;  2DZM A;  2PE6 B;  2WYQ A;  4GSW A;  4BOS C;  1V49 A;  1WXS A;  1SIF A;  4GGQ A;  1E90 A;  4W9F A;  2L00 B;  2HD5 B;  2IO0 B;  2KHW B;  4ZYN A;  1WI0 A;  2V4L A;  3ZTD A;  4A3P A;  4NNJ B;  4K81 A;  3APD A;  4GMV A;  3A9K B;  4NAW B;  4W9G A;  3RUI B;  2CKH B;  1WX8 A;  4AUQ C;  3A9K A;  4NAW A;  1LXD A;  3CF6 E;  3VUW A;  2CR5 A;  3V6E B;  3H1U A;  1ISN A;  2KVR A;  3VTU A;  3TBL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...