2MRPA

Nmr solution structure of the ubiquitin like domain (ubl) of dna-damage-inducible 1 protein (ddi1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
DLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding protein
molecule keywords DNA damage-inducible protein 1
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mrpA00
2RR9A 2IBIB 3L16A 3ML9A 4CO7A 2ZNVC 3DVNU 4BOZB 4TQ1A 2HTHA 2ZPNA 5AZHA 3M3JA 3N32A 3A9KB 4NY0A 2XBBC 2MP2B 4DHZB 1UELA 4MSQB 2XEWA 2D3GA 3NY5A 1WE7A 4E71A 4W9GA 3DBRI 3U8ZA 5E6PA 2MBQA 2RSUA 4G3XB 4K81A 2KK8A 4PS8A 4ANVA 2DZKA 5EDSA 2KN5A 4IWOA 4G11A 2O2VB 3VUWA 2MQJA 4GDLA 4AP4C 1G6JA 3KUZA 4TQ0A 5D94A 4MELA 4B9KA 4DDID 2GBJA 3VXWA 2ZZPB 3RZFA 2L05A 2ZNVB 4N9F4 3VH3B 2K8CA 2LVPA 3V61A 4EKUA 4LJOB 3H7PB 4K7SA 4WJPA 5CX3A 1WE6A 2ZEQA 2JVCA 3RCZA 1V5TA 1YD8U 2K39A 2RGFA 2MSED 3ZTCA 4RM8A 3APCA 3JVZX 4GSWA 2G3QB 2DAFA 4GIVA 3H7SA 4CHKA 3OJ4B 4NPNA 3EC8A 1WH3A 4IWPA 2W9NA 4MSMB 4MGYE 3M95A 4A20A 5KHQA 1V9JA 1WM3A 1D3ZA 3A1QA 1C3TA 4ANXA 3R7QA 1TTNA 1PQSA 3ZNHB 2LVQA 3WAPA 2PE9A 4KVGB 5DPSA 5AZFA 3PHXB 3HK0A 5C23A 4HXDA 4HK2A 2BGFA 3WA0A 4PS3A 4W9EA 1IYFA 2L7RA 2ZCBA 4GMVA 4NJ7A 1Q5WB 2V3SA 2LGXA 2ZPYA 2YVCA 4ZRIA 2O6VB 4HDOA 4E74A 1T0YA 2KFKB 4GN1A 4DHJB 4FJZA 2YLMA 3PT2B 1ISNA 2NBUA 4IW0A 2C9WB 2DX5B 3B08A 3K9OB 2FCQA 4IM2A 2JRHA 4FHKA 4FA6A 4FJYA 1WM2A 1EF1A 4NNJB 4W9DA 2JF5A 2KXJA 3U30A 5IAAC 1OQYA 3RUIB 3L54A 2CU1A 2LI5A 2CKHB 4WQOB 4HPLB 4BVUC 2N9PC 3CSTA 2J0JA 3VTWA 2G4SA 2KWUB 4MGZE 3ZNID 2MBBB 3UQAA 1OTRB 3K9PB 2AYOB 2BKFA 2L0FA 1WGGA 2FIDA 1K8RB 4EOYA 1UZXB 2Z59B 4LCDE 2LVOA 2KHWB 3L0WB 3W1YA 1U4AA 2KO3A 5JZEB 1J8CA 2NCNA 2IYDB 4NQLB 4AWJA 3RT3B 4ZDVA 1X1MA 2KMCA 5D2MB 2BYFA 2CR5A 2DZJA 1NDDA 3DOWA 4IC7B 3PGEA 1Y8RC 1XT9B 4LDTD 1V81A 3ZNGC 4HCPB 4AOFA 3NS8A 1SE9A 2KJ6A 2FAZA 3PLVA 4WWPA 2JRIB 4X57B 1SGHA 3BY4B 2KWVB 3ALBA 1P98A 4GU2A 2L8JA 2IY0B 1WXSA 2GBKA 3JYUA 2OOBB 3DBSA 3NHEB 2K25A 1E90A 2D07B 1SIFA 3AXCA 3RULA 1WFYA 2D2QA 4JGHB 1WMHB 2PE6B 3GOEA 4DXAB 3A9KA 3H6NA 3A4SC 3KUCB 2ZJDA 4II3B 3ZDTA 2KDEB 4RM9A 4FN2A 2C60A 2GOWA 2IO0B 3W1SA 3IFWB 2KOXA 2LGDA 1J0GA 2XK5A 3ZLZA 2IZVB 2KTRA 3TL5A 4FHJA 2G4DB 2Y5BB 3PREA 4BKSD 1OGWA 1XD3B 3WIMA 3QJZA 3EECA 3M63B 3MHSD 1WRDB 3VHTC 2C5LC 2KKCA 5DPTA 4GOCA 4HLEA 2FNJB 4WAAA 2CHXA 4DK5A 1UBIA 3EHVA 2WDTB 4FBJB 2JZZA 3VUXA 4DHZE 4I6NB 1TZ1A 4W9LA 3VUYA 4KV2A 3UIOB 3OJ3A 1I42A 4HWIB 3A9JA 2K1FA 1Z2MA 4W9IA 3WAOA 2PPHA 3V60A 4F7ZA 2BWFA 4J6IA 2Z0DB 3ZRCA 4GB9A 5J17A 3SU8X 3I3TB 4BOSC 4NJ6A 3HM3A 3O65B 2BF8B 1OEYA 1WY8A 2AL3A 1YX6B 2CHWA 2GBRA 3A4RA 1LFDA 5CTRC 2BYEA 4BBNC 1Z5SB 2UYZB 3PLUA 1C1YB 2KNBA 3PRMB 4DWFA 4I6LB 3KVFB 1KOTA 3QX1A 3IHPC 3IG3A 3TCAA 1WXAA 2LXAA 4BKTA 2V1YA 2DAJA 3TJPA 3X0WA 2RPQA 4B95A 3CMMB 4MH0E 3Q3FA 4DBGA 2FIFA 2KQ7A 2AWTA 2B3AA 1YJ1A 4W9HA 4BKGA 5C1ZA 3OAWA 3KW5B 1ZGUB 3R66C 1S3SG 2KWCA 3DBLI 5FR6A 4KSLC 5CHWA 4KIKB 2JY6A 2KTRB 2LRUA 2VRRB 4PS7A 1WIAA 1GG3A 2M4NA 2MA9B 3UGBB 2LWPA 3T8MA 4GDKA 3DDCB 4WWNA 3VVWB 4XX5A 2BWES 1RRBA 4XC2A 3WANA 4EZJA 3KYCD 4EZKA 2J7QB 2KDFB 1M94A 3PPAA 1TBEA 2KJRA 3A9JB 1UD7A 5AEKB 2G45B 2UWQA 1CMXB 4MDKE 5E6OA 3KYDD 4RMAA 1V49A 4PYUA 4WJNA 3BINA 5D6JB 3ZRFA 4PYZA 4KSKC 3PSEB 2N1WA 3B0AA 3NZSA 1VCBA 2LASA 3JSVB 2MRPA 1WJUA 1XQQA 3ML8A 1Q0WB 1WI0A 2CHZA 1OEYJ 3GZNI 2REXA 3TMPB 1EUVB 1UH6A 2RD0A 1I35A 3N30A 3VDZA 2IY1B 2DENB 5GMVA 1LQBA 3L13A 2KDIA 2L3ZA 2GMIC 3SDLC 1WXVA 3WALA 1V86A 3VQIA 3X23A 2ZCCA 2K6DB 1V6EA 2O6VD 2KD0A 2KMAA 4KZCA 3Q3JA 2CS4A 2L00B 1YX5B 2C7MB 4ICUA 1FXTB 4WWOA 1MG8A 3KUDB 4DDGD 4NAWA 1V5OA 2GBMA 1NI2A 3N3KB 1E8XA 2LRWA 3ECIA 4NQKE 3B1LX 4K7WA 4WJOA 3UIPB 3UF8A 2J0KA 3MJWA 3VH4B 2MCNB 3ZUNA 2WX0A 4GDKB 2KFKA 4EFOA 4URKA 1HE8A 2KZRA 3VAWA 3LDZE 2BPSA 4KIKA 5D7GA 2NS5A 3TBLD 2ZVOA 1IP9A 4M8NA 5G2NA 1R4MI 2NBWB 2KVRA 2PEAA 5J18A 1LXDA 4ZYNA 2L76A 5LLIA 3RD2A 2K8BA 2C7HA 1E8YA 4HPMB 1V80A 3ONSA 3D32A 2FUHB 4HCNB 3ZDMC 5AZGA 3ZNZB 2D11A 2MBHA 2FCNA 1E8WA 2LUEA 2I1JA 4LDTB 4TV3A 4EZLA 2R2OA 1IPGA 3DCGA 1VD2A 2DZMA 3ZTDA 3M62B 1V2YA 2MBOA 4HJKA 1KM7A 4HVBA 3KH0A 4BKSA 4FULA 2M8SA 1BT0A 3EFUA 3QC8B 3RYTA 2LZ6A 1P0RA 2MLBA 1E7VA 3AU4A 2BYVE 2KLCA 5DPRA 1A5RA 3QHTA 1GUAB 1E5WA 4W9FA 3ZW3A 2MW5A 2ZVNA 3AU5A 3HIZA 2WWZA 2MBEA 3LJ3A 3ZIMA 3ZO5B 4ICVA 5HKHA 4GDLB 1WX9A 2K8HA 1RAXA 2KJHB 4TUUA 4M0WB 2J0MA 1Q1OA 1WJNA 1ZW7A 2KDBA 3C0RB 2QHOA 4W9JA 4IM0A 5E6NA 4A3OA 3JW0X 1GNUA 2KX3A 2C7NB 1GJZA 5KHOA 1P1AA 4IWQA 2N7DA 1WX8A 1J19A 1EF5A 4F1SA 1P3QU 2XK5B 3MTNB 1WGYA 3VTVA 3NOBA 3PRPB 2MWSB 1WGHA 2EMTA 2KTFA 3WAMA 1L2NA 3QWZB 2N1VA 1WZ0A 4AUQC 4OVVA 3PV1A 3VTUA 2M17A 2JWZA 4G0NB 3OLMD 3QA8A 3DVGX 3PRZA 4KZ0A 4JIOU 4A3PA 4W9CA 2A5UA 3H9DA 1H8CA 2ASQA 4AJYB 3R7RA 2N9EB 2AL6A 2L0TA 2Z0EB 2DHZA 2BKRB 4AJWA 4FADA 1TGZB 1WXMA 4LJPB 3V6EB 4NAWB 1P9DU 2HJ8A 2JZ3B 2NR2A 4I6PA 4IUMB 4JQWC 1WMHA 5JH5C 4MGIE 3VFKA 4FJVB 2DYOA 3QK0A 3CSFA 2IO3B 1WJ4A 2N7EA 3A1QB 3L08A 4W9KA 2OJRA 2JXXA 5BO4B 4B6WA 4YL8A 2GBNA 2N9XA 1RFAA 5IA7A 2KC1A 4CYEA 4ANWA 5LXIB 2AEHA 1RLFA 3T9LA 4EEWA 5JHBA 1UBQA 2NVUI 1E7UA 3ENEA 3UINB 1AARA 4P7IA 1NBFC 1WX7A 5G55A 3AULA 2O6VA 3U7DA 4BFRA 4TKNA 2WX1A 3P2BA 3PTFC 4M8MA 3V6CB 2DYBA 4KDIC 2KQSA 2DZIA 4ANUA 5LXHA 3AI5A 4EUTA 1GC6A 2N4FA 2FCSA 3QAQA 1QZEA 3PVLA 3A33B 1UGMA 2MX2A 1WF9A 5DPWA 1WR1A 2NPTA 1GC7A 2D10A 3V62A 4FLHA 2JUOA 3DQVA 3H1UA 3SHQA 2EMSA 4DHJD 4MJSB 4G50A 4ZRKA 1KJTA 5CHVC 2LGYA 2WYQA 2HD5B 5JHAA 3R3MA 1H4RA 1R4NI 2KANA 3TIXA 4IM3A 2JT4B 1WYWB 1WGRA 5L95C 2DYMA 3L10B 4BBNF 4K1RB 3SD5A 3L17A 2HE7A 2M0XA 3QIJA 1JRUA 3S2AA 1WZ3A 2I1KA 3DPDA 2M1MA 1WR6E 4WJQA 3PS6A 1WJ6A 4HDQA 2LJ5A 5DCNA 1EO6A 1E8ZA 2FCMA 2KX0A 2LXCA 3APFA 3DVGY 1WGDA 4KDLB 4II2B 1KLVA 2PJHA 3UQBA 3JSVA 4GGQA 3QARA 2EKEC 3NZUA 2KC2A 4GXBA 1LM8B 3IBEA 4MJSA 4OVUA 1YQBA 2JPHA 2KFJA 2O2VA 3DVNV 3W1SC 4F8CB 2V4LA 4JL9A 2R2QA 2IO1B 3PZDA 4K7UA 3ZVVA 3APDA 2KLGA 2NPTB 1L7YA 5CHFA 4XZ4A 2K6QA 5TR5A 1S1QB 4ZRJA 1ZKHA 3QQ8B 2NBVB 4E3CA 2A4ZA 4ASWC 2MP2A 5L83A 3H7PA 1F9JA 4MGKE 3HM6X 2LD9A 4MM3A 4JLCA 3QCAA 3DBHI 4IG7B 4MEMA 3RZWC 3IVFA 3CF6E 3ZKJC 2IO2B 1YIWA 5J2RA 3PHWB 3HHMA
chains in the Genus database with same CATH superfamily
2RR9A 3ML9A 2IGHA 4CO7A 4TQ1A 3M3JA 1DOIA 4NY0A 2MP2B 3NS1A 2QIEB 4RNAA 2JYEA 3DBRI 1FCCC 3RNBC 3U8ZA 2KACA 2KK8A 4PS8A 1QQRA 2DZKA 3Q3NC 3VUWA 3P63A 1XLQA 1KF6B 3KUZA 1QOGA 2ZZPB 3RZFA 3NVVA 4N9F4 2G1EA 2K8CA 2WXNA 3V61A 1ET6A 5CX3A 1FO4A 2JVCA 4OHJA 1V5TA 3IAS1 2K39A 2CJOA 1MVKA 3APCA 3JVZX 4LK0M 2KT7A 2DAFA 3AE2B 4DXFA 2W9NA 2MJ3A 1N60A 3M95A 1V9JA 3A1QA 1C3TA 2KVZA 1OQRA 2LFIA 4ACFA 4HXDA 2ZCBA 4GMVA 3Q14C 4YSXB 2BS3B 2TSSA 4KX6B 1I4XA 4GN1A 2YLMA 1ISNA 2JWUA 2C9WB 3B08A 2FCQA 4IM2A 4FA6A 1B1ZA 3P4PB 1VZ7A 1PUTA 2LI5A 2CKHB 4BVUC 3CSTA 2J0JA 2G4SA 3K9PB 4OZBA 2RDGA 2FIDA 2Z59B 4LCDE 2LVOA 2KHWB 1MJDA 2IYDB 4IC7B 1QOBA 1I7HA 3FILB 1ZP0B 2R61A 1Y8RC 3PGEA 4LDTD 1V81A 1VZ8A 3NS8A 4WIPA 2BB6A 4X57B 1SGHA 1CZPA 1FM0D 1P98A 1ENFA 2ICIA 1WXSA 2PVOD 2OOBB 3NHEB 2K25A 3AXCA 1WFYA 2IO0B 1C4AA 3AEDB 2G9HD 2IZVB 1JRPA 1T3QA 1TJEA 3BK2A 3TEYA 3QJZA 2BQQA 2OEDA 4I6NB 3ETRA 4K3CA 3OJ3A 3AB5A 2K1FA 4ARCA 2BWFA 3ZRCA 3ZYYX 3ZJUA 4BOSC 3GZNB 3HM3A 1OEYA 1WY8A 2FBWB 4AQ7A 4ZRPA 2UYZB 4BAXA 1T0QC 1C1YB 4DWFA 2D3CA 4I6LB 3KVFB 1KOTA 5EE3A 2V1YA 1FIQA 5C3JB 2DAJA 2I38A 3TJPA 2BS2B 3H8HA 3LYYA 2B3AA 4BKGA 1XLOA 1SE4A 3AEAB 2DNFA 4RH6A 4KSLC 4PS7A 1V97A 2LWPA 2PVGC 3VVWB 1MG4A 4XC2A 1I4GA 4EZKA 2J7QB 3AE4B 2KAJA 3B9JA 1UUPA 1M94A 3I5JC 2GI9A 2H89B 4MDKE 3RI7C 4PYUA 3ZRFA 4PYZA 2J4XA 3NZSA 1VCBA 2MRPA 1WJUA 1WI0A 1OEYJ 3GZNI 2RD0A 1ZDVA 2DENB 5GMVA 3U7ZA 2K22A 1J7CA 2ZCCA 2O6VD 3MHZA 4KZCA 2CS4A 2L00B 1YX5B 1FXTB 4WWOA 1MG8A 3KUDB 4DDGD 1TKEA 2K3UA 3N3KB 2ONQA 4WJOA 4NQKE 3UIPB 3HVDA 2J0KA 2MCNB 2ZW1A 4EFOA 4URKA 4JX1C 1VR9A 1B9RA 5D7GA 3TBLD 1IP9A 2J53A 2KVRA 3AE8B 5J18A 1LXDA 4ZYNA 5LLIA 3RD2A 2K8BA 2C7HA 3P4RB 1E8YA 4WWMA 3ONSA 2IGGA 4EZLA 2LUEA 3R8BA 3ZTDA 2HTME 2BB5A 3M62B 1KM7A 3I63C 2M8SA 5LNK1 3UI3A 3RYTA 1TYGB 1GB4A 1TKYA 5IN7A 2KLCA 1XCQL 4W9FA 5IOIA 1FRRA 2MW5A 3HIZA 2V4IB 1GPXA 3ZO5B 4ICVA 2BS4B 2BBCA 4TUUA 3LXFA 4M0WB 4JWSC 3JW0X 5IO9A 2WDQB 1J19A 4HROA 1WGYA 1BXTA 1TKGA 4C7YA 3NOBA 1QF6A 2INNE 2QMTA 4KGSA 1DOXA 1XCTL 4G0NB 4KZ0A 1EU4A 2AL6A 2L0TA 4REZA 1TGZB 2E6XA 3I57A 4B0MA 4YTNB 1FFVA 2LEKA 4KKIA 3N1YC 3VFKA 4ZHPA 3CSFA 2IO3B 1WJ4A 2N7EA 3A1QB 2W3SA 2KC1A 2QDFA 5T8IA 2QILA 2M19A 3U2SC 5JHBA 1AARA 1NBFC 2WXJA 4AS1A 1J7AA 1FXAA 3U7DA 2FE8A 2IDYA 2WXPA 4KDIC 2DZIA 3KWLA 2WXLA 1GC6A 2LUMA 1QZEA 4WQMA 4D2KA 1ZXIA 5DPWA 4IDIA 1QKZA 1GC7A 3V62A 2JUOA 2QSDA 4DHJD 4MJSB 4G50A 4ZRKA 2W55A 2WYQA 2HD5B 3R3MA 3NVYA 5H8YE 2KANA 4IM3A 5TSSA 3PZ8A 5H92C 3GE3C 2M0XA 3S2AA 1JRUA 3AMZA 4WJQA 2M1MA 5E6JA 3PS6A 2PIAA 2FCMA 4II2B 3JSVA 4GGQA 3NZUA 2M0AA 4RFBA 4JL9A 2R2QA 2INPE 3APDA 2KLGA 5CHFA 1S1QB 4XGAB 3AN1A 4E3CA 2LGSA 5BYSA 2Y3AA 4XWWA 4MGKE 4OW0A 3OG5A 3QCAA 3DBHI 1D4BA 1SIJA 3C8YA 4XDDA 3IVFA 3ZKJC 5J2RA 2L83A 3SFEB 3NUHB 2WXHA 3ZJVA 1YMHE 1NYQA 4BOZB 1MFWA 4KGRA 1R4NB 3N32A 4P16A 1XEEA 2WQYB 5EE9A 1C79A 4RCOA 4M02A 2D3GA 1WE7A 4E71A 4ANVA 4K81A 3RPFC 1FPYA 1HQRD 2KN5A 4G11A 2O2VB 3NVZA 4JE3B 1WRIA 4TQ0A 4B9KA 3W9CB 2GBJA 4HKQA 2QC8A 3VH3B 4EKUA 4K7SA 2ZEQA 1JCKB 2RGFA 1QT9A 1JW9D 4WH4A 4LLGM 4GSWA 4GIVA 4A55A 3T3OA 2IPKD 4CHKA 4YT0B 4MSMB 4MGYE 1FMAD 5JXVA 1D3ZA 3MP9A 1PQSA 3ZNHB 4NJCA 4NJ7A 2V3SA 2O6VB 1SBBB 1FFUA 4DHJB 3PT2B 2NBUA 1E10A 1JMLA 1SXTA 4NNJB 2KXJA 1FEHA 5IAAC 1LGRA 3MJ5A 2BW2A 4WQOB 4HPLB 2KWUB 1OTRB 3TEXA 2BKFA 2BTEA 4EOYA 1HTQA 3W1YA 1J8CA 1VJKA 2NCNA 4XDCA 4AWJA 5D2MB 3AE1B 1CK1A 4USAA 5BYRA 4HCPB 1Q10A 3Q69A 2JU6X 1C9FA 2KJ6A 2FAZA 5EE0A 3ALBA 3JYUA 2D07B 1SIFA 1PGBA 3RULA 2PE6B 4DXAB 3A4SC 2GRIA 3FAHA 3KUCB 1UGJA 4II3B 3ZDTA 4RM9A 2Y5PA 2GOWA 3MFGA 1FNWA 3W1SA 2KOXA 2LGDA 4US9A 1OFFA 3AE3B 3ZLZA 4FHJA 2G4DB 1IGCA 3M63B 3VHTC 2KKCA 3NVWA 5DPTA 3EA6A 4HLEA 2CHXA 3EHVA 2WDTB 4DHZE 4FXCA 3R2TA 1I42A 4C4VB 3A9JA 3V60A 4F7ZA 4N6EB 3LB8C 4J6IA 5J17A 5BYQA 3SU8X 4NJ6A 2GBRA 2CHWA 5CTRC 4WAFA 3BIID 2WDVB 1N5WA 3QX1A 3TCAA 1WXAA 4P6VF 1R7SA 4B95A 2AWTA 1YJ1A 3HVZA 1S3SG 4KIKB 2JY6A 3KQ4A 2LRUA 2VRRB 1WIAA 2M4NA 3T8MA 1N5XA 2KDFB 2KJRA 2VH1A 1UD7A 4JWUC 2G45B 3AEGB 1L0VB 1V1PA 2NTTA 2WU2B 1JALA 2N1WA 1KLUD 2LMCA 3ML8A 3URYA 1SE3A 3N30A 1JWUD 1LQBA 1MHXA 3SDLC 2L3ZA 2GMIC 3GP7A 3X23A 1V86A 2K6DB 1V6EA 2KD0A 2KMAA 3Q3JA 4ICUA 4NZLB 3BVMA 2GBMA 2WNMA 2L1AA 2MEKA 2GB1A 1TY0A 1YQ4B 3UF8A 3ZUNA 2AQ3B 3ZGZA 2KFKA 1YJJA 1HE8A 1TIFA 2KZRA 2BPSA 4KIKA 4MM3B 2ZVOA 5G2NA 1R4MI 1WYGA 2PEAA 2PTLA 2L76A 2K0PA 5C2TB 4HPMB 3D32A 2FUHB 1SF0A 2D11A 2MBHA 5FK9C 4TV3A 2R2OA 1IPGA 1VD2A 1TZOA 2DZMA 3Q8AA 1WGKA 2X38A 4L23A 2MBOA 4HVBA 2H88B 1F52A 3MC0B 1BT0A 3QC8B 2AQ1B 1XO3A 1P0RA 2BYVE 4DXGA 1A5RA 3QHTA 1NVID 2ZVNA 2MHJA 2WWZA 2MBEA 5HKHA 2K8HA 3FILA 1RAXA 2KJHB 5IP4D 1FNUA 1ZW7A 2QHOA 1UF0A 2KX3A 2C7NB 1GJZA 3RNGC 3DHGC 1I4PA 2CJNA 1DYQA 2MJDA 3PRPB 4RF0A 2EMTA 2KTFA 4OVVA 3VTUA 3FKYA 2M17A 4RF1A 1WXQA 3AEFB 2A5UA 2ASQA 1TS4A 4AJYB 2JX5A 3DBHB 2DHZA 3TEWA 4AJWA 1WXMA 4LJPB 4LNOA 4NAWB 1P9DU 2WXFA 1ZUD2 4I6PA 4JQWC 5EE1A 5JH5C 4MGIE 4FJVB 3L08A 2OJRA 5BO4B 1PGAA 1RFAA 3B2FA 1RLFA 4EEWA 2NVUI 1C76A 1T0RC 2O6VA 4US8A 1K53A 3P2BA 3PTFC 3W5UB 5LXHA 2KQSA 3AI5A 5BMHA 4A9AA 1L0YB 1QOFA 4EUTA 3Q8BA 3A33B 1UGMA 1C78A 2JSVX 2W82A 2INDC 4LNFA 1KJTA 1NENB 2LGYA 2IJ0A 3C19A 2JT4B 2DBYA 1WYWB 3BWUD 2KN4A 2DYMA 4GLSC 2KWDA 3IT4B 1WZ3A 1WR6E 4HRSA 1WJ6A 2NMQA 1EWYC 1QILA 1E8ZA 3APFA 4KDLB 2PJHA 1VLBA 2KC2A 2CU3A 4OVUA 2KFJA 2O2VA 3DVNV 3W1SC 3PZDA 2NPTB 4XZ4A 3ZQ4A 3OWEB 2LJIA 4ZRJA 1TS2A 4N58A 2W3RA 2A4ZA 2Z8LA 2N7JA 3Q8FA 4ASWC 4JPSA 2V0GA 3H7PA 1F9JA 4HJGE 4PK1A 3BYYB 3RZWC 3TEZA 2IO2B 1YIWA 3PHWB 3HHMA 3MC8A 3L16A 4C4VA 2ZNVC 1RWSA 3DVNU 1QOAA 2INCC 2HTHA 2ZPNA 5AZHA 1HZ6A 3A9KB 2XBBC 4DHZB 1UELA 1D5MC 5HFYA 2XEWA 4RGTA 3TSSA 3E56A 4W9GA 4DQOC 2WXRA 2D3AA 1R4MB 5EDSA 4IWOA 3BVGA 2XNAC 5HHDG 4N59A 5D94A 4MELA 4ZOHC 2LVPA 4LJOB 3H7PB 4WJPA 3RNFC 1L6VA 5HG2A 3RCZA 1STEA 3O13A 2FUG1 3W2DA 3AE7B 4HEA1 4RGMA 4RM8A 1XF5L 3H7SA 2M56B 4YWGG 4KGTA 1WH3A 4IWPA 5FR3A 3NG0A 4L1BA 5KHQA 1HZ5A 4ANXA 4BZAA 3R7QA 1TTNA 2LVQA 2PE9A 5DPSA 5AZFA 5C23A 3EUB2 4HK2A 2BGFA 2RPVA 3WA0A 5I4DA 1IYFA 1Q5WB 3BVZA 2ZPYA 1IBXB 2MJEA 4HDOA 2KFKB 5BMGA 1Y56A 5HI1A 4IW0A 2Q5WD 2DX5B 3K9OB 4FHKA 4FJYA 1WM2A 1EF1A 1VRAB 2QJLA 1N6ZA 3RUIB 1D6EC 1A70A 3ABVB 3VTWA 4C7ZA 4MGZE 3ZNID 2AYOB 2L0FA 1WGGA 1UZXB 3RT3B 1X1MA 2BYFA 2DZJA 3RNEC 1E0ZA 4B0EA 1XT9B 1C4PA 2PMVA 1JWMD 1SE9A 2JRIB 2KWVB 2L8JA 1E90A 2W54A 4JGHB 1WMHB 3A9KA 2WXIA 4J3OD 2ZJDA 1E6EB 3RMKC 1FCLA 2KQ4X 3AE5B 4OZCA 1T6BX 2Y5BB 3NJTA 1OGWA 1JWSD 2FNJB 4IKGA 4WAAA 4DK5A 4FBJB 2JYTA 1V1OA 1TZ1A 3VUYA 3UIOB 4HWIB 2RMMA 4W9IA 2PPHA 1NEKB 4A90A 4PT5A 1FD6A 3I3TB 2AL3A 3A4RA 3RFZB 1LFDA 2BYEA 1Z5SB 3Q3MC 5BMIA 3IHPC 3IG3A 3Q6BA 1D5ZC 2DWQA 3GB1A 3Q3FA 2KQ7A 3Q2AC 1L6UA 1ZGUB 1PGXA 3DBLI 1AYFA 4ITKA 2MA9B 1GG3A 3UGBB 1V8CA 1MPEA 4YXDB 4GDKA 4XX5A 2BWES 2L52A 1V1PB 1TBEA 3A9JB 3U52E 1WSPA 3Q3OC 3IT6B 1CMXB 5E6OA 3KYDD 2XN9C 3NZ3A 1TS3A 4RMAA 5D3DA 5D6JB 1M4VA 4KSKC 3B0AA 4KKJA 1XQQA 1Q0WB 2EELA 2REXA 3TMPB 1UH6A 1EUVB 2KDIA 1SEBD 1WXVA 3WALA 1YQ3B 3IXSA 4C80A 4HPPA 1ZDXA 1V5OA 2VZKB 1NI2A 3ECIA 3MJWA 3VH4B 1KH0A 2WX0A 1L4DB 3P42A 2NS5A 1DGJA 1ZPSA 1ZXHA 2NBWB 3BYTB 3DHHC 1KFYB 1V80A 4NAMA 1JWAD 3ZNZB 3ZDMC 3N1ZC 2I1JA 4LDTB 4OZAA 1BMLC 3DCGA 5MPOA 2WU5B 3PZ7A 1V2YA 4HJKA 3B2GA 2AQ2B 2J42A 3KH0A 4FULA 3EFUA 2OHFA 2LZ6A 5AUKA 1GOZA 2MLBA 2AX5A 3FC4A 2EKIA 3AU4A 1K52A 1KTKA 1TS5A 2DLBA 1WX9A 2WLBA 4RGOS 2J0MA 1Q1OA 1WJNA 2KDBA 3C0RB 1GNUA 3NRZA 5KHOA 1P1AA 4IWQA 1RYJA 4F1SA 1E9MA 4MACA 1HEZE 3VTVA 3SEBA 1PFDA 3WAMA 1L2NA 3QWZB 1WZ0A 1L4ZB 4XE0A 2JWZA 3OLMD 3QA8A 3DVGX 2WS3B 4JIOU 1HXYD 1H8CA 3BK1A 1YN4A 2N9EB 2Z0EB 1IBXA 2BKRB 3HUIA 4FADA 1AN8A 3GS2A 2PLPA 1E7PB 2HJ8A 2JZ3B 2NR2A 1AW7A 5AUIA 3RN9C 1WMHA 2QEJC 2X8XX 2DYOA 3QK0A 2OJWA 2JXXA 4YL8A 1ESFA 2N9KA 4ANWA 2LGIA 3IAM1 1HA5A 3AH7A 1UBQA 1E7UA 1WX7A 1KRHA 2B76B 1VDVA 4TKNA 2WX1A 5IKCM 4M8MA 4ANUA 5G5GA 2N4FA 1DOYA 3QAQA 4TSSA 3PVLA 2MX2A 2NPTA 2D10A 4FLHA 3H1UA 2WXGA 1H4RA 1IUEA 1R4NI 4LNKA 4L2YA 1WGRA 5L95C 3L10B 3SD5A 3QIJA 2HE7A 1J7BA 3DPDA 2I1KA 1I4RA 4HDQA 5DCNA 3ZXVA 1EO6A 2LXCA 3DVGY 1WGDA 1SSNA 3VRAB 1KLVA 3UQBA 3QARA 2L32A 1LM8B 2MH7A 1YQBA 1EU3A 2V4LA 3ZVVA 5TR5A 3QQ8B 2N0SB 2NBVB 1WWTA 2MP2A 1SJED 1MI0A 1LO5D 3HM6X 2V3PA 4JLCA 4O1NA 4MEMA 4M00A 1GB1A 1UWMA 2HDEA 1YJIA 1NI3A 3I9V1 3EFCA 2IBIB 2PKOA 4MSQB 3NY5A 3DBLB 4S0RA 2MBQA 2RSUA 4G3XB 5E6PA 2MQJA 3V05A 4GDLA 4AP4C 1G6JA 2YEPF 4DDID 3VXWA 1YOVB 2L05A 2ZNVB 1XXGA 1ROEA 2J52A 1WE6A 3AE6B 4P1CC 2E3TA 1YD8U 1JWBD 2MSED 3ZTCA 1XLPA 3KWVA 2G3QB 1TT5B 4C00A 4YTPB 2RDBC 1F1HA 3OJ4B 4NPNA 3EC8A 3VR9B 3AEBB 4LTUA 3DWGC 4A20A 1WM3A 2KDMA 2PW9A 2ZW0A 4TMAB 3WAPA 4KVGB 1QLBB 2VZKD 3PHXB 3HK0A 3PO0A 1EWCA 4PS3A 4W9EA 2L7RA 1N62A 2LGXA 2YVCA 4ZRIA 2WDRB 4QAYA 4UDUC 1XLNA 4E74A 3AECB 1T0YA 2VH2A 3SFDB 1FXIA 4FJZA 2GLSA 2WXKA 2JRHA 4M01A 3DWMA 5D3IB 4W9DA 3U30A 2JF5A 1RFKA 1OQYA 3AE9B 3L54A 2CU1A 2N9PC 2MBBB 3UQAA 1K8RB 3L0WB 5JZEB 1U4AA 2KO3A 1K50A 3WCQA 4NQLB 4ZDVA 2KMCA 2CR5A 1I4QA 1NDDA 3DOWA 1UNSA 3ZNGC 4M0WA 2NTSA 4AOFA 3PLVA 4WWPA 3BY4B 4GU2A 3P1MA 2IY0B 1F2RI 2GBKA 3EGRA 3DBSA 1IGDA 4Q2JA 2D2QA 3GOEA 3H6NA 2WP9B 1ET9A 4ZRQA 2KDEB 3V3XA 4FN2A 1OQQA 2C60A 1L0XB 2LHEA 3IFWB 1YNTE 1J0GA 2WXMA 4EE2A 2XK5A 2KTRA 3TL5A 1C77A 3PREA 2K9XA 4BKSD 3WIMA 1XD3B 4LNNA 4H2AA 4HKZE 3EECA 3MHSD 2BVCA 1WRDB 4IOIE 2C5LC 4GOCA 1UBIA 2JZZA 4MH8A 3U4EG 3VUXA 4W9LA 1T5XD 4KV2A 2SEBD 5G5HA 1Z2MA 3WAOA 4C56C 2Z0DB 4GB9A 3O65B 2BF8B 1YX6B 2D5GA 4BBNC 3PLUA 3AEEB 3PRMB 2KNBA 2LXAA 4BKTA 1D5XC 3RNAC 3X0WA 2IGDA 1F0ZA 1F77A 2RPQA 1EM7A 3CMMB 4MH0E 2V9HA 4DBGA 1I4HA 4P1BC 2FIFA 1P7FA 3Q8EA 4W9HA 1JQ4A 5C1ZA 3OAWA 3KW5B 3R66C 2KWCA 5FR6A 5CHWA 2KTRB 3Q8CA 2RDHA 1HTOA 3DDCB 4WWNA 1AWDA 1RRBA 3WANA 4EZJA 3KYCD 3PPAA 5AEKB 2UWQA 3TUOA 2LHDA 1V49A 4WJNA 3RNCC 3BINA 2SAKA 3PSEB 2LASA 3JSVB 3P4QB 2CHZA 2YEPB 4S17A 1I35A 3VDZA 2IY1B 3AM9A 3L13A 3VR8B 2WXOA 1ACCA 3VQIA 2C7MB 4CQNA 3ZXRA 4NAWA 3R2IA 1E8XA 2LRWA 3B1LX 4K7WA 4XYCA 4YTMB 1PDXA 1ZOYB 4OVZA 4GDKB 3VAWA 3LDZE 3W5VB 4M8NA 1N61A 2BYTA 2I2YA 3SR6A 2WXQA 4HCNB 2ON8A 5AZGA 4MT5A 2FCNA 3T3NA 1VZ6A 1E8WA 1GAQB 2KMMA 4LNIA 2Y5CA 1ZE3D 3E9SA 4BKSA 4ARIA 2QCZA 2WHIA 4ZYSA 3ZJTA 1E7VA 3P4SB 5DPRA 1GUAB 2WGSA 1RM6C 1E5WA 3VRBB 3BZDB 1JROA 3ZW3A 3AU5A 3LJ3A 3ZIMA 4GDLB 3DHIC 1NYRA 3CIRB 2BT6A 4WURA 5E6NA 4W9JA 4A3OA 4IM0A 4RGNA 2N7DA 1WX8A 1EF5A 4ZHOA 1P3QU 2XK5B 3MTNB 4YSZB 1F2RC 1P7EA 2MWSB 1N63A 3N20C 1WGHA 3N1XC 2HJ1A 3L4PA 2N1VA 4AUQC 1KLGD 3PV1A 1FRDA 3PRZA 4K3BA 4W9CA 1YN3A 4A3PA 3H9DA 3R7RA 3HRDD 4R3DA 2KYWA 2UU7A 2JZPA 1UWXA 4A6QA 3V6EB 1CJEA 4IUMB 1CQVA 4W9KA 4XWTA 4B6WA 1BUIC 2GBNA 2N9XA 5IA7A 4CYEA 5LXIB 2AEHA 3T9LA 3MC9A 3ENEA 3UINB 1PYWD 4P7IA 5G55A 3AULA 4BFRA 3V6CB 2DYBA 1SB3C 2FCSA 5GXGB 2V3NA 4YSYB 1FNVA 1WF9A 2ACZB 1WR1A 1C4CA 1L5PA 1T0SC 3DQVA 3SHQA 2EMSA 5CHVC 2N9LA 3KLSX 5JHAA 3TIXA 3N9YC 4BBNF 2K5PA 4K1RB 1SE2A 3CWIA 3L17A 1MHHE 3DBRB 2JXTA 2LJ5A 2KX0A 2D3BA 3AV8A 2EKEC 2JQRB 4GXBA 3IBEA 4MJSA 2JPHA 4F8CB 1YN5A 2IO1B 4K7UA 1L7YA 2K6QA 5FKAC 1ZKHA 3GE8C 4A8XC 5L83A 2LD9A 4MM3A 4IG7B 3J9CA 1K51A 1SJHD 1TY2A 3CF6E
chains in the Genus database with same CATH topology
2RR9A 2IBIB 3L16A 3ML9A 4CO7A 2ZNVC 3DVNU 4BOZB 4TQ1A 2HTHA 2ZPNA 5AZHA 3M3JA 3N32A 3A9KB 4NY0A 2XBBC 2MP2B 4DHZB 1UELA 4MSQB 2XEWA 2D3GA 3NY5A 1WE7A 4E71A 4W9GA 3DBRI 3U8ZA 5E6PA 2MBQA 2RSUA 4G3XB 4K81A 2KK8A 4PS8A 4ANVA 2DZKA 5EDSA 2KN5A 4IWOA 4G11A 2O2VB 3VUWA 2MQJA 4GDLA 4AP4C 1G6JA 3KUZA 4TQ0A 5D94A 4MELA 4B9KA 4DDID 2GBJA 3VXWA 2ZZPB 3RZFA 2L05A 2ZNVB 4N9F4 3VH3B 2K8CA 2LVPA 3V61A 4EKUA 4LJOB 3H7PB 4K7SA 4WJPA 5CX3A 1WE6A 2ZEQA 2JVCA 3RCZA 1V5TA 1YD8U 2K39A 2RGFA 2MSED 3ZTCA 4RM8A 3APCA 3JVZX 4GSWA 2G3QB 2DAFA 4GIVA 3H7SA 4CHKA 3OJ4B 4NPNA 3EC8A 1WH3A 4IWPA 2W9NA 4MSMB 4MGYE 3M95A 4A20A 5KHQA 1V9JA 1WM3A 1D3ZA 3A1QA 1C3TA 4ANXA 3R7QA 1TTNA 1PQSA 3ZNHB 2LVQA 3WAPA 2PE9A 4KVGB 5DPSA 5AZFA 3PHXB 3HK0A 5C23A 4HXDA 4HK2A 2BGFA 3WA0A 4PS3A 4W9EA 1IYFA 2L7RA 2ZCBA 4GMVA 4NJ7A 1Q5WB 2V3SA 2LGXA 2ZPYA 2YVCA 4ZRIA 2O6VB 4HDOA 4E74A 1T0YA 2KFKB 4GN1A 4DHJB 4FJZA 2YLMA 3PT2B 1ISNA 2NBUA 4IW0A 2C9WB 2DX5B 3B08A 3K9OB 2FCQA 4IM2A 2JRHA 4FHKA 4FA6A 4FJYA 1WM2A 1EF1A 4NNJB 4W9DA 2JF5A 2KXJA 3U30A 5IAAC 1OQYA 3RUIB 3L54A 2CU1A 2LI5A 2CKHB 4WQOB 4HPLB 4BVUC 2N9PC 3CSTA 2J0JA 3VTWA 2G4SA 2KWUB 4MGZE 3ZNID 2MBBB 3UQAA 1OTRB 3K9PB 2AYOB 2BKFA 2L0FA 1WGGA 2FIDA 1K8RB 4EOYA 1UZXB 2Z59B 4LCDE 2LVOA 2KHWB 3L0WB 3W1YA 1U4AA 2KO3A 5JZEB 1J8CA 2NCNA 2IYDB 4NQLB 4AWJA 3RT3B 4ZDVA 1X1MA 2KMCA 5D2MB 2BYFA 2CR5A 2DZJA 1NDDA 3DOWA 4IC7B 3PGEA 1Y8RC 1XT9B 4LDTD 1V81A 3ZNGC 4HCPB 4AOFA 3NS8A 1SE9A 2KJ6A 2FAZA 3PLVA 4WWPA 2JRIB 4X57B 1SGHA 3BY4B 2KWVB 3ALBA 1P98A 4GU2A 2L8JA 2IY0B 1WXSA 2GBKA 3JYUA 2OOBB 3DBSA 3NHEB 2K25A 1E90A 2D07B 1SIFA 3AXCA 3RULA 1WFYA 2D2QA 4JGHB 1WMHB 2PE6B 3GOEA 4DXAB 3A9KA 3H6NA 3A4SC 3KUCB 2ZJDA 4II3B 3ZDTA 2KDEB 4RM9A 4FN2A 2C60A 2GOWA 2IO0B 3W1SA 3IFWB 2KOXA 2LGDA 1J0GA 2XK5A 3ZLZA 2IZVB 2KTRA 3TL5A 4FHJA 2G4DB 2Y5BB 3PREA 4BKSD 1OGWA 1XD3B 3WIMA 3QJZA 3EECA 3M63B 3MHSD 1WRDB 3VHTC 2C5LC 2KKCA 5DPTA 4GOCA 4HLEA 2FNJB 4WAAA 2CHXA 4DK5A 1UBIA 3EHVA 2WDTB 4FBJB 2JZZA 3VUXA 4DHZE 4I6NB 1TZ1A 4W9LA 3VUYA 4KV2A 3UIOB 3OJ3A 1I42A 4HWIB 3A9JA 2K1FA 1Z2MA 4W9IA 3WAOA 2PPHA 3V60A 4F7ZA 2BWFA 4J6IA 2Z0DB 3ZRCA 4GB9A 5J17A 3SU8X 3I3TB 4BOSC 4NJ6A 3HM3A 3O65B 2BF8B 1OEYA 1WY8A 2AL3A 1YX6B 2CHWA 2GBRA 3A4RA 1LFDA 5CTRC 2BYEA 4BBNC 1Z5SB 2UYZB 3PLUA 1C1YB 2KNBA 3PRMB 4DWFA 4I6LB 3KVFB 1KOTA 3QX1A 3IHPC 3IG3A 3TCAA 1WXAA 2LXAA 4BKTA 2V1YA 2DAJA 3TJPA 3X0WA 2RPQA 4B95A 3CMMB 4MH0E 3Q3FA 4DBGA 2FIFA 2KQ7A 2AWTA 2B3AA 1YJ1A 4W9HA 4BKGA 5C1ZA 3OAWA 3KW5B 1ZGUB 3R66C 1S3SG 2KWCA 3DBLI 5FR6A 4KSLC 5CHWA 4KIKB 2JY6A 2KTRB 2LRUA 2VRRB 4PS7A 1WIAA 1GG3A 2M4NA 2MA9B 3UGBB 2LWPA 3T8MA 4GDKA 3DDCB 4WWNA 3VVWB 4XX5A 2BWES 1RRBA 4XC2A 3WANA 4EZJA 3KYCD 4EZKA 2J7QB 2KDFB 1M94A 3PPAA 1TBEA 2KJRA 3A9JB 1UD7A 5AEKB 2G45B 2UWQA 1CMXB 4MDKE 5E6OA 3KYDD 4RMAA 1V49A 4PYUA 4WJNA 3BINA 5D6JB 3ZRFA 4PYZA 4KSKC 3PSEB 2N1WA 3B0AA 3NZSA 1VCBA 2LASA 3JSVB 2MRPA 1WJUA 1XQQA 3ML8A 1Q0WB 1WI0A 2CHZA 1OEYJ 3GZNI 2REXA 3TMPB 1EUVB 1UH6A 2RD0A 1I35A 3N30A 3VDZA 2IY1B 2DENB 5GMVA 1LQBA 3L13A 2KDIA 2L3ZA 2GMIC 3SDLC 1WXVA 3WALA 1V86A 3VQIA 3X23A 2ZCCA 2K6DB 1V6EA 2O6VD 2KD0A 2KMAA 4KZCA 3Q3JA 2CS4A 2L00B 1YX5B 2C7MB 4ICUA 1FXTB 4WWOA 1MG8A 3KUDB 4DDGD 4NAWA 1V5OA 2GBMA 1NI2A 3N3KB 1E8XA 2LRWA 3ECIA 4NQKE 3B1LX 4K7WA 4WJOA 3UIPB 3UF8A 2J0KA 3MJWA 3VH4B 2MCNB 3ZUNA 2WX0A 4GDKB 2KFKA 4EFOA 4URKA 1HE8A 2KZRA 3VAWA 3LDZE 2BPSA 4KIKA 5D7GA 2NS5A 3TBLD 2ZVOA 1IP9A 4M8NA 5G2NA 1R4MI 2NBWB 2KVRA 2PEAA 5J18A 1LXDA 4ZYNA 2L76A 5LLIA 3RD2A 2K8BA 2C7HA 1E8YA 4HPMB 1V80A 3ONSA 3D32A 2FUHB 4HCNB 3ZDMC 5AZGA 3ZNZB 2D11A 2MBHA 2FCNA 1E8WA 2LUEA 2I1JA 4LDTB 4TV3A 4EZLA 2R2OA 1IPGA 3DCGA 1VD2A 2DZMA 3ZTDA 3M62B 1V2YA 2MBOA 4HJKA 1KM7A 4HVBA 3KH0A 4BKSA 4FULA 2M8SA 1BT0A 3EFUA 3QC8B 3RYTA 2LZ6A 1P0RA 2MLBA 1E7VA 3AU4A 2BYVE 2KLCA 5DPRA 1A5RA 3QHTA 1GUAB 1E5WA 4W9FA 3ZW3A 2MW5A 2ZVNA 3AU5A 3HIZA 2WWZA 2MBEA 3LJ3A 3ZIMA 3ZO5B 4ICVA 5HKHA 4GDLB 1WX9A 2K8HA 1RAXA 2KJHB 4TUUA 4M0WB 2J0MA 1Q1OA 1WJNA 1ZW7A 2KDBA 3C0RB 2QHOA 4W9JA 4IM0A 5E6NA 4A3OA 3JW0X 1GNUA 2KX3A 2C7NB 1GJZA 5KHOA 1P1AA 4IWQA 2N7DA 1WX8A 1J19A 1EF5A 4F1SA 1P3QU 2XK5B 3MTNB 1WGYA 3VTVA 3NOBA 3PRPB 2MWSB 1WGHA 2EMTA 2KTFA 3WAMA 1L2NA 3QWZB 2N1VA 1WZ0A 4AUQC 4OVVA 3PV1A 3VTUA 2M17A 2JWZA 4G0NB 3OLMD 3QA8A 3DVGX 3PRZA 4KZ0A 4JIOU 4A3PA 4W9CA 2A5UA 3H9DA 1H8CA 2ASQA 4AJYB 3R7RA 2N9EB 2AL6A 2L0TA 2Z0EB 2DHZA 2BKRB 4AJWA 4FADA 1TGZB 1WXMA 4LJPB 3V6EB 4NAWB 1P9DU 2HJ8A 2JZ3B 2NR2A 4I6PA 4IUMB 4JQWC 1WMHA 5JH5C 4MGIE 3VFKA 4FJVB 2DYOA 3QK0A 3CSFA 2IO3B 1WJ4A 2N7EA 3A1QB 3L08A 4W9KA 2OJRA 2JXXA 5BO4B 4B6WA 4YL8A 2GBNA 2N9XA 1RFAA 5IA7A 2KC1A 4CYEA 4ANWA 5LXIB 2AEHA 1RLFA 3T9LA 4EEWA 5JHBA 1UBQA 2NVUI 1E7UA 3ENEA 3UINB 1AARA 4P7IA 1NBFC 1WX7A 5G55A 3AULA 2O6VA 3U7DA 4BFRA 4TKNA 2WX1A 3P2BA 3PTFC 4M8MA 3V6CB 2DYBA 4KDIC 2KQSA 2DZIA 4ANUA 5LXHA 3AI5A 4EUTA 1GC6A 2N4FA 2FCSA 3QAQA 1QZEA 3PVLA 3A33B 1UGMA 2MX2A 1WF9A 5DPWA 1WR1A 2NPTA 1GC7A 2D10A 3V62A 4FLHA 2JUOA 3DQVA 3H1UA 3SHQA 2EMSA 4DHJD 4MJSB 4G50A 4ZRKA 1KJTA 5CHVC 2LGYA 2WYQA 2HD5B 5JHAA 3R3MA 1H4RA 1R4NI 2KANA 3TIXA 4IM3A 2JT4B 1WYWB 1WGRA 5L95C 2DYMA 3L10B 4BBNF 4K1RB 3SD5A 3L17A 2HE7A 2M0XA 3QIJA 1JRUA 3S2AA 1WZ3A 2I1KA 3DPDA 2M1MA 1WR6E 4WJQA 3PS6A 1WJ6A 4HDQA 2LJ5A 5DCNA 1EO6A 1E8ZA 2FCMA 2KX0A 2LXCA 3APFA 3DVGY 1WGDA 4KDLB 4II2B 1KLVA 2PJHA 3UQBA 3JSVA 4GGQA 3QARA 2EKEC 3NZUA 2KC2A 4GXBA 1LM8B 3IBEA 4MJSA 4OVUA 1YQBA 2JPHA 2KFJA 2O2VA 3DVNV 3W1SC 4F8CB 2V4LA 4JL9A 2R2QA 2IO1B 3PZDA 4K7UA 3ZVVA 3APDA 2KLGA 2NPTB 1L7YA 5CHFA 4XZ4A 2K6QA 5TR5A 1S1QB 4ZRJA 1ZKHA 3QQ8B 2NBVB 4E3CA 2A4ZA 4ASWC 2MP2A 5L83A 3H7PA 1F9JA 4MGKE 3HM6X 2LD9A 4MM3A 4JLCA 3QCAA 3DBHI 4IG7B 4MEMA 3RZWC 3IVFA 3CF6E 3ZKJC 2IO2B 1YIWA 5J2RA 3PHWB 3HHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RR9 A;  2IBI B;  3L16 A;  3ML9 A;  4CO7 A;  2ZNV C;  3DVN U;  4BOZ B;  4TQ1 A;  2HTH A;  2ZPN A;  5AZH A;  3M3J A;  3N32 A;  3A9K B;  4NY0 A;  2XBB C;  2MP2 B;  4DHZ B;  1UEL A;  4MSQ B;  2XEW A;  2D3G A;  3NY5 A;  1WE7 A;  4E71 A;  4W9G A;  3DBR I;  3U8Z A;  5E6P A;  2MBQ A;  2RSU A;  4G3X B;  4K81 A;  2KK8 A;  4PS8 A;  4ANV A;  2DZK A;  5EDS A;  2KN5 A;  4IWO A;  4G11 A;  2O2V B;  3VUW A;  2MQJ A;  4GDL A;  4AP4 C;  1G6J A;  3KUZ A;  4TQ0 A;  5D94 A;  4MEL A;  4B9K A;  4DDI D;  2GBJ A;  3VXW A;  2ZZP B;  3RZF A;  2L05 A;  2ZNV B;  4N9F 4;  3VH3 B;  2K8C A;  2LVP A;  3V61 A;  4EKU A;  4LJO B;  3H7P B;  4K7S A;  4WJP A;  5CX3 A;  1WE6 A;  2ZEQ A;  2JVC A;  3RCZ A;  1V5T A;  1YD8 U;  2K39 A;  2RGF A;  2MSE D;  3ZTC A;  4RM8 A;  3APC A;  3JVZ X;  4GSW A;  2G3Q B;  2DAF A;  4GIV A;  3H7S A;  4CHK A;  3OJ4 B;  4NPN A;  3EC8 A;  1WH3 A;  4IWP A;  2W9N A;  4MSM B;  4MGY E;  3M95 A;  4A20 A;  5KHQ A;  1V9J A;  1WM3 A;  1D3Z A;  3A1Q A;  1C3T A;  4ANX A;  3R7Q A;  1TTN A;  1PQS A;  3ZNH B;  2LVQ A;  3WAP A;  2PE9 A;  4KVG B;  5DPS A;  5AZF A;  3PHX B;  3HK0 A;  5C23 A;  4HXD A;  4HK2 A;  2BGF A;  3WA0 A;  4PS3 A;  4W9E A;  1IYF A;  2L7R A;  2ZCB A;  4GMV A;  4NJ7 A;  1Q5W B;  2V3S A;  2LGX A;  2ZPY A;  2YVC A;  4ZRI A;  2O6V B;  4HDO A;  4E74 A;  1T0Y A;  2KFK B;  4GN1 A;  4DHJ B;  4FJZ A;  2YLM A;  3PT2 B;  1ISN A;  2NBU A;  4IW0 A;  2C9W B;  2DX5 B;  3B08 A;  3K9O B;  2FCQ A;  4IM2 A;  2JRH A;  4FHK A;  4FA6 A;  4FJY A;  1WM2 A;  1EF1 A;  4NNJ B;  4W9D A;  2JF5 A;  2KXJ A;  3U30 A;  5IAA C;  1OQY A;  3RUI B;  3L54 A;  2CU1 A;  2LI5 A;  2CKH B;  4WQO B;  4HPL B;  4BVU C;  2N9P C;  3CST A;  2J0J A;  3VTW A;  2G4S A;  2KWU B;  4MGZ E;  3ZNI D;  2MBB B;  3UQA A;  1OTR B;  3K9P B;  2AYO B;  2BKF A;  2L0F A;  1WGG A;  2FID A;  1K8R B;  4EOY A;  1UZX B;  2Z59 B;  4LCD E;  2LVO A;  2KHW B;  3L0W B;  3W1Y A;  1U4A A;  2KO3 A;  5JZE B;  1J8C A;  2NCN A;  2IYD B;  4NQL B;  4AWJ A;  3RT3 B;  4ZDV A;  1X1M A;  2KMC A;  5D2M B;  2BYF A;  2CR5 A;  2DZJ A;  1NDD A;  3DOW A;  4IC7 B;  3PGE A;  1Y8R C;  1XT9 B;  4LDT D;  1V81 A;  3ZNG C;  4HCP B;  4AOF A;  3NS8 A;  1SE9 A;  2KJ6 A;  2FAZ A;  3PLV A;  4WWP A;  2JRI B;  4X57 B;  1SGH A;  3BY4 B;  2KWV B;  3ALB A;  1P98 A;  4GU2 A;  2L8J A;  2IY0 B;  1WXS A;  2GBK A;  3JYU A;  2OOB B;  3DBS A;  3NHE B;  2K25 A;  1E90 A;  2D07 B;  1SIF A;  3AXC A;  3RUL A;  1WFY A;  2D2Q A;  4JGH B;  1WMH B;  2PE6 B;  3GOE A;  4DXA B;  3A9K A;  3H6N A;  3A4S C;  3KUC B;  2ZJD A;  4II3 B;  3ZDT A;  2KDE B;  4RM9 A;  4FN2 A;  2C60 A;  2GOW A;  2IO0 B;  3W1S A;  3IFW B;  2KOX A;  2LGD A;  1J0G A;  2XK5 A;  3ZLZ A;  2IZV B;  2KTR A;  3TL5 A;  4FHJ A;  2G4D B;  2Y5B B;  3PRE A;  4BKS D;  1OGW A;  1XD3 B;  3WIM A;  3QJZ A;  3EEC A;  3M63 B;  3MHS D;  1WRD B;  3VHT C;  2C5L C;  2KKC A;  5DPT A;  4GOC A;  4HLE A;  2FNJ B;  4WAA A;  2CHX A;  4DK5 A;  1UBI A;  3EHV A;  2WDT B;  4FBJ B;  2JZZ A;  3VUX A;  4DHZ E;  4I6N B;  1TZ1 A;  4W9L A;  3VUY A;  4KV2 A;  3UIO B;  3OJ3 A;  1I42 A;  4HWI B;  3A9J A;  2K1F A;  1Z2M A;  4W9I A;  3WAO A;  2PPH A;  3V60 A;  4F7Z A;  2BWF A;  4J6I A;  2Z0D B;  3ZRC A;  4GB9 A;  5J17 A;  3SU8 X;  3I3T B;  4BOS C;  4NJ6 A;  3HM3 A;  3O65 B;  2BF8 B;  1OEY A;  1WY8 A;  2AL3 A;  1YX6 B;  2CHW A;  2GBR A;  3A4R A;  1LFD A;  5CTR C;  2BYE A;  4BBN C;  1Z5S B;  2UYZ B;  3PLU A;  1C1Y B;  2KNB A;  3PRM B;  4DWF A;  4I6L B;  3KVF B;  1KOT A;  3QX1 A;  3IHP C;  3IG3 A;  3TCA A;  1WXA A;  2LXA A;  4BKT A;  2V1Y A;  2DAJ A;  3TJP A;  3X0W A;  2RPQ A;  4B95 A;  3CMM B;  4MH0 E;  3Q3F A;  4DBG A;  2FIF A;  2KQ7 A;  2AWT A;  2B3A A;  1YJ1 A;  4W9H A;  4BKG A;  5C1Z A;  3OAW A;  3KW5 B;  1ZGU B;  3R66 C;  1S3S G;  2KWC A;  3DBL I;  5FR6 A;  4KSL C;  5CHW A;  4KIK B;  2JY6 A;  2KTR B;  2LRU A;  2VRR B;  4PS7 A;  1WIA A;  1GG3 A;  2M4N A;  2MA9 B;  3UGB B;  2LWP A;  3T8M A;  4GDK A;  3DDC B;  4WWN A;  3VVW B;  4XX5 A;  2BWE S;  1RRB A;  4XC2 A;  3WAN A;  4EZJ A;  3KYC D;  4EZK A;  2J7Q B;  2KDF B;  1M94 A;  3PPA A;  1TBE A;  2KJR A;  3A9J B;  1UD7 A;  5AEK B;  2G45 B;  2UWQ A;  1CMX B;  4MDK E;  5E6O A;  3KYD D;  4RMA A;  1V49 A;  4PYU A;  4WJN A;  3BIN A;  5D6J B;  3ZRF A;  4PYZ A;  4KSK C;  3PSE B;  2N1W A;  3B0A A;  3NZS A;  1VCB A;  2LAS A;  3JSV B;  2MRP A;  1WJU A;  1XQQ A;  3ML8 A;  1Q0W B;  1WI0 A;  2CHZ A;  1OEY J;  3GZN I;  2REX A;  3TMP B;  1EUV B;  1UH6 A;  2RD0 A;  1I35 A;  3N30 A;  3VDZ A;  2IY1 B;  2DEN B;  5GMV A;  1LQB A;  3L13 A;  2KDI A;  2L3Z A;  2GMI C;  3SDL C;  1WXV A;  3WAL A;  1V86 A;  3VQI A;  3X23 A;  2ZCC A;  2K6D B;  1V6E A;  2O6V D;  2KD0 A;  2KMA A;  4KZC A;  3Q3J A;  2CS4 A;  2L00 B;  1YX5 B;  2C7M B;  4ICU A;  1FXT B;  4WWO A;  1MG8 A;  3KUD B;  4DDG D;  4NAW A;  1V5O A;  2GBM A;  1NI2 A;  3N3K B;  1E8X A;  2LRW A;  3ECI A;  4NQK E;  3B1L X;  4K7W A;  4WJO A;  3UIP B;  3UF8 A;  2J0K A;  3MJW A;  3VH4 B;  2MCN B;  3ZUN A;  2WX0 A;  4GDK B;  2KFK A;  4EFO A;  4URK A;  1HE8 A;  2KZR A;  3VAW A;  3LDZ E;  2BPS A;  4KIK A;  5D7G A;  2NS5 A;  3TBL D;  2ZVO A;  1IP9 A;  4M8N A;  5G2N A;  1R4M I;  2NBW B;  2KVR A;  2PEA A;  5J18 A;  1LXD A;  4ZYN A;  2L76 A;  5LLI A;  3RD2 A;  2K8B A;  2C7H A;  1E8Y A;  4HPM B;  1V80 A;  3ONS A;  3D32 A;  2FUH B;  4HCN B;  3ZDM C;  5AZG A;  3ZNZ B;  2D11 A;  2MBH A;  2FCN A;  1E8W A;  2LUE A;  2I1J A;  4LDT B;  4TV3 A;  4EZL A;  2R2O A;  1IPG A;  3DCG A;  1VD2 A;  2DZM A;  3ZTD A;  3M62 B;  1V2Y A;  2MBO A;  4HJK A;  1KM7 A;  4HVB A;  3KH0 A;  4BKS A;  4FUL A;  2M8S A;  1BT0 A;  3EFU A;  3QC8 B;  3RYT A;  2LZ6 A;  1P0R A;  2MLB A;  1E7V A;  3AU4 A;  2BYV E;  2KLC A;  5DPR A;  1A5R A;  3QHT A;  1GUA B;  1E5W A;  4W9F A;  3ZW3 A;  2MW5 A;  2ZVN A;  3AU5 A;  3HIZ A;  2WWZ A;  2MBE A;  3LJ3 A;  3ZIM A;  3ZO5 B;  4ICV A;  5HKH A;  4GDL B;  1WX9 A;  2K8H A;  1RAX A;  2KJH B;  4TUU A;  4M0W B;  2J0M A;  1Q1O A;  1WJN A;  1ZW7 A;  2KDB A;  3C0R B;  2QHO A;  4W9J A;  4IM0 A;  5E6N A;  4A3O A;  3JW0 X;  1GNU A;  2KX3 A;  2C7N B;  1GJZ A;  5KHO A;  1P1A A;  4IWQ A;  2N7D A;  1WX8 A;  1J19 A;  1EF5 A;  4F1S A;  1P3Q U;  2XK5 B;  3MTN B;  1WGY A;  3VTV A;  3NOB A;  3PRP B;  2MWS B;  1WGH A;  2EMT A;  2KTF A;  3WAM A;  1L2N A;  3QWZ B;  2N1V A;  1WZ0 A;  4AUQ C;  4OVV A;  3PV1 A;  3VTU A;  2M17 A;  2JWZ A;  4G0N B;  3OLM D;  3QA8 A;  3DVG X;  3PRZ A;  4KZ0 A;  4JIO U;  4A3P A;  4W9C A;  2A5U A;  3H9D A;  1H8C A;  2ASQ A;  4AJY B;  3R7R A;  2N9E B;  2AL6 A;  2L0T A;  2Z0E B;  2DHZ A;  2BKR B;  4AJW A;  4FAD A;  1TGZ B;  1WXM A;  4LJP B;  3V6E B;  4NAW B;  1P9D U;  2HJ8 A;  2JZ3 B;  2NR2 A;  4I6P A;  4IUM B;  4JQW C;  1WMH A;  5JH5 C;  4MGI E;  3VFK A;  4FJV B;  2DYO A;  3QK0 A;  3CSF A;  2IO3 B;  1WJ4 A;  2N7E A;  3A1Q B;  3L08 A;  4W9K A;  2OJR A;  2JXX A;  5BO4 B;  4B6W A;  4YL8 A;  2GBN A;  2N9X A;  1RFA A;  5IA7 A;  2KC1 A;  4CYE A;  4ANW A;  5LXI B;  2AEH A;  1RLF A;  3T9L A;  4EEW A;  5JHB A;  1UBQ A;  2NVU I;  1E7U A;  3ENE A;  3UIN B;  1AAR A;  4P7I A;  1NBF C;  1WX7 A;  5G55 A;  3AUL A;  2O6V A;  3U7D A;  4BFR A;  4TKN A;  2WX1 A;  3P2B A;  3PTF C;  4M8M A;  3V6C B;  2DYB A;  4KDI C;  2KQS A;  2DZI A;  4ANU A;  5LXH A;  3AI5 A;  4EUT A;  1GC6 A;  2N4F A;  2FCS A;  3QAQ A;  1QZE A;  3PVL A;  3A33 B;  1UGM A;  2MX2 A;  1WF9 A;  5DPW A;  1WR1 A;  2NPT A;  1GC7 A;  2D10 A;  3V62 A;  4FLH A;  2JUO A;  3DQV A;  3H1U A;  3SHQ A;  2EMS A;  4DHJ D;  4MJS B;  4G50 A;  4ZRK A;  1KJT A;  5CHV C;  2LGY A;  2WYQ A;  2HD5 B;  5JHA A;  3R3M A;  1H4R A;  1R4N I;  2KAN A;  3TIX A;  4IM3 A;  2JT4 B;  1WYW B;  1WGR A;  5L95 C;  2DYM A;  3L10 B;  4BBN F;  4K1R B;  3SD5 A;  3L17 A;  2HE7 A;  2M0X A;  3QIJ A;  1JRU A;  3S2A A;  1WZ3 A;  2I1K A;  3DPD A;  2M1M A;  1WR6 E;  4WJQ A;  3PS6 A;  1WJ6 A;  4HDQ A;  2LJ5 A;  5DCN A;  1EO6 A;  1E8Z A;  2FCM A;  2KX0 A;  2LXC A;  3APF A;  3DVG Y;  1WGD A;  4KDL B;  4II2 B;  1KLV A;  2PJH A;  3UQB A;  3JSV A;  4GGQ A;  3QAR A;  2EKE C;  3NZU A;  2KC2 A;  4GXB A;  1LM8 B;  3IBE A;  4MJS A;  4OVU A;  1YQB A;  2JPH A;  2KFJ A;  2O2V A;  3DVN V;  3W1S C;  4F8C B;  2V4L A;  4JL9 A;  2R2Q A;  2IO1 B;  3PZD A;  4K7U A;  3ZVV A;  3APD A;  2KLG A;  2NPT B;  1L7Y A;  5CHF A;  4XZ4 A;  2K6Q A;  5TR5 A;  1S1Q B;  4ZRJ A;  1ZKH A;  3QQ8 B;  2NBV B;  4E3C A;  2A4Z A;  4ASW C;  2MP2 A;  5L83 A;  3H7P A;  1F9J A;  4MGK E;  3HM6 X;  2LD9 A;  4MM3 A;  4JLC A;  3QCA A;  3DBH I;  4IG7 B;  4MEM A;  3RZW C;  3IVF A;  3CF6 E;  3ZKJ C;  2IO2 B;  1YIW A;  5J2R A;  3PHW B;  3HHM A; 
#chains in the Genus database with same CATH topology
 2RR9 A;  3ML9 A;  2IGH A;  4CO7 A;  4TQ1 A;  3M3J A;  1DOI A;  4NY0 A;  2MP2 B;  3NS1 A;  2QIE B;  4RNA A;  2JYE A;  3DBR I;  1FCC C;  3RNB C;  3U8Z A;  2KAC A;  2KK8 A;  4PS8 A;  1QQR A;  2DZK A;  3Q3N C;  3VUW A;  3P63 A;  1XLQ A;  1KF6 B;  3KUZ A;  1QOG A;  2ZZP B;  3RZF A;  3NVV A;  4N9F 4;  2G1E A;  2K8C A;  2WXN A;  3V61 A;  1ET6 A;  5CX3 A;  1FO4 A;  2JVC A;  4OHJ A;  1V5T A;  3IAS 1;  2K39 A;  2CJO A;  1MVK A;  3APC A;  3JVZ X;  4LK0 M;  2KT7 A;  2DAF A;  3AE2 B;  4DXF A;  2W9N A;  2MJ3 A;  1N60 A;  3M95 A;  1V9J A;  3A1Q A;  1C3T A;  2KVZ A;  1OQR A;  2LFI A;  4ACF A;  4HXD A;  2ZCB A;  4GMV A;  3Q14 C;  4YSX B;  2BS3 B;  2TSS A;  4KX6 B;  1I4X A;  4GN1 A;  2YLM A;  1ISN A;  2JWU A;  2C9W B;  3B08 A;  2FCQ A;  4IM2 A;  4FA6 A;  1B1Z A;  3P4P B;  1VZ7 A;  1PUT A;  2LI5 A;  2CKH B;  4BVU C;  3CST A;  2J0J A;  2G4S A;  3K9P B;  4OZB A;  2RDG A;  2FID A;  2Z59 B;  4LCD E;  2LVO A;  2KHW B;  1MJD A;  2IYD B;  4IC7 B;  1QOB A;  1I7H A;  3FIL B;  1ZP0 B;  2R61 A;  1Y8R C;  3PGE A;  4LDT D;  1V81 A;  1VZ8 A;  3NS8 A;  4WIP A;  2BB6 A;  4X57 B;  1SGH A;  1CZP A;  1FM0 D;  1P98 A;  1ENF A;  2ICI A;  1WXS A;  2PVO D;  2OOB B;  3NHE B;  2K25 A;  3AXC A;  1WFY A;  2IO0 B;  1C4A A;  3AED B;  2G9H D;  2IZV B;  1JRP A;  1T3Q A;  1TJE A;  3BK2 A;  3TEY A;  3QJZ A;  2BQQ A;  2OED A;  4I6N B;  3ETR A;  4K3C A;  3OJ3 A;  3AB5 A;  2K1F A;  4ARC A;  2BWF A;  3ZRC A;  3ZYY X;  3ZJU A;  4BOS C;  3GZN B;  3HM3 A;  1OEY A;  1WY8 A;  2FBW B;  4AQ7 A;  4ZRP A;  2UYZ B;  4BAX A;  1T0Q C;  1C1Y B;  4DWF A;  2D3C A;  4I6L B;  3KVF B;  1KOT A;  5EE3 A;  2V1Y A;  1FIQ A;  5C3J B;  2DAJ A;  2I38 A;  3TJP A;  2BS2 B;  3H8H A;  3LYY A;  2B3A A;  4BKG A;  1XLO A;  1SE4 A;  3AEA B;  2DNF A;  4RH6 A;  4KSL C;  4PS7 A;  1V97 A;  2LWP A;  2PVG C;  3VVW B;  1MG4 A;  4XC2 A;  1I4G A;  4EZK A;  2J7Q B;  3AE4 B;  2KAJ A;  3B9J A;  1UUP A;  1M94 A;  3I5J C;  2GI9 A;  2H89 B;  4MDK E;  3RI7 C;  4PYU A;  3ZRF A;  4PYZ A;  2J4X A;  3NZS A;  1VCB A;  2MRP A;  1WJU A;  1WI0 A;  1OEY J;  3GZN I;  2RD0 A;  1ZDV A;  2DEN B;  5GMV A;  3U7Z A;  2K22 A;  1J7C A;  2ZCC A;  2O6V D;  3MHZ A;  4KZC A;  2CS4 A;  2L00 B;  1YX5 B;  1FXT B;  4WWO A;  1MG8 A;  3KUD B;  4DDG D;  1TKE A;  2K3U A;  3N3K B;  2ONQ A;  4WJO A;  4NQK E;  3UIP B;  3HVD A;  2J0K A;  2MCN B;  2ZW1 A;  4EFO A;  4URK A;  4JX1 C;  1VR9 A;  1B9R A;  5D7G A;  3TBL D;  1IP9 A;  2J53 A;  2KVR A;  3AE8 B;  5J18 A;  1LXD A;  4ZYN A;  5LLI A;  3RD2 A;  2K8B A;  2C7H A;  3P4R B;  1E8Y A;  4WWM A;  3ONS A;  2IGG A;  4EZL A;  2LUE A;  3R8B A;  3ZTD A;  2HTM E;  2BB5 A;  3M62 B;  1KM7 A;  3I63 C;  2M8S A;  5LNK 1;  3UI3 A;  3RYT A;  1TYG B;  1GB4 A;  1TKY A;  5IN7 A;  2KLC A;  1XCQ L;  4W9F A;  5IOI A;  1FRR A;  2MW5 A;  3HIZ A;  2V4I B;  1GPX A;  3ZO5 B;  4ICV A;  2BS4 B;  2BBC A;  4TUU A;  3LXF A;  4M0W B;  4JWS C;  3JW0 X;  5IO9 A;  2WDQ B;  1J19 A;  4HRO A;  1WGY A;  1BXT A;  1TKG A;  4C7Y A;  3NOB A;  1QF6 A;  2INN E;  2QMT A;  4KGS A;  1DOX A;  1XCT L;  4G0N B;  4KZ0 A;  1EU4 A;  2AL6 A;  2L0T A;  4REZ A;  1TGZ B;  2E6X A;  3I57 A;  4B0M A;  4YTN B;  1FFV A;  2LEK A;  4KKI A;  3N1Y C;  3VFK A;  4ZHP A;  3CSF A;  2IO3 B;  1WJ4 A;  2N7E A;  3A1Q B;  2W3S A;  2KC1 A;  2QDF A;  5T8I A;  2QIL A;  2M19 A;  3U2S C;  5JHB A;  1AAR A;  1NBF C;  2WXJ A;  4AS1 A;  1J7A A;  1FXA A;  3U7D A;  2FE8 A;  2IDY A;  2WXP A;  4KDI C;  2DZI A;  3KWL A;  2WXL A;  1GC6 A;  2LUM A;  1QZE A;  4WQM A;  4D2K A;  1ZXI A;  5DPW A;  4IDI A;  1QKZ A;  1GC7 A;  3V62 A;  2JUO A;  2QSD A;  4DHJ D;  4MJS B;  4G50 A;  4ZRK A;  2W55 A;  2WYQ A;  2HD5 B;  3R3M A;  3NVY A;  5H8Y E;  2KAN A;  4IM3 A;  5TSS A;  3PZ8 A;  5H92 C;  3GE3 C;  2M0X A;  3S2A A;  1JRU A;  3AMZ A;  4WJQ A;  2M1M A;  5E6J A;  3PS6 A;  2PIA A;  2FCM A;  4II2 B;  3JSV A;  4GGQ A;  3NZU A;  2M0A A;  4RFB A;  4JL9 A;  2R2Q A;  2INP E;  3APD A;  2KLG A;  5CHF A;  1S1Q B;  4XGA B;  3AN1 A;  4E3C A;  2LGS A;  5BYS A;  2Y3A A;  4XWW A;  4MGK E;  4OW0 A;  3OG5 A;  3QCA A;  3DBH I;  1D4B A;  1SIJ A;  3C8Y A;  4XDD A;  3IVF A;  3ZKJ C;  5J2R A;  2L83 A;  3SFE B;  3NUH B;  2WXH A;  3ZJV A;  1YMH E;  1NYQ A;  4BOZ B;  1MFW A;  4KGR A;  1R4N B;  3N32 A;  4P16 A;  1XEE A;  2WQY B;  5EE9 A;  1C79 A;  4RCO A;  4M02 A;  2D3G A;  1WE7 A;  4E71 A;  4ANV A;  4K81 A;  3RPF C;  1FPY A;  1HQR D;  2KN5 A;  4G11 A;  2O2V B;  3NVZ A;  4JE3 B;  1WRI A;  4TQ0 A;  4B9K A;  3W9C B;  2GBJ A;  4HKQ A;  2QC8 A;  3VH3 B;  4EKU A;  4K7S A;  2ZEQ A;  1JCK B;  2RGF A;  1QT9 A;  1JW9 D;  4WH4 A;  4LLG M;  4GSW A;  4GIV A;  4A55 A;  3T3O A;  2IPK D;  4CHK A;  4YT0 B;  4MSM B;  4MGY E;  1FMA D;  5JXV A;  1D3Z A;  3MP9 A;  1PQS A;  3ZNH B;  4NJC A;  4NJ7 A;  2V3S A;  2O6V B;  1SBB B;  1FFU A;  4DHJ B;  3PT2 B;  2NBU A;  1E10 A;  1JML A;  1SXT A;  4NNJ B;  2KXJ A;  1FEH A;  5IAA C;  1LGR A;  3MJ5 A;  2BW2 A;  4WQO B;  4HPL B;  2KWU B;  1OTR B;  3TEX A;  2BKF A;  2BTE A;  4EOY A;  1HTQ A;  3W1Y A;  1J8C A;  1VJK A;  2NCN A;  4XDC A;  4AWJ A;  5D2M B;  3AE1 B;  1CK1 A;  4USA A;  5BYR A;  4HCP B;  1Q10 A;  3Q69 A;  2JU6 X;  1C9F A;  2KJ6 A;  2FAZ A;  5EE0 A;  3ALB A;  3JYU A;  2D07 B;  1SIF A;  1PGB A;  3RUL A;  2PE6 B;  4DXA B;  3A4S C;  2GRI A;  3FAH A;  3KUC B;  1UGJ A;  4II3 B;  3ZDT A;  4RM9 A;  2Y5P A;  2GOW A;  3MFG A;  1FNW A;  3W1S A;  2KOX A;  2LGD A;  4US9 A;  1OFF A;  3AE3 B;  3ZLZ A;  4FHJ A;  2G4D B;  1IGC A;  3M63 B;  3VHT C;  2KKC A;  3NVW A;  5DPT A;  3EA6 A;  4HLE A;  2CHX A;  3EHV A;  2WDT B;  4DHZ E;  4FXC A;  3R2T A;  1I42 A;  4C4V B;  3A9J A;  3V60 A;  4F7Z A;  4N6E B;  3LB8 C;  4J6I A;  5J17 A;  5BYQ A;  3SU8 X;  4NJ6 A;  2GBR A;  2CHW A;  5CTR C;  4WAF A;  3BII D;  2WDV B;  1N5W A;  3QX1 A;  3TCA A;  1WXA A;  4P6V F;  1R7S A;  4B95 A;  2AWT A;  1YJ1 A;  3HVZ A;  1S3S G;  4KIK B;  2JY6 A;  3KQ4 A;  2LRU A;  2VRR B;  1WIA A;  2M4N A;  3T8M A;  1N5X A;  2KDF B;  2KJR A;  2VH1 A;  1UD7 A;  4JWU C;  2G45 B;  3AEG B;  1L0V B;  1V1P A;  2NTT A;  2WU2 B;  1JAL A;  2N1W A;  1KLU D;  2LMC A;  3ML8 A;  3URY A;  1SE3 A;  3N30 A;  1JWU D;  1LQB A;  1MHX A;  3SDL C;  2L3Z A;  2GMI C;  3GP7 A;  3X23 A;  1V86 A;  2K6D B;  1V6E A;  2KD0 A;  2KMA A;  3Q3J A;  4ICU A;  4NZL B;  3BVM A;  2GBM A;  2WNM A;  2L1A A;  2MEK A;  2GB1 A;  1TY0 A;  1YQ4 B;  3UF8 A;  3ZUN A;  2AQ3 B;  3ZGZ A;  2KFK A;  1YJJ A;  1HE8 A;  1TIF A;  2KZR A;  2BPS A;  4KIK A;  4MM3 B;  2ZVO A;  5G2N A;  1R4M I;  1WYG A;  2PEA A;  2PTL A;  2L76 A;  2K0P A;  5C2T B;  4HPM B;  3D32 A;  2FUH B;  1SF0 A;  2D11 A;  2MBH A;  5FK9 C;  4TV3 A;  2R2O A;  1IPG A;  1VD2 A;  1TZO A;  2DZM A;  3Q8A A;  1WGK A;  2X38 A;  4L23 A;  2MBO A;  4HVB A;  2H88 B;  1F52 A;  3MC0 B;  1BT0 A;  3QC8 B;  2AQ1 B;  1XO3 A;  1P0R A;  2BYV E;  4DXG A;  1A5R A;  3QHT A;  1NVI D;  2ZVN A;  2MHJ A;  2WWZ A;  2MBE A;  5HKH A;  2K8H A;  3FIL A;  1RAX A;  2KJH B;  5IP4 D;  1FNU A;  1ZW7 A;  2QHO A;  1UF0 A;  2KX3 A;  2C7N B;  1GJZ A;  3RNG C;  3DHG C;  1I4P A;  2CJN A;  1DYQ A;  2MJD A;  3PRP B;  4RF0 A;  2EMT A;  2KTF A;  4OVV A;  3VTU A;  3FKY A;  2M17 A;  4RF1 A;  1WXQ A;  3AEF B;  2A5U A;  2ASQ A;  1TS4 A;  4AJY B;  2JX5 A;  3DBH B;  2DHZ A;  3TEW A;  4AJW A;  1WXM A;  4LJP B;  4LNO A;  4NAW B;  1P9D U;  2WXF A;  1ZUD 2;  4I6P A;  4JQW C;  5EE1 A;  5JH5 C;  4MGI E;  4FJV B;  3L08 A;  2OJR A;  5BO4 B;  1PGA A;  1RFA A;  3B2F A;  1RLF A;  4EEW A;  2NVU I;  1C76 A;  1T0R C;  2O6V A;  4US8 A;  1K53 A;  3P2B A;  3PTF C;  3W5U B;  5LXH A;  2KQS A;  3AI5 A;  5BMH A;  4A9A A;  1L0Y B;  1QOF A;  4EUT A;  3Q8B A;  3A33 B;  1UGM A;  1C78 A;  2JSV X;  2W82 A;  2IND C;  4LNF A;  1KJT A;  1NEN B;  2LGY A;  2IJ0 A;  3C19 A;  2JT4 B;  2DBY A;  1WYW B;  3BWU D;  2KN4 A;  2DYM A;  4GLS C;  2KWD A;  3IT4 B;  1WZ3 A;  1WR6 E;  4HRS A;  1WJ6 A;  2NMQ A;  1EWY C;  1QIL A;  1E8Z A;  3APF A;  4KDL B;  2PJH A;  1VLB A;  2KC2 A;  2CU3 A;  4OVU A;  2KFJ A;  2O2V A;  3DVN V;  3W1S C;  3PZD A;  2NPT B;  4XZ4 A;  3ZQ4 A;  3OWE B;  2LJI A;  4ZRJ A;  1TS2 A;  4N58 A;  2W3R A;  2A4Z A;  2Z8L A;  2N7J A;  3Q8F A;  4ASW C;  4JPS A;  2V0G A;  3H7P A;  1F9J A;  4HJG E;  4PK1 A;  3BYY B;  3RZW C;  3TEZ A;  2IO2 B;  1YIW A;  3PHW B;  3HHM A;  3MC8 A;  3L16 A;  4C4V A;  2ZNV C;  1RWS A;  3DVN U;  1QOA A;  2INC C;  2HTH A;  2ZPN A;  5AZH A;  1HZ6 A;  3A9K B;  2XBB C;  4DHZ B;  1UEL A;  1D5M C;  5HFY A;  2XEW A;  4RGT A;  3TSS A;  3E56 A;  4W9G A;  4DQO C;  2WXR A;  2D3A A;  1R4M B;  5EDS A;  4IWO A;  3BVG A;  2XNA C;  5HHD G;  4N59 A;  5D94 A;  4MEL A;  4ZOH C;  2LVP A;  4LJO B;  3H7P B;  4WJP A;  3RNF C;  1L6V A;  5HG2 A;  3RCZ A;  1STE A;  3O13 A;  2FUG 1;  3W2D A;  3AE7 B;  4HEA 1;  4RGM A;  4RM8 A;  1XF5 L;  3H7S A;  2M56 B;  4YWG G;  4KGT A;  1WH3 A;  4IWP A;  5FR3 A;  3NG0 A;  4L1B A;  5KHQ A;  1HZ5 A;  4ANX A;  4BZA A;  3R7Q A;  1TTN A;  2LVQ A;  2PE9 A;  5DPS A;  5AZF A;  5C23 A;  3EUB 2;  4HK2 A;  2BGF A;  2RPV A;  3WA0 A;  5I4D A;  1IYF A;  1Q5W B;  3BVZ A;  2ZPY A;  1IBX B;  2MJE A;  4HDO A;  2KFK B;  5BMG A;  1Y56 A;  5HI1 A;  4IW0 A;  2Q5W D;  2DX5 B;  3K9O B;  4FHK A;  4FJY A;  1WM2 A;  1EF1 A;  1VRA B;  2QJL A;  1N6Z A;  3RUI B;  1D6E C;  1A70 A;  3ABV B;  3VTW A;  4C7Z A;  4MGZ E;  3ZNI D;  2AYO B;  2L0F A;  1WGG A;  1UZX B;  3RT3 B;  1X1M A;  2BYF A;  2DZJ A;  3RNE C;  1E0Z A;  4B0E A;  1XT9 B;  1C4P A;  2PMV A;  1JWM D;  1SE9 A;  2JRI B;  2KWV B;  2L8J A;  1E90 A;  2W54 A;  4JGH B;  1WMH B;  3A9K A;  2WXI A;  4J3O D;  2ZJD A;  1E6E B;  3RMK C;  1FCL A;  2KQ4 X;  3AE5 B;  4OZC A;  1T6B X;  2Y5B B;  3NJT A;  1OGW A;  1JWS D;  2FNJ B;  4IKG A;  4WAA A;  4DK5 A;  4FBJ B;  2JYT A;  1V1O A;  1TZ1 A;  3VUY A;  3UIO B;  4HWI B;  2RMM A;  4W9I A;  2PPH A;  1NEK B;  4A90 A;  4PT5 A;  1FD6 A;  3I3T B;  2AL3 A;  3A4R A;  3RFZ B;  1LFD A;  2BYE A;  1Z5S B;  3Q3M C;  5BMI A;  3IHP C;  3IG3 A;  3Q6B A;  1D5Z C;  2DWQ A;  3GB1 A;  3Q3F A;  2KQ7 A;  3Q2A C;  1L6U A;  1ZGU B;  1PGX A;  3DBL I;  1AYF A;  4ITK A;  2MA9 B;  1GG3 A;  3UGB B;  1V8C A;  1MPE A;  4YXD B;  4GDK A;  4XX5 A;  2BWE S;  2L52 A;  1V1P B;  1TBE A;  3A9J B;  3U52 E;  1WSP A;  3Q3O C;  3IT6 B;  1CMX B;  5E6O A;  3KYD D;  2XN9 C;  3NZ3 A;  1TS3 A;  4RMA A;  5D3D A;  5D6J B;  1M4V A;  4KSK C;  3B0A A;  4KKJ A;  1XQQ A;  1Q0W B;  2EEL A;  2REX A;  3TMP B;  1UH6 A;  1EUV B;  2KDI A;  1SEB D;  1WXV A;  3WAL A;  1YQ3 B;  3IXS A;  4C80 A;  4HPP A;  1ZDX A;  1V5O A;  2VZK B;  1NI2 A;  3ECI A;  3MJW A;  3VH4 B;  1KH0 A;  2WX0 A;  1L4D B;  3P42 A;  2NS5 A;  1DGJ A;  1ZPS A;  1ZXH A;  2NBW B;  3BYT B;  3DHH C;  1KFY B;  1V80 A;  4NAM A;  1JWA D;  3ZNZ B;  3ZDM C;  3N1Z C;  2I1J A;  4LDT B;  4OZA A;  1BML C;  3DCG A;  5MPO A;  2WU5 B;  3PZ7 A;  1V2Y A;  4HJK A;  3B2G A;  2AQ2 B;  2J42 A;  3KH0 A;  4FUL A;  3EFU A;  2OHF A;  2LZ6 A;  5AUK A;  1GOZ A;  2MLB A;  2AX5 A;  3FC4 A;  2EKI A;  3AU4 A;  1K52 A;  1KTK A;  1TS5 A;  2DLB A;  1WX9 A;  2WLB A;  4RGO S;  2J0M A;  1Q1O A;  1WJN A;  2KDB A;  3C0R B;  1GNU A;  3NRZ A;  5KHO A;  1P1A A;  4IWQ A;  1RYJ A;  4F1S A;  1E9M A;  4MAC A;  1HEZ E;  3VTV A;  3SEB A;  1PFD A;  3WAM A;  1L2N A;  3QWZ B;  1WZ0 A;  1L4Z B;  4XE0 A;  2JWZ A;  3OLM D;  3QA8 A;  3DVG X;  2WS3 B;  4JIO U;  1HXY D;  1H8C A;  3BK1 A;  1YN4 A;  2N9E B;  2Z0E B;  1IBX A;  2BKR B;  3HUI A;  4FAD A;  1AN8 A;  3GS2 A;  2PLP A;  1E7P B;  2HJ8 A;  2JZ3 B;  2NR2 A;  1AW7 A;  5AUI A;  3RN9 C;  1WMH A;  2QEJ C;  2X8X X;  2DYO A;  3QK0 A;  2OJW A;  2JXX A;  4YL8 A;  1ESF A;  2N9K A;  4ANW A;  2LGI A;  3IAM 1;  1HA5 A;  3AH7 A;  1UBQ A;  1E7U A;  1WX7 A;  1KRH A;  2B76 B;  1VDV A;  4TKN A;  2WX1 A;  5IKC M;  4M8M A;  4ANU A;  5G5G A;  2N4F A;  1DOY A;  3QAQ A;  4TSS A;  3PVL A;  2MX2 A;  2NPT A;  2D10 A;  4FLH A;  3H1U A;  2WXG A;  1H4R A;  1IUE A;  1R4N I;  4LNK A;  4L2Y A;  1WGR A;  5L95 C;  3L10 B;  3SD5 A;  3QIJ A;  2HE7 A;  1J7B A;  3DPD A;  2I1K A;  1I4R A;  4HDQ A;  5DCN A;  3ZXV A;  1EO6 A;  2LXC A;  3DVG Y;  1WGD A;  1SSN A;  3VRA B;  1KLV A;  3UQB A;  3QAR A;  2L32 A;  1LM8 B;  2MH7 A;  1YQB A;  1EU3 A;  2V4L A;  3ZVV A;  5TR5 A;  3QQ8 B;  2N0S B;  2NBV B;  1WWT A;  2MP2 A;  1SJE D;  1MI0 A;  1LO5 D;  3HM6 X;  2V3P A;  4JLC A;  4O1N A;  4MEM A;  4M00 A;  1GB1 A;  1UWM A;  2HDE A;  1YJI A;  1NI3 A;  3I9V 1;  3EFC A;  2IBI B;  2PKO A;  4MSQ B;  3NY5 A;  3DBL B;  4S0R A;  2MBQ A;  2RSU A;  4G3X B;  5E6P A;  2MQJ A;  3V05 A;  4GDL A;  4AP4 C;  1G6J A;  2YEP F;  4DDI D;  3VXW A;  1YOV B;  2L05 A;  2ZNV B;  1XXG A;  1ROE A;  2J52 A;  1WE6 A;  3AE6 B;  4P1C C;  2E3T A;  1YD8 U;  1JWB D;  2MSE D;  3ZTC A;  1XLP A;  3KWV A;  2G3Q B;  1TT5 B;  4C00 A;  4YTP B;  2RDB C;  1F1H A;  3OJ4 B;  4NPN A;  3EC8 A;  3VR9 B;  3AEB B;  4LTU A;  3DWG C;  4A20 A;  1WM3 A;  2KDM A;  2PW9 A;  2ZW0 A;  4TMA B;  3WAP A;  4KVG B;  1QLB B;  2VZK D;  3PHX B;  3HK0 A;  3PO0 A;  1EWC A;  4PS3 A;  4W9E A;  2L7R A;  1N62 A;  2LGX A;  2YVC A;  4ZRI A;  2WDR B;  4QAY A;  4UDU C;  1XLN A;  4E74 A;  3AEC B;  1T0Y A;  2VH2 A;  3SFD B;  1FXI A;  4FJZ A;  2GLS A;  2WXK A;  2JRH A;  4M01 A;  3DWM A;  5D3I B;  4W9D A;  3U30 A;  2JF5 A;  1RFK A;  1OQY A;  3AE9 B;  3L54 A;  2CU1 A;  2N9P C;  2MBB B;  3UQA A;  1K8R B;  3L0W B;  5JZE B;  1U4A A;  2KO3 A;  1K50 A;  3WCQ A;  4NQL B;  4ZDV A;  2KMC A;  2CR5 A;  1I4Q A;  1NDD A;  3DOW A;  1UNS A;  3ZNG C;  4M0W A;  2NTS A;  4AOF A;  3PLV A;  4WWP A;  3BY4 B;  4GU2 A;  3P1M A;  2IY0 B;  1F2R I;  2GBK A;  3EGR A;  3DBS A;  1IGD A;  4Q2J A;  2D2Q A;  3GOE A;  3H6N A;  2WP9 B;  1ET9 A;  4ZRQ A;  2KDE B;  3V3X A;  4FN2 A;  1OQQ A;  2C60 A;  1L0X B;  2LHE A;  3IFW B;  1YNT E;  1J0G A;  2WXM A;  4EE2 A;  2XK5 A;  2KTR A;  3TL5 A;  1C77 A;  3PRE A;  2K9X A;  4BKS D;  3WIM A;  1XD3 B;  4LNN A;  4H2A A;  4HKZ E;  3EEC A;  3MHS D;  2BVC A;  1WRD B;  4IOI E;  2C5L C;  4GOC A;  1UBI A;  2JZZ A;  4MH8 A;  3U4E G;  3VUX A;  4W9L A;  1T5X D;  4KV2 A;  2SEB D;  5G5H A;  1Z2M A;  3WAO A;  4C56 C;  2Z0D B;  4GB9 A;  3O65 B;  2BF8 B;  1YX6 B;  2D5G A;  4BBN C;  3PLU A;  3AEE B;  3PRM B;  2KNB A;  2LXA A;  4BKT A;  1D5X C;  3RNA C;  3X0W A;  2IGD A;  1F0Z A;  1F77 A;  2RPQ A;  1EM7 A;  3CMM B;  4MH0 E;  2V9H A;  4DBG A;  1I4H A;  4P1B C;  2FIF A;  1P7F A;  3Q8E A;  4W9H A;  1JQ4 A;  5C1Z A;  3OAW A;  3KW5 B;  3R66 C;  2KWC A;  5FR6 A;  5CHW A;  2KTR B;  3Q8C A;  2RDH A;  1HTO A;  3DDC B;  4WWN A;  1AWD A;  1RRB A;  3WAN A;  4EZJ A;  3KYC D;  3PPA A;  5AEK B;  2UWQ A;  3TUO A;  2LHD A;  1V49 A;  4WJN A;  3RNC C;  3BIN A;  2SAK A;  3PSE B;  2LAS A;  3JSV B;  3P4Q B;  2CHZ A;  2YEP B;  4S17 A;  1I35 A;  3VDZ A;  2IY1 B;  3AM9 A;  3L13 A;  3VR8 B;  2WXO A;  1ACC A;  3VQI A;  2C7M B;  4CQN A;  3ZXR A;  4NAW A;  3R2I A;  1E8X A;  2LRW A;  3B1L X;  4K7W A;  4XYC A;  4YTM B;  1PDX A;  1ZOY B;  4OVZ A;  4GDK B;  3VAW A;  3LDZ E;  3W5V B;  4M8N A;  1N61 A;  2BYT A;  2I2Y A;  3SR6 A;  2WXQ A;  4HCN B;  2ON8 A;  5AZG A;  4MT5 A;  2FCN A;  3T3N A;  1VZ6 A;  1E8W A;  1GAQ B;  2KMM A;  4LNI A;  2Y5C A;  1ZE3 D;  3E9S A;  4BKS A;  4ARI A;  2QCZ A;  2WHI A;  4ZYS A;  3ZJT A;  1E7V A;  3P4S B;  5DPR A;  1GUA B;  2WGS A;  1RM6 C;  1E5W A;  3VRB B;  3BZD B;  1JRO A;  3ZW3 A;  3AU5 A;  3LJ3 A;  3ZIM A;  4GDL B;  3DHI C;  1NYR A;  3CIR B;  2BT6 A;  4WUR A;  5E6N A;  4W9J A;  4A3O A;  4IM0 A;  4RGN A;  2N7D A;  1WX8 A;  1EF5 A;  4ZHO A;  1P3Q U;  2XK5 B;  3MTN B;  4YSZ B;  1F2R C;  1P7E A;  2MWS B;  1N63 A;  3N20 C;  1WGH A;  3N1X C;  2HJ1 A;  3L4P A;  2N1V A;  4AUQ C;  1KLG D;  3PV1 A;  1FRD A;  3PRZ A;  4K3B A;  4W9C A;  1YN3 A;  4A3P A;  3H9D A;  3R7R A;  3HRD D;  4R3D A;  2KYW A;  2UU7 A;  2JZP A;  1UWX A;  4A6Q A;  3V6E B;  1CJE A;  4IUM B;  1CQV A;  4W9K A;  4XWT A;  4B6W A;  1BUI C;  2GBN A;  2N9X A;  5IA7 A;  4CYE A;  5LXI B;  2AEH A;  3T9L A;  3MC9 A;  3ENE A;  3UIN B;  1PYW D;  4P7I A;  5G55 A;  3AUL A;  4BFR A;  3V6C B;  2DYB A;  1SB3 C;  2FCS A;  5GXG B;  2V3N A;  4YSY B;  1FNV A;  1WF9 A;  2ACZ B;  1WR1 A;  1C4C A;  1L5P A;  1T0S C;  3DQV A;  3SHQ A;  2EMS A;  5CHV C;  2N9L A;  3KLS X;  5JHA A;  3TIX A;  3N9Y C;  4BBN F;  2K5P A;  4K1R B;  1SE2 A;  3CWI A;  3L17 A;  1MHH E;  3DBR B;  2JXT A;  2LJ5 A;  2KX0 A;  2D3B A;  3AV8 A;  2EKE C;  2JQR B;  4GXB A;  3IBE A;  4MJS A;  2JPH A;  4F8C B;  1YN5 A;  2IO1 B;  4K7U A;  1L7Y A;  2K6Q A;  5FKA C;  1ZKH A;  3GE8 C;  4A8X C;  5L83 A;  2LD9 A;  4MM3 A;  4IG7 B;  3J9C A;  1K51 A;  1SJH D;  1TY2 A;  3CF6 E; 
#chains in the Genus database with same CATH homology
 2RR9 A;  2IBI B;  3L16 A;  3ML9 A;  4CO7 A;  2ZNV C;  3DVN U;  4BOZ B;  4TQ1 A;  2HTH A;  2ZPN A;  5AZH A;  3M3J A;  3N32 A;  3A9K B;  4NY0 A;  2XBB C;  2MP2 B;  4DHZ B;  1UEL A;  4MSQ B;  2XEW A;  2D3G A;  3NY5 A;  1WE7 A;  4E71 A;  4W9G A;  3DBR I;  3U8Z A;  5E6P A;  2MBQ A;  2RSU A;  4G3X B;  4K81 A;  2KK8 A;  4PS8 A;  4ANV A;  2DZK A;  5EDS A;  2KN5 A;  4IWO A;  4G11 A;  2O2V B;  3VUW A;  2MQJ A;  4GDL A;  4AP4 C;  1G6J A;  3KUZ A;  4TQ0 A;  5D94 A;  4MEL A;  4B9K A;  4DDI D;  2GBJ A;  3VXW A;  2ZZP B;  3RZF A;  2L05 A;  2ZNV B;  4N9F 4;  3VH3 B;  2K8C A;  2LVP A;  3V61 A;  4EKU A;  4LJO B;  3H7P B;  4K7S A;  4WJP A;  5CX3 A;  1WE6 A;  2ZEQ A;  2JVC A;  3RCZ A;  1V5T A;  1YD8 U;  2K39 A;  2RGF A;  2MSE D;  3ZTC A;  4RM8 A;  3APC A;  3JVZ X;  4GSW A;  2G3Q B;  2DAF A;  4GIV A;  3H7S A;  4CHK A;  3OJ4 B;  4NPN A;  3EC8 A;  1WH3 A;  4IWP A;  2W9N A;  4MSM B;  4MGY E;  3M95 A;  4A20 A;  5KHQ A;  1V9J A;  1WM3 A;  1D3Z A;  3A1Q A;  1C3T A;  4ANX A;  3R7Q A;  1TTN A;  1PQS A;  3ZNH B;  2LVQ A;  3WAP A;  2PE9 A;  4KVG B;  5DPS A;  5AZF A;  3PHX B;  3HK0 A;  5C23 A;  4HXD A;  4HK2 A;  2BGF A;  3WA0 A;  4PS3 A;  4W9E A;  1IYF A;  2L7R A;  2ZCB A;  4GMV A;  4NJ7 A;  1Q5W B;  2V3S A;  2LGX A;  2ZPY A;  2YVC A;  4ZRI A;  2O6V B;  4HDO A;  4E74 A;  1T0Y A;  2KFK B;  4GN1 A;  4DHJ B;  4FJZ A;  2YLM A;  3PT2 B;  1ISN A;  2NBU A;  4IW0 A;  2C9W B;  2DX5 B;  3B08 A;  3K9O B;  2FCQ A;  4IM2 A;  2JRH A;  4FHK A;  4FA6 A;  4FJY A;  1WM2 A;  1EF1 A;  4NNJ B;  4W9D A;  2JF5 A;  2KXJ A;  3U30 A;  5IAA C;  1OQY A;  3RUI B;  3L54 A;  2CU1 A;  2LI5 A;  2CKH B;  4WQO B;  4HPL B;  4BVU C;  2N9P C;  3CST A;  2J0J A;  3VTW A;  2G4S A;  2KWU B;  4MGZ E;  3ZNI D;  2MBB B;  3UQA A;  1OTR B;  3K9P B;  2AYO B;  2BKF A;  2L0F A;  1WGG A;  2FID A;  1K8R B;  4EOY A;  1UZX B;  2Z59 B;  4LCD E;  2LVO A;  2KHW B;  3L0W B;  3W1Y A;  1U4A A;  2KO3 A;  5JZE B;  1J8C A;  2NCN A;  2IYD B;  4NQL B;  4AWJ A;  3RT3 B;  4ZDV A;  1X1M A;  2KMC A;  5D2M B;  2BYF A;  2CR5 A;  2DZJ A;  1NDD A;  3DOW A;  4IC7 B;  3PGE A;  1Y8R C;  1XT9 B;  4LDT D;  1V81 A;  3ZNG C;  4HCP B;  4AOF A;  3NS8 A;  1SE9 A;  2KJ6 A;  2FAZ A;  3PLV A;  4WWP A;  2JRI B;  4X57 B;  1SGH A;  3BY4 B;  2KWV B;  3ALB A;  1P98 A;  4GU2 A;  2L8J A;  2IY0 B;  1WXS A;  2GBK A;  3JYU A;  2OOB B;  3DBS A;  3NHE B;  2K25 A;  1E90 A;  2D07 B;  1SIF A;  3AXC A;  3RUL A;  1WFY A;  2D2Q A;  4JGH B;  1WMH B;  2PE6 B;  3GOE A;  4DXA B;  3A9K A;  3H6N A;  3A4S C;  3KUC B;  2ZJD A;  4II3 B;  3ZDT A;  2KDE B;  4RM9 A;  4FN2 A;  2C60 A;  2GOW A;  2IO0 B;  3W1S A;  3IFW B;  2KOX A;  2LGD A;  1J0G A;  2XK5 A;  3ZLZ A;  2IZV B;  2KTR A;  3TL5 A;  4FHJ A;  2G4D B;  2Y5B B;  3PRE A;  4BKS D;  1OGW A;  1XD3 B;  3WIM A;  3QJZ A;  3EEC A;  3M63 B;  3MHS D;  1WRD B;  3VHT C;  2C5L C;  2KKC A;  5DPT A;  4GOC A;  4HLE A;  2FNJ B;  4WAA A;  2CHX A;  4DK5 A;  1UBI A;  3EHV A;  2WDT B;  4FBJ B;  2JZZ A;  3VUX A;  4DHZ E;  4I6N B;  1TZ1 A;  4W9L A;  3VUY A;  4KV2 A;  3UIO B;  3OJ3 A;  1I42 A;  4HWI B;  3A9J A;  2K1F A;  1Z2M A;  4W9I A;  3WAO A;  2PPH A;  3V60 A;  4F7Z A;  2BWF A;  4J6I A;  2Z0D B;  3ZRC A;  4GB9 A;  5J17 A;  3SU8 X;  3I3T B;  4BOS C;  4NJ6 A;  3HM3 A;  3O65 B;  2BF8 B;  1OEY A;  1WY8 A;  2AL3 A;  1YX6 B;  2CHW A;  2GBR A;  3A4R A;  1LFD A;  5CTR C;  2BYE A;  4BBN C;  1Z5S B;  2UYZ B;  3PLU A;  1C1Y B;  2KNB A;  3PRM B;  4DWF A;  4I6L B;  3KVF B;  1KOT A;  3QX1 A;  3IHP C;  3IG3 A;  3TCA A;  1WXA A;  2LXA A;  4BKT A;  2V1Y A;  2DAJ A;  3TJP A;  3X0W A;  2RPQ A;  4B95 A;  3CMM B;  4MH0 E;  3Q3F A;  4DBG A;  2FIF A;  2KQ7 A;  2AWT A;  2B3A A;  1YJ1 A;  4W9H A;  4BKG A;  5C1Z A;  3OAW A;  3KW5 B;  1ZGU B;  3R66 C;  1S3S G;  2KWC A;  3DBL I;  5FR6 A;  4KSL C;  5CHW A;  4KIK B;  2JY6 A;  2KTR B;  2LRU A;  2VRR B;  4PS7 A;  1WIA A;  1GG3 A;  2M4N A;  2MA9 B;  3UGB B;  2LWP A;  3T8M A;  4GDK A;  3DDC B;  4WWN A;  3VVW B;  4XX5 A;  2BWE S;  1RRB A;  4XC2 A;  3WAN A;  4EZJ A;  3KYC D;  4EZK A;  2J7Q B;  2KDF B;  1M94 A;  3PPA A;  1TBE A;  2KJR A;  3A9J B;  1UD7 A;  5AEK B;  2G45 B;  2UWQ A;  1CMX B;  4MDK E;  5E6O A;  3KYD D;  4RMA A;  1V49 A;  4PYU A;  4WJN A;  3BIN A;  5D6J B;  3ZRF A;  4PYZ A;  4KSK C;  3PSE B;  2N1W A;  3B0A A;  3NZS A;  1VCB A;  2LAS A;  3JSV B;  2MRP A;  1WJU A;  1XQQ A;  3ML8 A;  1Q0W B;  1WI0 A;  2CHZ A;  1OEY J;  3GZN I;  2REX A;  3TMP B;  1EUV B;  1UH6 A;  2RD0 A;  1I35 A;  3N30 A;  3VDZ A;  2IY1 B;  2DEN B;  5GMV A;  1LQB A;  3L13 A;  2KDI A;  2L3Z A;  2GMI C;  3SDL C;  1WXV A;  3WAL A;  1V86 A;  3VQI A;  3X23 A;  2ZCC A;  2K6D B;  1V6E A;  2O6V D;  2KD0 A;  2KMA A;  4KZC A;  3Q3J A;  2CS4 A;  2L00 B;  1YX5 B;  2C7M B;  4ICU A;  1FXT B;  4WWO A;  1MG8 A;  3KUD B;  4DDG D;  4NAW A;  1V5O A;  2GBM A;  1NI2 A;  3N3K B;  1E8X A;  2LRW A;  3ECI A;  4NQK E;  3B1L X;  4K7W A;  4WJO A;  3UIP B;  3UF8 A;  2J0K A;  3MJW A;  3VH4 B;  2MCN B;  3ZUN A;  2WX0 A;  4GDK B;  2KFK A;  4EFO A;  4URK A;  1HE8 A;  2KZR A;  3VAW A;  3LDZ E;  2BPS A;  4KIK A;  5D7G A;  2NS5 A;  3TBL D;  2ZVO A;  1IP9 A;  4M8N A;  5G2N A;  1R4M I;  2NBW B;  2KVR A;  2PEA A;  5J18 A;  1LXD A;  4ZYN A;  2L76 A;  5LLI A;  3RD2 A;  2K8B A;  2C7H A;  1E8Y A;  4HPM B;  1V80 A;  3ONS A;  3D32 A;  2FUH B;  4HCN B;  3ZDM C;  5AZG A;  3ZNZ B;  2D11 A;  2MBH A;  2FCN A;  1E8W A;  2LUE A;  2I1J A;  4LDT B;  4TV3 A;  4EZL A;  2R2O A;  1IPG A;  3DCG A;  1VD2 A;  2DZM A;  3ZTD A;  3M62 B;  1V2Y A;  2MBO A;  4HJK A;  1KM7 A;  4HVB A;  3KH0 A;  4BKS A;  4FUL A;  2M8S A;  1BT0 A;  3EFU A;  3QC8 B;  3RYT A;  2LZ6 A;  1P0R A;  2MLB A;  1E7V A;  3AU4 A;  2BYV E;  2KLC A;  5DPR A;  1A5R A;  3QHT A;  1GUA B;  1E5W A;  4W9F A;  3ZW3 A;  2MW5 A;  2ZVN A;  3AU5 A;  3HIZ A;  2WWZ A;  2MBE A;  3LJ3 A;  3ZIM A;  3ZO5 B;  4ICV A;  5HKH A;  4GDL B;  1WX9 A;  2K8H A;  1RAX A;  2KJH B;  4TUU A;  4M0W B;  2J0M A;  1Q1O A;  1WJN A;  1ZW7 A;  2KDB A;  3C0R B;  2QHO A;  4W9J A;  4IM0 A;  5E6N A;  4A3O A;  3JW0 X;  1GNU A;  2KX3 A;  2C7N B;  1GJZ A;  5KHO A;  1P1A A;  4IWQ A;  2N7D A;  1WX8 A;  1J19 A;  1EF5 A;  4F1S A;  1P3Q U;  2XK5 B;  3MTN B;  1WGY A;  3VTV A;  3NOB A;  3PRP B;  2MWS B;  1WGH A;  2EMT A;  2KTF A;  3WAM A;  1L2N A;  3QWZ B;  2N1V A;  1WZ0 A;  4AUQ C;  4OVV A;  3PV1 A;  3VTU A;  2M17 A;  2JWZ A;  4G0N B;  3OLM D;  3QA8 A;  3DVG X;  3PRZ A;  4KZ0 A;  4JIO U;  4A3P A;  4W9C A;  2A5U A;  3H9D A;  1H8C A;  2ASQ A;  4AJY B;  3R7R A;  2N9E B;  2AL6 A;  2L0T A;  2Z0E B;  2DHZ A;  2BKR B;  4AJW A;  4FAD A;  1TGZ B;  1WXM A;  4LJP B;  3V6E B;  4NAW B;  1P9D U;  2HJ8 A;  2JZ3 B;  2NR2 A;  4I6P A;  4IUM B;  4JQW C;  1WMH A;  5JH5 C;  4MGI E;  3VFK A;  4FJV B;  2DYO A;  3QK0 A;  3CSF A;  2IO3 B;  1WJ4 A;  2N7E A;  3A1Q B;  3L08 A;  4W9K A;  2OJR A;  2JXX A;  5BO4 B;  4B6W A;  4YL8 A;  2GBN A;  2N9X A;  1RFA A;  5IA7 A;  2KC1 A;  4CYE A;  4ANW A;  5LXI B;  2AEH A;  1RLF A;  3T9L A;  4EEW A;  5JHB A;  1UBQ A;  2NVU I;  1E7U A;  3ENE A;  3UIN B;  1AAR A;  4P7I A;  1NBF C;  1WX7 A;  5G55 A;  3AUL A;  2O6V A;  3U7D A;  4BFR A;  4TKN A;  2WX1 A;  3P2B A;  3PTF C;  4M8M A;  3V6C B;  2DYB A;  4KDI C;  2KQS A;  2DZI A;  4ANU A;  5LXH A;  3AI5 A;  4EUT A;  1GC6 A;  2N4F A;  2FCS A;  3QAQ A;  1QZE A;  3PVL A;  3A33 B;  1UGM A;  2MX2 A;  1WF9 A;  5DPW A;  1WR1 A;  2NPT A;  1GC7 A;  2D10 A;  3V62 A;  4FLH A;  2JUO A;  3DQV A;  3H1U A;  3SHQ A;  2EMS A;  4DHJ D;  4MJS B;  4G50 A;  4ZRK A;  1KJT A;  5CHV C;  2LGY A;  2WYQ A;  2HD5 B;  5JHA A;  3R3M A;  1H4R A;  1R4N I;  2KAN A;  3TIX A;  4IM3 A;  2JT4 B;  1WYW B;  1WGR A;  5L95 C;  2DYM A;  3L10 B;  4BBN F;  4K1R B;  3SD5 A;  3L17 A;  2HE7 A;  2M0X A;  3QIJ A;  1JRU A;  3S2A A;  1WZ3 A;  2I1K A;  3DPD A;  2M1M A;  1WR6 E;  4WJQ A;  3PS6 A;  1WJ6 A;  4HDQ A;  2LJ5 A;  5DCN A;  1EO6 A;  1E8Z A;  2FCM A;  2KX0 A;  2LXC A;  3APF A;  3DVG Y;  1WGD A;  4KDL B;  4II2 B;  1KLV A;  2PJH A;  3UQB A;  3JSV A;  4GGQ A;  3QAR A;  2EKE C;  3NZU A;  2KC2 A;  4GXB A;  1LM8 B;  3IBE A;  4MJS A;  4OVU A;  1YQB A;  2JPH A;  2KFJ A;  2O2V A;  3DVN V;  3W1S C;  4F8C B;  2V4L A;  4JL9 A;  2R2Q A;  2IO1 B;  3PZD A;  4K7U A;  3ZVV A;  3APD A;  2KLG A;  2NPT B;  1L7Y A;  5CHF A;  4XZ4 A;  2K6Q A;  5TR5 A;  1S1Q B;  4ZRJ A;  1ZKH A;  3QQ8 B;  2NBV B;  4E3C A;  2A4Z A;  4ASW C;  2MP2 A;  5L83 A;  3H7P A;  1F9J A;  4MGK E;  3HM6 X;  2LD9 A;  4MM3 A;  4JLC A;  3QCA A;  3DBH I;  4IG7 B;  4MEM A;  3RZW C;  3IVF A;  3CF6 E;  3ZKJ C;  2IO2 B;  1YIW A;  5J2R A;  3PHW B;  3HHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...