2MRPA

Nmr solution structure of the ubiquitin like domain (ubl) of dna-damage-inducible 1 protein (ddi1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
DLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ubiquitin-binding protein
molecule keywords DNA damage-inducible protein 1
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mrpA00
2LVQA 1Y8RC 3NS8A 1OEYJ 2PPHA 3UGBB 2L05A 3V61A 2IYDB 3VH3B 3ZRCA 4EZLA 4M8MA 2KTFA 3T9LA 2C7MB 2MRPA 5DPWA 4K7WA 3WA0A 4DBGA 5L95C 2JZ3B 1WGRA 1WJ6A 1WM2A 2O6VD 2D07B 2CU1A 4MGIE 5D6JB 1WX8A 2O2VA 4URKA 2WWZA 3OJ4B 1H4RA 4MJSB 2ZNVC 3JYUA 5DPTA 3UF8A 3W1YA 1I35A 5CX3A 2MSED 3VHTC 2HJ8A 4BOSC 1YJ1A 4FJYA 3WAPA 4HVBA 3L08A 3K9PB 3OAWA 4XC2A 2BYEA 3RZWC 4HXDA 4GXBA 1E5WA 1J0GA 1OQYA 3ML8A 4F1SA 2MP2A 5L83A 2I1JA 2KC1A 3RUIB 1E8ZA 2NCNA 3IFWB 1JRUA 1UBQA 4G0NB 1TTNA 2K1FA 4AP4C 3V6CB 4I6LB 2FCSA 3H9DA 2KMCA 3QARA 3K9OB 2BWFA 4YL8A 4LJPB 3KUDB 1WGYA 4ASWC 4CYEA 2MX2A 2AL6A 2PEAA 4WWNA 4EZJA 4GDLA 5LLIA 4PYUA 3EECA 2D10A 2KDFB 2JRIB 2EKEC 2GBNA 1E8WA 3DBLI 4RMAA 5G2NA 4FHJA 3AI5A 4FADA 3VAWA 3PLVA 3OLMD 2NVUI 1ZGUB 3PZDA 3ENEA 1S1QB 2OOBB 2CHZA 4ZRKA 1WGHA 2K8CA 4JIOU 4X57B 2BYFA 2LWPA 2M1MA 2O2VB 2C7NB 4P7IA 3SDLC 4HLEA 4HDOA 1TZ1A 4HCNB 2HD5B 3AULA 4MGZE 2J0JA 3PVLA 2L8JA 4B9KA 2KANA 2WDTB 3ZUNA 3QAQA 2MLBA 4IUMB 3VTWA 5IAAC 3ZDMC 3T8MA 3A9JA 2DYMA 3APCA 3N30A 2BWES 3JVZX 2JVCA 4LJOB 4MGKE 4KIKB 2BGFA 1J8CA 3X0WA 1V81A 2G4SA 2MBQA 4IC7B 3VQIA 2DYBA 4W9HA 1WI0A 2KNBA 3VUYA 4MM3A 5D94A 5KHOA 3ZNID 3ZTCA 2ZNVB 4G3XB 1WE6A 2CS4A 2KWCA 4HWIB 2DZKA 2KHWB 3Q3FA 4HDQA 1EF1A 2N1WA 4MSMB 1WJUA 4BKTA 1IPGA 1K8RB 5E6PA 3PTFC 1KJTA 1L2NA 2L0TA 4G50A 2IO1B 3AXCA 1ISNA 3Q3JA 4ANVA 5D7GA 2M4NA 4DWFA 3L16A 2NPTA 1WGGA 2ZCCA 3KUCB 3IBEA 3RULA 5J17A 1S3SG 2A4ZA 4E3CA 3AU4A 3VUWA 4DK5A 1ZW7A 4GSWA 2DENB 3U8ZA 3PLUA 2MBBB 4XZ4A 2IY1B 4FA6A 4BVUC 3DBRI 4HPMB 2KC2A 2R2QA 2FCMA 2KQSA 3NZUA 1V49A 1WXSA 3WIMA 4DHZE 3WALA 1PQSA 2NS5A 4PYZA 2GOWA 1UH6A 1RLFA 3N3KB 2Z59B 2KZRA 2XK5B 3H7SA 1SE9A 2D11A 1T0YA 2EMSA 4EFOA 1C3TA 4BFRA 2IZVB 2O6VB 2KLCA 2K8BA 1WXVA 4MDKE 2JY6A 3TMPB 3L54A 3VXWA 3ZNGC 2IO3B 2JPHA 2NBUA 3UIOB 4K7UA 4MSQB 3ZTDA 2JT4B 3B08A 3MHSD 4W9LA 2ZPNA 3A9KA 3MJWA 3KUZA 3RT3B 2RSUA 3RYTA 3DOWA 5DPSA 4EEWA 3PPAA 1TGZB 2K39A 5E6NA 1YIWA 4MEMA 1WZ3A 4GB9A 3TIXA 2L0FA 1YQBA 2ZVNA 2JWZA 2KK8A 3QQ8B 3A9JB 3IHPC 3QHTA 1WJNA 3HIZA 4KZCA 4E74A 2B3AA 1P1AA 2KFJA 2M8SA 2MP2B 2REXA 3M3JA 2G45B 4OVVA 4AUQC 2JF5A 3AU5A 2KN5A 2CHWA 4GDKA 2C60A 2PE9A 3LJ3A 3PRZA 4K7SA 4BOZB 4NQLB 2KKCA 2N4FA 1WR6E 1C1YB 2L76A 1P98A 1QZEA 1V9JA 1WRDB 3PS6A 1YX6B 3A4SC 4GGQA 1SIFA 4MJSA 5AZGA 1H8CA 4ICVA 1WZ0A 2FAZA 3JSVA 4GOCA 1V2YA 5E6OA 3V6EB 4ICUA 4GDKB 2V1YA 2KTRA 4DDID 1G6JA 3DBSA 4DXAB 1P3QU 3QK0A 2LI5A 2WYQA 3NHEB 3ZNHB 3DVGX 4RM8A 3S2AA 4IM2A 3UINB 3UQAA 1WY8A 1EF5A 1LM8B 4PS3A 5AZHA 4JGHB 1Q1OA 2LUEA 1WJ4A 3PHWB 4A3OA 3L10B 5LXIB 2AYOB 1NDDA 2XBBC 1WH3A 2FNJB 2KFKB 1U4AA 2PE6B 1Z2MA 2NPTB 4IWOA 1VD2A 3GZNI 2RR9A 1GJZA 4WJPA 3ML9A 1XT9B 2KX3A 2KJ6A 3EHVA 4GDLB 1Q5WB 4TKNA 3APFA 3BINA 4NPNA 3TJPA 1UGMA 5IA7A 4JL9A 4JLCA 4LDTD 4A3PA 1WM3A 4NAWA 1Z5SB 3M62B 3EC8A 5BO4B 1V5TA 1R4MI 2RD0A 3EFUA 4ZRJA 4LDTB 4PS7A 3VH4B 2DAFA 1AARA 4KSLC 3R7QA 1OTRB 1GG3A 4TV3A 3V60A 2L7RA 4JQWC 1GUAB 4FJVB 3W1SC 3P2BA 5AEKB 2ZJDA 4IM3A 4E71A 4XX5A 2J0MA 4ZRIA 3IG3A 3X23A 3DPDA 5CHVC 2KWUB 4W9IA 2FCQA 2DYOA 1WF9A 2L00B 3ZKJC 1NBFC 2C7HA 3R3MA 2NR2A 3SD5A 4ANWA 3CSFA 1WX7A 4W9FA 3TBLD 5J2RA 4B6WA 4IWQA 3CMMB 1KLVA 2YLMA 3H7PA 3PREA 2ZCBA 2R2OA 4FLHA 4DHZB 3PHXB 3UQBA 2ZVOA 4F8CB 3ZW3A 4TUUA 2LGYA 1OGWA 1V5OA 3PT2B 5HKHA 3ZVVA 2DZMA 2FUHB 2HE7A 2FCNA 2KQ7A 2N9PC 3PRMB 4DDGD 3N32A 2N9XA 5C23A 1RFAA 4GIVA 3KW5B 1WYWB 4CHKA 3DVNV 2DAJA 4KDIC 3PSEB 3VFKA 4EUTA 1UZXB 2BKRB 2HTHA 2WX0A 2L3ZA 2DZJA 2GBRA 1WMHA 1X1MA 3JW0X 2LZ6A 4CO7A 2JRHA 2DX5B 2LGXA 2MW5A 4GU2A 3ZO5B 4W9EA 5D2MB 2KDIA 3M95A 4IW0A 3QIJA 3TL5A 1E7UA 4DHJD 4KZ0A 4FJZA 1UBIA 4WJNA 2I1KA 2JZZA 2MWSB 5GMVA 1LXDA 1FXTB 2IBIB 3U30A 1L7YA 3C0RB 3QJZA 4W9CA 3ZIMA 2LXCA 4TQ1A 3KH0A 2GBMA 4KSKC 4FBJB 2D3GA 2K8HA 3M63B 1GNUA 3LDZE 1IYFA 1VCBA 4N9F4 2KFKA 4NNJB 1XD3B 1EUVB 2Z0DB 5C1ZA 1RAXA 4AJWA 3ZRFA 2Y5BB 5JHBA 1UELA 3SHQA 4AJYB 1WXMA 4G11A 2DHZA 1MG8A 2QHOA 3L0WB 2KJRA 3U7DA 3RD2A 3ZNZB 4II3B 3WAMA 1YX5B 3VDZA 2KJHB 3GOEA 4FHKA 4KVGB 2O6VA 3QC8B 2NBWB 3L17A 4IG7B 2KMAA 1P9DU 5JHAA 2GMIC 3QA8A 2EMTA 1I42A 1LQBA 2IO0B 2J0KA 4WJQA 2KWVB 1WE7A 1E8XA 1Q0WB 2KOXA 3BY4B 2JXXA 3KVFB 3WAOA 4ANUA 3QWZB 3NY5A 4FULA 4WWOA 4NJ7A 5KHQA 5LXHA 1WGDA 2K6DB 3ECIA 2AWTA 2JUOA 2DZIA 3DBHI 3HM3A 4GN1A 4MH0E 3JSVB 1V86A 3HM6X 1WXAA 2BF8B 4BKGA 4NQKE 2UYZB 3UIPB 4MGYE 4FN2A 1V6EA 1GC6A 4BBNC 3HHMA 1KOTA 5AZFA 5G55A 3ZDTA 2GBKA 3CF6E 3CSTA 4ZDVA 1P0RA 2MBOA 2W9NA 4AWJA 2A5UA 2KVRA 2G3QB 4RM9A 4M0WB 4BBNF 3A33B 2FIDA 3KYDD 1F9JA 2MCNB 2KDBA 4M8NA 2G4DB 4IM0A 5EDSA 4AOFA 2BPSA 2LASA 5DCNA 1WIAA 4W9JA 3I3TB 4WQOB 2MBEA 3TCAA 3NOBA 1E7VA 3L13A 1R4NI 2N7DA 5J18A 2LGDA 2N7EA 4ZYNA 3KYCD 4HCPB 3APDA 4NAWB 2ZEQA 2PJHA 1XQQA 2LJ5A 4OVUA 1OEYA 4BKSD 4WJOA 1LFDA 2KD0A 2LXAA 2ZPYA 1D3ZA 2LVOA 4W9GA 4BKSA 3R7RA 1UD7A 4MELA 2LRUA 2MBHA 4EKUA 4NJ6A 4W9KA 4KIKA 2MQJA 1E90A 2AEHA 2N1VA 2K6QA 3DVGY 2V4LA 3B1LX 5CTRC 3DCGA 2M17A 2RPQA 4B95A 4HK2A 5JZEB 2AL3A 3RZFA 1WX9A 5CHWA 3A9KB 4LCDE 5TR5A 2LRWA 3QX1A 3VTVA 4I6NB 3H7PB 3A1QA 3B0AA 3QCAA 4HPLB 3HK0A 4HJKA 2BYVE 2Z0EB 5DPRA 2IO2B 3R66C 4NY0A 2K25A 1ZKHA 3RCZA 1IP9A 3DVNU 2CKHB 1SGHA 2XK5A 3WANA 2LVPA 1V80A 4EOYA 2MA9B 1WR1A 2GBJA 4K1RB 2YVCA 1HE8A 1GC7A 3ONSA 2CHXA 2M0XA 1KM7A 2CR5A 3H1UA 3DDCB 4WAAA 3SU8X 2C9WB 4PS8A 3VUXA 2KTRB 1E8YA 4W9DA 2V3SA 1WMHB 1M94A 2BKFA 3VVWB 3PRPB 3H6NA 1TBEA 4K81A 2C5LC 3OJ3A 4II2B 3A4RA 4TQ0A 3VTUA 1YD8U 3D32A 4ANXA 4KDLB 5CHFA 1RRBA 2D2QA 2WX1A 5FR6A 2ASQA 2VRRB 4KV2A 4EZKA 2KO3A 4F7ZA 1CMXB 2KLGA 2FIFA 2N9EB 2NBVB 3PGEA 3W1SA 1A5RA 3V62A 2UWQA 4DHJB 1NI2A 4GMVA 5JH5C 2J7QB 3PV1A 1BT0A 3ZLZA 3O65B 3MTNB 3ALBA 1EO6A 2KXJA 2KDEB 2KX0A 2XEWA 1WFYA 2LD9A 2RGFA 4J6IA 2IY0B 4WWPA 2OJRA 1J19A 3DQVA 3NZSA 2ZZPB 3IVFA 4I6PA 3A1QB 4IWPA 4A20A
chains in the Genus database with same CATH superfamily
2LVQA 2WXRA 3TEXA 3FC4A 3V61A 2IYDB 4FXCA 2MRPA 1QOAA 4DBGA 2LHDA 1I4RA 4MGIE 1KH0A 2WWZA 1ZE3D 1H4RA 2ZNVC 2K3UA 5DPTA 3W1YA 1I35A 4KKJA 3TSSA 1E5WA 1WRIA 1J0GA 1ACCA 3GE8C 2KC1A 2ACZB 1E8ZA 4O1NA 3IFWB 1JALA 3FILA 3RMKC 2SAKA 2FCSA 3H9DA 3CIRB 1JWMD 3KUDB 2MX2A 2D3AA 2LHEA 4WWNA 3MC9A 3EECA 1E8WA 1WSPA 3HVDA 3ZXRA 1HTQA 3OLMD 1JWSD 4ZRKA 1IBXA 1WGHA 4J3OD 1QLBB 3NVYA 2BYFA 2LWPA 2M1MA 4Q2JA 5BYRA 4HDOA 1TZ1A 2J0JA 1I4HA 4IUMB 1NI3A 1FO4A 4LJOB 2BGFA 3X0WA 4GLSC 2G4SA 2W55A 4RCOA 3VQIA 1WI0A 3ZNID 4HWIB 2BS4B 1EF1A 2N1WA 4BKTA 1IPGA 2QJLA 1K53A 3E9SA 2L0TA 2IO1B 1FCLA 3Q8FA 5D7GA 1WGGA 1IGCA 3AU4A 4DK5A 1ZW7A 1SE2A 1DOXA 4OHJA 2R2QA 2FCMA 2INPE 4DHZE 3NRZA 4OVZA 2GOWA 1K52A 2IPKD 1OQQA 3H7SA 1MHXA 2D11A 2EMSA 2JZPA 4KGTA 4EFOA 2O6VB 4MDKE 2EELA 3L54A 4RF0A 3Q8BA 3W5VB 4RGNA 3B08A 3MHSD 2AQ3B 2D5GA 5EE9A 2RSUA 4EEWA 2K39A 4MEMA 1YQ4B 4WIPA 2ZVNA 2JWZA 2KK8A 3IHPC 4TMAB 1WJNA 2HDEA 3O13A 3BVMA 4OVVA 1DYQA 4HPPA 2WS3B 4GDKA 2PE9A 2D3BA 4NQLB 1QZEA 4GGQA 4MJSA 1QQRA 1V1PB 3Q3OC 4ICVA 2FAZA 4ICUA 2V1YA 2KTRA 3P63A 1L4ZB 4DDID 1G6JA 4RFBA 2RDGA 2N7JA 1P3QU 2LI5A 1JRPA 3DVGX 2WDRB 4IM2A 3TEYA 4P1BC 1WY8A 1LM8B 2LUEA 1WJ4A 3PHWB 3L10B 2MJDA 1NDDA 1WH3A 2FNJB 4ACFA 1QKZA 1E7PB 3URYA 1VD2A 3GZNI 4WJPA 2Y5CA 1XO3A 2GI9A 3EHVA 1T0QC 1Q5WB 4A6QA 4NPNA 1PFDA 2RPVA 4JL9A 3M62B 3EC8A 1GB4A 1V5TA 3AE3B 2RD0A 3EFUA 3VH4B 1KLGD 1FNWA 2WXGA 3W1SC 4YTMB 4E71A 3IG3A 5IP4D 2KWUB 4XGAB 2L00B 3ZKJC 3KWLA 4ANWA 4MM3B 2PTLA 4IWQA 3CMMB 1N5WA 2R2OA 3BYTB 4FLHA 4TUUA 2W3SA 4OW0A 3PT2B 2DZMA 1XLQA 2FUHB 1YN4A 2JU6X 2FCNA 2KQ7A 4DDGD 1XXGA 3N32A 2N9XA 4GIVA 3IT6B 4WURA 4CHKA 4KDIC 2NTTA 4ZHOA 3PSEB 3VFKA 4EUTA 2HTHA 2IGDA 4YTNB 2DZJA 1X1MA 3JW0X 4BZAA 4GU2A 3ZO5B 2KDIA 3M95A 1KTKA 2MWSB 1LXDA 1JMLA 3PO0A 4KSKC 4LLGM 4N9F4 1XD3B 2HJ1A 1UUPA 1RYJA 1ENFA 4XE0A 3T3OA 5JHBA 1P7FA 3RNBC 4WH4A 2DHZA 1MG8A 3ZNZB 3VDZA 3DBRB 4FHKA 1J7CA 1PGBA 3QC8B 1XLOA 4DXFA 2KMAA 1P9DU 5JHAA 4C00A 4IOIE 3ETRA 2KWVB 4HRSA 1Q0WB 4XYCA 2WNMA 3BY4B 2JXXA 3WAOA 3NY5A 4LNKA 5BMHA 2DLBA 2L32A 3ECIA 2AWTA 3AEFB 4BKGA 3JSVB 3N1YC 4REZA 3BK1A 1VZ8A 4MGYE 5AUIA 1GC6A 3R2TA 4NAMA 4OZBA 1TS5A 3HUIA 2KVRA 3NVZA 2G3QB 2FIDA 1F9JA 2MCNB 2G4DB 1D5XC 2LGIA 4IM0A 4AOFA 1AN8A 3I9V1 1MHHE 3NOBA 1AWDA 1HEZE 1J7BA 3RNFC 2ZEQA 1C78A 4WQMA 3E56A 2KD0A 2LXAA 4K3BA 1XEEA 2ZPYA 1D3ZA 4W9GA 3RNEC 1UF0A 3N1XC 2K6QA 1AYFA 4B95A 4HK2A 4BAXA 1WX9A 2LRWA 3Q3NC 3VTVA 3P4QB 1UWXA 2Z0EB 2IO2B 1YJJA 3AE2B 4A55A 3RCZA 3DVNU 1ET6A 5LNK1 4EOYA 2N0SB 2GBJA 4C7ZA 2YVCA 3BYYB 3Q3MC 2PIAA 3SU8X 4WAAA 2C9WB 2V3NA 5C3JB 1OFFA 2VH2A 2IGGA 1K50A 4II2B 4TQ0A 4HJGE 1TS3A 3VTUA 4KGRA 3VR8B 2V0GA 2KACA 2VRRB 2R61A 4KV2A 1GOZA 4F7ZA 1PGAA 1FFVA 1FNUA 3PGEA 1I4PA 5H92C 3GE3C 1HZ5A 3ALBA 1EO6A 3MC0B 5IN7A 4C7YA 2IY0B 3ZQ4A 4XDCA 3A1QB 1Y8RC 2L05A 4EZLA 3T9LA 1FPYA 3WA0A 5L95C 1MFWA 4N6EB 1KFYB 2O6VD 2D07B 4L2YA 2CU1A 5D6JB 3AEAB 4MJSB 3JYUA 1SF0A 2HJ8A 4IDIA 1HA5A 3H8HA 3K9PB 4XC2A 2BYEA 1OQYA 5L83A 1YNTE 2QILA 1JWUD 2NCNA 4B0MA 1TTNA 2K1FA 4AP4C 4I6LB 1HXYD 2KMCA 3QARA 3K9OB 2FE8A 1D5MC 5LLIA 2JRIB 2GBNA 2ONQA 3DBLI 4AS1A 4FHJA 3AI5A 3VAWA 1FEHA 1JW9D 3PZDA 4HKZE 1S1QB 2OOBB 2CHZA 2KYWA 1MJDA 2K8CA 3P4SB 4JIOU 4QAYA 4X57B 2C7NB 1TS4A 2N9LA 4HLEA 2INDC 4HCNB 5BYQA 4MGZE 3ZYYX 2KANA 2WDTB 3W2DA 5IAAC 3T8MA 2BB5A 3A9JA 4MGKE 5MPOA 2MHJA 4W9HA 5TSSA 3VUYA 5D94A 3R8BA 5KHOA 4RGOS 2CS4A 2DZKA 1VR9A 3Q3FA 2W82A 1STEA 4MSMB 2K22A 2KVZA 1LGRA 1ZUD2 3P1MA 5IKCM 1KLUD 3Q69A 2BB6A 2KQ4X 3AXCA 1ISNA 4ANVA 4RGMA 2M4NA 3WCQA 2WXKA 3DBRI 4HPMB 2CJOA 4M02A 2QIEB 2KQSA 4MT5A 4PYZA 2NS5A 2EKIA 4KKIA 1E10A 1T6BX 2IZVB 2KLCA 1YQ3B 2L83A 2JY6A 3VXWA 3ZNGC 1C77A 2E3TA 4K7UA 4MSQB 3ZTDA 3AEGB 4US8A 2RDHA 3DOWA 2E6XA 5DPSA 3PPAA 1WZ3A 4GB9A 3MP9A 3HIZA 1WWTA 3W9CB 2KFJA 1P7EA 1QOGA 2CHWA 3LJ3A 4K7SA 1KF6B 1WR6E 2INCC 1C1YB 2L76A 5LXIB 3PS6A 3ABVB 2WXNA 4GDKB 4LTUA 1E6EB 3PZ8A 4RM8A 3ZJUA 1EF5A 4PS3A 1UGJA 4JGHB 3VRAB 3RFZB 3VR9B 2AYOB 2XBBC 1U4AA 2PKOA 1FRRA 2NPTB 5I4DA 1GJZA 2KX3A 1I4QA 4CQNA 4US9A 4TKNA 2BT6A 1K51A 1VJKA 2WDQB 4A3PA 4NAWA 1Z5SB 3OG5A 1XLPA 3FKYA 3AE7B 4LDTB 3R7QA 5D3IB 4JQWC 3P2BA 5AEKB 1EWYC 3X23A 4S0RA 1TT5B 2J42A 1SSNA 1T0RC 1WX7A 2MJEA 3H7PA 1NENB 4DHZB 2WXMA 4JE3B 3UQBA 4MH8A 4F8CB 3ZW3A 1OGWA 1V5OA 1L5PA 3KW5B 1FM0D 2DAJA 2RDBC 2BKRB 2WX0A 1VDVA 1V97A 3KLSX 2WQYB 2MW5A 1UNSA 5D2MB 1YMHE 3QIJA 1YN5A 2IBIB 2OJWA 3C0RB 4W9CA 1R4MB 4LNIA 3ZIMA 4TQ1A 3KH0A 4FBJB 2D3GA 3M63B 1GNUA 3LDZE 1VCBA 2KFKA 4OZCA 3C8YA 3AE1B 3V3XA 1RAXA 4AJWA 3ZXVA 1I4GA 5HFYA 1TZOA 1FIQA 1M4VA 3SHQA 4AJYB 3B2GA 3WAMA 4DQOC 3GOEA 4YTPB 1DOYA 3L17A 2GMIC 3QA8A 2EMTA 1I42A 3B9JA 1ZP0B 1TS2A 1ZDXA 3AN1A 2WU2B 2KOXA 1EM7A 3ZJVA 3KVFB 3MHZA 4M00A 4WWOA 2DZIA 2DWQA 1V86A 3HM6X 1WXAA 3UIPB 2UYZB 5HI1A 1MPEA 4FN2A 1VRAB 1KOTA 2W3RA 5AZFA 3ZDTA 4AWJA 4YXDB 3Q2AC 2M19A 4RM9A 1PGXA 4C4VB 2YEPF 3KYDD 1PUTA 2OHFA 4M8NA 1SE3A 3RNAC 1SEBD 1E7VA 1R4NI 1CZPA 4ZYNA 3KYCD 2BQQA 2PJHA 1OEYA 4BKSD 4WJOA 4ZRPA 5HG2A 1CJEA 2MBHA 4EKUA 3EA6A 4LNNA 4W9KA 4XWWA 2AEHA 3DVGY 2V4LA 3GS2A 2M17A 2NMQA 2RPQA 5JZEB 3RZFA 3FAHA 5CHWA 4I6NB 5JXVA 2BTEA 1FFUA 1L6VA 4HJKA 2BYVE 5DPRA 3R66C 4NY0A 3WANA 2LVPA 4HEA1 1ROEA 3RN9C 1WR1A 4IKGA 4K1RB 3ONSA 2CHXA 1ZOYB 2LGSA 2UU7A 4W9DA 4L1BA 3PRPB 3H6NA 1ZPSA 2C5LC 3OJ3A 2QSDA 3GZNB 1B9RA 3D32A 4ANXA 2V4IB 4ITKA 1L0YB 2KO3A 1F2RI 1CMXB 2N9EB 2NBVB 3AEEB 2PVOD 2PW9A 3V62A 2UWQA 1NI2A 4GMVA 2BYTA 1BT0A 3ZLZA 4ARIA 2L1AA 1WFYA 3P4RB 4J6IA 3C19A 2OJRA 3NZSA 4I6PA 4IWPA 4XDDA 3NS8A 2PPHA 3UGBB 3VH3B 3ZRCA 1E0ZA 4M8MA 2KTFA 2C7MB 2GB1A 2JZ3B 1WJ6A 1WM2A 3MFGA 1WX8A 2LJIA 1E9MA 3OJ4B 3UF8A 5CX3A 2MSED 3I63C 4BOSC 5FR3A 1YJ1A 3WAPA 3NJTA 2VZKD 3L08A 3AE5B 3OAWA 4HXDA 4GXBA 4C56C 1PYWD 4F1SA 2JYEA 2IGHA 1ZDVA 2H89B 4S17A 1NYQA 1JRUA 4G0NB 1ZXHA 3RNGC 4CYEA 1WGYA 4ASWC 2AL6A 4B0EA 2PEAA 4EZJA 4GDLA 4PYUA 1NYRA 2EKEC 1RWSA 5G2NA 1QOFA 2PLPA 1ZGUB 3ENEA 4LK0M 3CWIA 4P7IA 3SDLC 2VH1A 2HD5B 1F77A 4LNFA 1GPXA 2L8JA 4B9KA 2VZKB 3ZUNA 2MLBA 3VTWA 2CU3A 3ZDMC 2WXQA 3APCA 1J8CA 2PVGC 3JVZX 3N30A 4KIKB 2LUMA 1V1PA 4IC7B 4MM3A 2WXOA 5EE1A 1RM6C 3ZTCA 2ZNVB 1EU4A 1F0ZA 2KWCA 1FXAA 2JSVX 1WJUA 4N58A 4G50A 4YSZB 2AQ2B 3W5UB 2QEJC 3BZDB 2JWUA 3NVVA 5J17A 3RULA 2ZCCA 3KUCB 3IBEA 2A4ZA 3VUWA 4GSWA 2DENB 2MBBB 2IY1B 4FA6A 3VRBB 2KC2A 3B2FA 2IJ0A 1V49A 1WXSA 3WALA 1VZ7A 1GAQB 1C4AA 1PQSA 2V9HA 1RLFA 2J52A 2Z59B 1WYGA 1HZ6A 2L52A 3EFCA 4BFRA 2K8BA 2IO3B 2JPHA 2BVCA 3A9KA 3MJWA 1FNVA 3KUZA 3RT3B 3RYTA 3DHGC 3NG0A 3TIXA 2J53A 3QQ8B 3A9JB 3QHTA 4A90A 2KN4A 4E74A 2WP9B 2B3AA 3KWVA 4TSSA 1P1AA 2M8SA 2MP2B 1FCCC 4AUQC 2JF5A 2C60A 4A8XC 1L6UA 3PRZA 4BOZB 2KKCA 1P98A 3DWMA 1Y56A 5AZGA 1YX6B 2GLSA 1SIFA 1H8CA 1WZ0A 3U4EG 2WXLA 2QC8A 1GB1A 3U2SC 4RGTA 3IXSA 3QK0A 2WYQA 3NHEB 1TYGB 5AZHA 4A3OA 2WXIA 1TIFA 1Z2MA 4IWOA 4K3CA 1XT9B 2WDVB 2ZW1A 4USAA 3SFEB 3APFA 5IA7A 1UGMA 5HHDG 4JLCA 4LDTD 1I4XA 1WM3A 3N9YC 1VZ6A 5BO4B 5T8IA 1AARA 1OTRB 4TV3A 3V60A 2L7RA 1GUAB 1VLBA 4IM3A 4XX5A 1T5XD 3DPDA 5CHVC 4W9IA 1AW7A 1WF9A 1BUIC 3CSFA 1TKYA 3TBLD 5J2RA 1SXTA 2YLMA 3PREA 2ZCBA 3BIID 3HVZA 3AE9B 3PHXB 2LGYA 4KGSA 2WLBA 2V3PA 3PRMB 1A70A 1WYWB 3DVNV 2G9HD 1UZXB 1D4BA 1XCTL 5E6JA 4ZOHC 2GBRA 2DX5B 2LGXA 4W9EA 3J9CA 4IW0A 4DHJD 3IAS1 3TL5A 1E7UA 1QF6A 3DHIC 4KZ0A 2KMMA 4WJNA 5GMVA 3SR6A 3U30A 1L7YA 3DBLB 3QJZA 2LXCA 3GP7A 3ZJTA 1YN3A 4NJCA 1ZXIA 5C1ZA 4M0WA 1N62A 1UELA 1WXMA 2KDMA 3U7DA 3RD2A 4II3B 1YX5B 2KJHB 1FXIA 1F52A 4JX1C 4KVGB 2HTME 4N59A 5G5HA 2O6VA 2WXJA 2Y3AA 1I7HA 4IG7B 1HQRD 3EGRA 3AH7A 2H88B 3Q14C 1LQBA 2IO0B 2J0KA 3BWUD 1WE7A 1E8XA 4P1CC 5EE0A 3TEZA 4ANUA 4FULA 5KHQA 5IO9A 5LXHA 3Q8EA 3DBHI 4GN1A 2BF8B 4NQKE 1C79A 1V6EA 4BBNC 4RNAA 5G55A 2GBKA 1R4NB 3CSTA 1C76A 2MBOA 4JWSC 2A5UA 4BBNF 4M0WB 3A33B 1L0XB 4WWMA 2LASA 5DCNA 4W9JA 3I3TB 2MBEA 5FKAC 3TCAA 2N7DA 1MVKA 1N61A 3LB8C 4HCPB 3P4PB 1XQQA 2LJ5A 4OVUA 2JYTA 3R2IA 1LFDA 5AUKA 1N60A 1PDXA 4PT5A 4MELA 3Q8AA 1T0SC 3N20C 1E90A 4HROA 2N1VA 3LYYA 3B1LX 3AECB 3I5JC 4WAFA 3KQ4A 3A1QA 3B0AA 2LEKA 3QCAA 5EE3A 2Y5PA 2G1EA 2XK5A 3SFDB 3SEBA 1GC7A 1KM7A 2YEPB 4PS8A 4ARCA 2KTRB 1E8YA 2V3SA 2BKFA 2MJ3A 4K81A 4KX6B 2K9XA 1JCKB 1T3QA 3A4RA 4A9AA 3AEBB 3N1ZC 3U7ZA 3TUOA 1YD8U 2D2QA 2WX1A 1C4PA 2KLGA 2FIFA 2M0AA 1HTOA 2QMTA 1WXQA 1A5RA 4DHJB 3O65B 2JQRB 2KDEB 2KX0A 2XEWA 2RGFA 3DQVA 3IVFA 4A20A 1OEYJ 2MH7A 5DPWA 4K7WA 1BXTA 1QILA 1WGRA 4URKA 2O2VA 3AE4B 4PK1A 3VHTC 3L4PA 4FJYA 1V8CA 1DGJA 2M56B 4HVBA 2PMVA 3RZWC 3ML8A 2MP2A 2D3CA 2I1JA 1TJEA 3RUIB 1SBBB 2RMMA 1UBQA 2WGSA 3V6CB 1CQVA 2BWFA 5G5GA 4LJPB 3AMZA 3OWEB 3RNCC 1ESFA 3P42A 3NZ3A 2D10A 2KDFB 3BK2A 4RMAA 4FADA 5D3DA 3PLVA 2NVUI 4H2AA 1C9FA 1TY2A 2O2VB 2OEDA 3BVGA 3AULA 3PVLA 3QAQA 2TSSA 2W54A 1IBXB 1C4CA 2DYMA 4YL8A 2BWES 2JVCA 1V81A 2MEKA 4C80A 2MBQA 2DYBA 1QOBA 2KNBA 2BBCA 4G3XB 1WE6A 3IT4B 2KHWB 4HDQA 4RH6A 1K8RB 5E6PA 3PTFC 2DBYA 1KJTA 1ET9A 1L2NA 4LNOA 2JXTA 1XF5L 2LFIA 2WXFA 3Q3JA 4DWFA 3FILB 3ZGZA 3L16A 2NPTA 1S3SG 4L23A 4E3CA 1XCQL 1N5XA 3U8ZA 3PLUA 4XZ4A 2ZW0A 4DXGA 4BVUC 4D2KA 3NZUA 3WIMA 4P6VF 5FK9C 1RFKA 1UH6A 3HRDD 2XN9C 3N3KB 2KZRA 2XK5B 1SE9A 1T0YA 1C3TA 1WXVA 4M01A 3TMPB 2NBUA 3UIOB 2JT4B 1D6EC 4W9LA 2ZPNA 3DBHB 5E6NA 1TGZB 1JQ4A 1YIWA 1JROA 1TKEA 5BMIA 2L0FA 1YQBA 1IUEA 2XNAC 4NZLB 2KT7A 3NUHB 4KZCA 2REXA 1B1ZA 2G45B 5IOIA 2GRIA 1FMAD 2KN5A 3AU5A 2NTSA 2N4FA 1Q10A 1V9JA 1WRDB 3A4SC 2N9KA 5C2TB 3JSVA 4GOCA 1V2YA 5E6OA 1TY0A 3V6EB 2AX5A 1V1OA 3DBSA 4HKQA 4DXAB 4ZHPA 1KRHA 3ZNHB 3S2AA 3UINB 3UQAA 3BVZA 1Q1OA 2KFKB 2PE6B 3MC8A 1SE4A 1YOVB 2K5PA 2RR9A 2J4XA 2X38A 3ML9A 2CJNA 2KJ6A 1D5ZC 1R7SA 4GDLB 3BINA 3TJPA 3LXFA 2WXHA 1R4MI 4ZRJA 4PS7A 2DAFA 4KSLC 1GG3A 1L4DB 4FJVB 1TKGA 3DHHC 3Q8CA 2ZJDA 4OZAA 2J0MA 4ZRIA 2FCQA 2DYOA 3MJ5A 1OQRA 1NBFC 2C7HA 3AB5A 2NR2A 3R3MA 3SD5A 4W9FA 1DOIA 4B6WA 1KLVA 1SIJA 4R3DA 1NVID 2QDFA 4ZYSA 2ZVOA 1YJIA 2INNE 3ZVVA 5HKHA 2HE7A 3EUB2 2N9PC 5C23A 1RFAA 1FRDA 2L3ZA 2WU5B 3V05A 1WMHA 2I2YA 3AE6B 2LZ6A 4CO7A 2JRHA 2IDYA 2I38A 3AE8B 2BW2A 1SJED 1EWCA 4FJZA 1UBIA 2I1KA 2JZZA 2KAJA 1FXTB 3PZ7A 2GBMA 2K8HA 3IAM1 1IYFA 4NNJB 1EUVB 2Z0DB 3RPFC 3ZRFA 4MACA 2Y5BB 4C4VA 3NS1A 4G11A 2WHIA 3RI7C 2QHOA 1JWBD 2KJRA 3L0WB 3NVWA 2JX5A 1F2RC 2NBWB 4JPSA 1L0VB 2X8XX 2K0PA 2LMCA 3AEDB 3AM9A 4WJQA 1MG4A 4YSYB 2FUG1 3QWZB 2WXPA 4NJ7A 3UI3A 1WGDA 3DWGC 2K6DB 2JUOA 3HM3A 4MH0E 2ICIA 4UDUC 1F1HA 2Z8LA 3HHMA 3GB1A 2QCZA 3CF6E 4ZDVA 1P0RA 2W9NA 1FD6A 3Q6BA 1LO5D 1JWAD 2KDBA 4YSXB 5EDSA 1N6ZA 2BPSA 1WIAA 1XLNA 4WQOB 3L13A 3TEWA 5J18A 2LGDA 2N7EA 4YT0B 5GXGB 1CK1A 3APDA 4JWUC 4NAWB 1NEKB 1UWMA 1EU3A 4YWGG 1MI0A 1N63A 4AQ7A 2LVOA 4BKSA 3R7RA 1UD7A 2LRUA 2AQ1B 1IGDA 4NJ6A 4XWTA 4KIKA 2MQJA 1SJHD 4P16A 1J7AA 5CTRC 3DCGA 2AL3A 5TR5A 3A9KB 4LCDE 3QX1A 3H7PB 2FBWB 1WGKA 5H8YE 4EE2A 4HPLB 3HK0A 2K25A 1ZKHA 1IP9A 2ON8A 2CKHB 1SGHA 3I57A 3T3NA 1V80A 2MA9B 1HE8A 2M0XA 2CR5A 3H1UA 3DDCB 3VUXA 1WMHB 1M94A 3VVWB 1TBEA 2B76B 2Q5WD 1BMLC 4KDLB 5CHFA 1RRBA 4ZRQA 2KWDA 5FR6A 5BMGA 2ASQA 4EZKA 3AV8A 2DNFA 2BS2B 2BS3B 3W1SA 3U52E 5JH5C 2J7QB 3PV1A 3MTNB 2KXJA 1SB3C 4RF1A 2LD9A 4WWPA 1J19A 2SEBD 5BYSA 2ZZPB 3M3JA 1QT9A
chains in the Genus database with same CATH topology
2LVQA 1Y8RC 3NS8A 1OEYJ 2PPHA 3UGBB 2L05A 3V61A 2IYDB 3VH3B 3ZRCA 4EZLA 4M8MA 2KTFA 3T9LA 2C7MB 2MRPA 5DPWA 4K7WA 3WA0A 4DBGA 5L95C 2JZ3B 1WGRA 1WJ6A 1WM2A 2O6VD 2D07B 2CU1A 4MGIE 5D6JB 1WX8A 2O2VA 4URKA 2WWZA 3OJ4B 1H4RA 4MJSB 2ZNVC 3JYUA 5DPTA 3UF8A 3W1YA 1I35A 5CX3A 2MSED 3VHTC 2HJ8A 4BOSC 1YJ1A 4FJYA 3WAPA 4HVBA 3L08A 3K9PB 3OAWA 4XC2A 2BYEA 3RZWC 4HXDA 4GXBA 1E5WA 1J0GA 1OQYA 3ML8A 4F1SA 2MP2A 5L83A 2I1JA 2KC1A 3RUIB 1E8ZA 2NCNA 3IFWB 1JRUA 1UBQA 4G0NB 1TTNA 2K1FA 4AP4C 3V6CB 4I6LB 2FCSA 3H9DA 2KMCA 3QARA 3K9OB 2BWFA 4YL8A 4LJPB 3KUDB 1WGYA 4ASWC 4CYEA 2MX2A 2AL6A 2PEAA 4WWNA 4EZJA 4GDLA 5LLIA 4PYUA 3EECA 2D10A 2KDFB 2JRIB 2EKEC 2GBNA 1E8WA 3DBLI 4RMAA 5G2NA 4FHJA 3AI5A 4FADA 3VAWA 3PLVA 3OLMD 2NVUI 1ZGUB 3PZDA 3ENEA 1S1QB 2OOBB 2CHZA 4ZRKA 1WGHA 2K8CA 4JIOU 4X57B 2BYFA 2LWPA 2M1MA 2O2VB 2C7NB 4P7IA 3SDLC 4HLEA 4HDOA 1TZ1A 4HCNB 2HD5B 3AULA 4MGZE 2J0JA 3PVLA 2L8JA 4B9KA 2KANA 2WDTB 3ZUNA 3QAQA 2MLBA 4IUMB 3VTWA 5IAAC 3ZDMC 3T8MA 3A9JA 2DYMA 3APCA 3N30A 2BWES 3JVZX 2JVCA 4LJOB 4MGKE 4KIKB 2BGFA 1J8CA 3X0WA 1V81A 2G4SA 2MBQA 4IC7B 3VQIA 2DYBA 4W9HA 1WI0A 2KNBA 3VUYA 4MM3A 5D94A 5KHOA 3ZNID 3ZTCA 2ZNVB 4G3XB 1WE6A 2CS4A 2KWCA 4HWIB 2DZKA 2KHWB 3Q3FA 4HDQA 1EF1A 2N1WA 4MSMB 1WJUA 4BKTA 1IPGA 1K8RB 5E6PA 3PTFC 1KJTA 1L2NA 2L0TA 4G50A 2IO1B 3AXCA 1ISNA 3Q3JA 4ANVA 5D7GA 2M4NA 4DWFA 3L16A 2NPTA 1WGGA 2ZCCA 3KUCB 3IBEA 3RULA 5J17A 1S3SG 2A4ZA 4E3CA 3AU4A 3VUWA 4DK5A 1ZW7A 4GSWA 2DENB 3U8ZA 3PLUA 2MBBB 4XZ4A 2IY1B 4FA6A 4BVUC 3DBRI 4HPMB 2KC2A 2R2QA 2FCMA 2KQSA 3NZUA 1V49A 1WXSA 3WIMA 4DHZE 3WALA 1PQSA 2NS5A 4PYZA 2GOWA 1UH6A 1RLFA 3N3KB 2Z59B 2KZRA 2XK5B 3H7SA 1SE9A 2D11A 1T0YA 2EMSA 4EFOA 1C3TA 4BFRA 2IZVB 2O6VB 2KLCA 2K8BA 1WXVA 4MDKE 2JY6A 3TMPB 3L54A 3VXWA 3ZNGC 2IO3B 2JPHA 2NBUA 3UIOB 4K7UA 4MSQB 3ZTDA 2JT4B 3B08A 3MHSD 4W9LA 2ZPNA 3A9KA 3MJWA 3KUZA 3RT3B 2RSUA 3RYTA 3DOWA 5DPSA 4EEWA 3PPAA 1TGZB 2K39A 5E6NA 1YIWA 4MEMA 1WZ3A 4GB9A 3TIXA 2L0FA 1YQBA 2ZVNA 2JWZA 2KK8A 3QQ8B 3A9JB 3IHPC 3QHTA 1WJNA 3HIZA 4KZCA 4E74A 2B3AA 1P1AA 2KFJA 2M8SA 2MP2B 2REXA 3M3JA 2G45B 4OVVA 4AUQC 2JF5A 3AU5A 2KN5A 2CHWA 4GDKA 2C60A 2PE9A 3LJ3A 3PRZA 4K7SA 4BOZB 4NQLB 2KKCA 2N4FA 1WR6E 1C1YB 2L76A 1P98A 1QZEA 1V9JA 1WRDB 3PS6A 1YX6B 3A4SC 4GGQA 1SIFA 4MJSA 5AZGA 1H8CA 4ICVA 1WZ0A 2FAZA 3JSVA 4GOCA 1V2YA 5E6OA 3V6EB 4ICUA 4GDKB 2V1YA 2KTRA 4DDID 1G6JA 3DBSA 4DXAB 1P3QU 3QK0A 2LI5A 2WYQA 3NHEB 3ZNHB 3DVGX 4RM8A 3S2AA 4IM2A 3UINB 3UQAA 1WY8A 1EF5A 1LM8B 4PS3A 5AZHA 4JGHB 1Q1OA 2LUEA 1WJ4A 3PHWB 4A3OA 3L10B 5LXIB 2AYOB 1NDDA 2XBBC 1WH3A 2FNJB 2KFKB 1U4AA 2PE6B 1Z2MA 2NPTB 4IWOA 1VD2A 3GZNI 2RR9A 1GJZA 4WJPA 3ML9A 1XT9B 2KX3A 2KJ6A 3EHVA 4GDLB 1Q5WB 4TKNA 3APFA 3BINA 4NPNA 3TJPA 1UGMA 5IA7A 4JL9A 4JLCA 4LDTD 4A3PA 1WM3A 4NAWA 1Z5SB 3M62B 3EC8A 5BO4B 1V5TA 1R4MI 2RD0A 3EFUA 4ZRJA 4LDTB 4PS7A 3VH4B 2DAFA 1AARA 4KSLC 3R7QA 1OTRB 1GG3A 4TV3A 3V60A 2L7RA 4JQWC 1GUAB 4FJVB 3W1SC 3P2BA 5AEKB 2ZJDA 4IM3A 4E71A 4XX5A 2J0MA 4ZRIA 3IG3A 3X23A 3DPDA 5CHVC 2KWUB 4W9IA 2FCQA 2DYOA 1WF9A 2L00B 3ZKJC 1NBFC 2C7HA 3R3MA 2NR2A 3SD5A 4ANWA 3CSFA 1WX7A 4W9FA 3TBLD 5J2RA 4B6WA 4IWQA 3CMMB 1KLVA 2YLMA 3H7PA 3PREA 2ZCBA 2R2OA 4FLHA 4DHZB 3PHXB 3UQBA 2ZVOA 4F8CB 3ZW3A 4TUUA 2LGYA 1OGWA 1V5OA 3PT2B 5HKHA 3ZVVA 2DZMA 2FUHB 2HE7A 2FCNA 2KQ7A 2N9PC 3PRMB 4DDGD 3N32A 2N9XA 5C23A 1RFAA 4GIVA 3KW5B 1WYWB 4CHKA 3DVNV 2DAJA 4KDIC 3PSEB 3VFKA 4EUTA 1UZXB 2BKRB 2HTHA 2WX0A 2L3ZA 2DZJA 2GBRA 1WMHA 1X1MA 3JW0X 2LZ6A 4CO7A 2JRHA 2DX5B 2LGXA 2MW5A 4GU2A 3ZO5B 4W9EA 5D2MB 2KDIA 3M95A 4IW0A 3QIJA 3TL5A 1E7UA 4DHJD 4KZ0A 4FJZA 1UBIA 4WJNA 2I1KA 2JZZA 2MWSB 5GMVA 1LXDA 1FXTB 2IBIB 3U30A 1L7YA 3C0RB 3QJZA 4W9CA 3ZIMA 2LXCA 4TQ1A 3KH0A 2GBMA 4KSKC 4FBJB 2D3GA 2K8HA 3M63B 1GNUA 3LDZE 1IYFA 1VCBA 4N9F4 2KFKA 4NNJB 1XD3B 1EUVB 2Z0DB 5C1ZA 1RAXA 4AJWA 3ZRFA 2Y5BB 5JHBA 1UELA 3SHQA 4AJYB 1WXMA 4G11A 2DHZA 1MG8A 2QHOA 3L0WB 2KJRA 3U7DA 3RD2A 3ZNZB 4II3B 3WAMA 1YX5B 3VDZA 2KJHB 3GOEA 4FHKA 4KVGB 2O6VA 3QC8B 2NBWB 3L17A 4IG7B 2KMAA 1P9DU 5JHAA 2GMIC 3QA8A 2EMTA 1I42A 1LQBA 2IO0B 2J0KA 4WJQA 2KWVB 1WE7A 1E8XA 1Q0WB 2KOXA 3BY4B 2JXXA 3KVFB 3WAOA 4ANUA 3QWZB 3NY5A 4FULA 4WWOA 4NJ7A 5KHQA 5LXHA 1WGDA 2K6DB 3ECIA 2AWTA 2JUOA 2DZIA 3DBHI 3HM3A 4GN1A 4MH0E 3JSVB 1V86A 3HM6X 1WXAA 2BF8B 4BKGA 4NQKE 2UYZB 3UIPB 4MGYE 4FN2A 1V6EA 1GC6A 4BBNC 3HHMA 1KOTA 5AZFA 5G55A 3ZDTA 2GBKA 3CF6E 3CSTA 4ZDVA 1P0RA 2MBOA 2W9NA 4AWJA 2A5UA 2KVRA 2G3QB 4RM9A 4M0WB 4BBNF 3A33B 2FIDA 3KYDD 1F9JA 2MCNB 2KDBA 4M8NA 2G4DB 4IM0A 5EDSA 4AOFA 2BPSA 2LASA 5DCNA 1WIAA 4W9JA 3I3TB 4WQOB 2MBEA 3TCAA 3NOBA 1E7VA 3L13A 1R4NI 2N7DA 5J18A 2LGDA 2N7EA 4ZYNA 3KYCD 4HCPB 3APDA 4NAWB 2ZEQA 2PJHA 1XQQA 2LJ5A 4OVUA 1OEYA 4BKSD 4WJOA 1LFDA 2KD0A 2LXAA 2ZPYA 1D3ZA 2LVOA 4W9GA 4BKSA 3R7RA 1UD7A 4MELA 2LRUA 2MBHA 4EKUA 4NJ6A 4W9KA 4KIKA 2MQJA 1E90A 2AEHA 2N1VA 2K6QA 3DVGY 2V4LA 3B1LX 5CTRC 3DCGA 2M17A 2RPQA 4B95A 4HK2A 5JZEB 2AL3A 3RZFA 1WX9A 5CHWA 3A9KB 4LCDE 5TR5A 2LRWA 3QX1A 3VTVA 4I6NB 3H7PB 3A1QA 3B0AA 3QCAA 4HPLB 3HK0A 4HJKA 2BYVE 2Z0EB 5DPRA 2IO2B 3R66C 4NY0A 2K25A 1ZKHA 3RCZA 1IP9A 3DVNU 2CKHB 1SGHA 2XK5A 3WANA 2LVPA 1V80A 4EOYA 2MA9B 1WR1A 2GBJA 4K1RB 2YVCA 1HE8A 1GC7A 3ONSA 2CHXA 2M0XA 1KM7A 2CR5A 3H1UA 3DDCB 4WAAA 3SU8X 2C9WB 4PS8A 3VUXA 2KTRB 1E8YA 4W9DA 2V3SA 1WMHB 1M94A 2BKFA 3VVWB 3PRPB 3H6NA 1TBEA 4K81A 2C5LC 3OJ3A 4II2B 3A4RA 4TQ0A 3VTUA 1YD8U 3D32A 4ANXA 4KDLB 5CHFA 1RRBA 2D2QA 2WX1A 5FR6A 2ASQA 2VRRB 4KV2A 4EZKA 2KO3A 4F7ZA 1CMXB 2KLGA 2FIFA 2N9EB 2NBVB 3PGEA 3W1SA 1A5RA 3V62A 2UWQA 4DHJB 1NI2A 4GMVA 5JH5C 2J7QB 3PV1A 1BT0A 3ZLZA 3O65B 3MTNB 3ALBA 1EO6A 2KXJA 2KDEB 2KX0A 2XEWA 1WFYA 2LD9A 2RGFA 4J6IA 2IY0B 4WWPA 2OJRA 1J19A 3DQVA 3NZSA 2ZZPB 3IVFA 4I6PA 3A1QB 4IWPA 4A20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVQ A;  1Y8R C;  3NS8 A;  1OEY J;  2PPH A;  3UGB B;  2L05 A;  3V61 A;  2IYD B;  3VH3 B;  3ZRC A;  4EZL A;  4M8M A;  2KTF A;  3T9L A;  2C7M B;  2MRP A;  5DPW A;  4K7W A;  3WA0 A;  4DBG A;  5L95 C;  2JZ3 B;  1WGR A;  1WJ6 A;  1WM2 A;  2O6V D;  2D07 B;  2CU1 A;  4MGI E;  5D6J B;  1WX8 A;  2O2V A;  4URK A;  2WWZ A;  3OJ4 B;  1H4R A;  4MJS B;  2ZNV C;  3JYU A;  5DPT A;  3UF8 A;  3W1Y A;  1I35 A;  5CX3 A;  2MSE D;  3VHT C;  2HJ8 A;  4BOS C;  1YJ1 A;  4FJY A;  3WAP A;  4HVB A;  3L08 A;  3K9P B;  3OAW A;  4XC2 A;  2BYE A;  3RZW C;  4HXD A;  4GXB A;  1E5W A;  1J0G A;  1OQY A;  3ML8 A;  4F1S A;  2MP2 A;  5L83 A;  2I1J A;  2KC1 A;  3RUI B;  1E8Z A;  2NCN A;  3IFW B;  1JRU A;  1UBQ A;  4G0N B;  1TTN A;  2K1F A;  4AP4 C;  3V6C B;  4I6L B;  2FCS A;  3H9D A;  2KMC A;  3QAR A;  3K9O B;  2BWF A;  4YL8 A;  4LJP B;  3KUD B;  1WGY A;  4ASW C;  4CYE A;  2MX2 A;  2AL6 A;  2PEA A;  4WWN A;  4EZJ A;  4GDL A;  5LLI A;  4PYU A;  3EEC A;  2D10 A;  2KDF B;  2JRI B;  2EKE C;  2GBN A;  1E8W A;  3DBL I;  4RMA A;  5G2N A;  4FHJ A;  3AI5 A;  4FAD A;  3VAW A;  3PLV A;  3OLM D;  2NVU I;  1ZGU B;  3PZD A;  3ENE A;  1S1Q B;  2OOB B;  2CHZ A;  4ZRK A;  1WGH A;  2K8C A;  4JIO U;  4X57 B;  2BYF A;  2LWP A;  2M1M A;  2O2V B;  2C7N B;  4P7I A;  3SDL C;  4HLE A;  4HDO A;  1TZ1 A;  4HCN B;  2HD5 B;  3AUL A;  4MGZ E;  2J0J A;  3PVL A;  2L8J A;  4B9K A;  2KAN A;  2WDT B;  3ZUN A;  3QAQ A;  2MLB A;  4IUM B;  3VTW A;  5IAA C;  3ZDM C;  3T8M A;  3A9J A;  2DYM A;  3APC A;  3N30 A;  2BWE S;  3JVZ X;  2JVC A;  4LJO B;  4MGK E;  4KIK B;  2BGF A;  1J8C A;  3X0W A;  1V81 A;  2G4S A;  2MBQ A;  4IC7 B;  3VQI A;  2DYB A;  4W9H A;  1WI0 A;  2KNB A;  3VUY A;  4MM3 A;  5D94 A;  5KHO A;  3ZNI D;  3ZTC A;  2ZNV B;  4G3X B;  1WE6 A;  2CS4 A;  2KWC A;  4HWI B;  2DZK A;  2KHW B;  3Q3F A;  4HDQ A;  1EF1 A;  2N1W A;  4MSM B;  1WJU A;  4BKT A;  1IPG A;  1K8R B;  5E6P A;  3PTF C;  1KJT A;  1L2N A;  2L0T A;  4G50 A;  2IO1 B;  3AXC A;  1ISN A;  3Q3J A;  4ANV A;  5D7G A;  2M4N A;  4DWF A;  3L16 A;  2NPT A;  1WGG A;  2ZCC A;  3KUC B;  3IBE A;  3RUL A;  5J17 A;  1S3S G;  2A4Z A;  4E3C A;  3AU4 A;  3VUW A;  4DK5 A;  1ZW7 A;  4GSW A;  2DEN B;  3U8Z A;  3PLU A;  2MBB B;  4XZ4 A;  2IY1 B;  4FA6 A;  4BVU C;  3DBR I;  4HPM B;  2KC2 A;  2R2Q A;  2FCM A;  2KQS A;  3NZU A;  1V49 A;  1WXS A;  3WIM A;  4DHZ E;  3WAL A;  1PQS A;  2NS5 A;  4PYZ A;  2GOW A;  1UH6 A;  1RLF A;  3N3K B;  2Z59 B;  2KZR A;  2XK5 B;  3H7S A;  1SE9 A;  2D11 A;  1T0Y A;  2EMS A;  4EFO A;  1C3T A;  4BFR A;  2IZV B;  2O6V B;  2KLC A;  2K8B A;  1WXV A;  4MDK E;  2JY6 A;  3TMP B;  3L54 A;  3VXW A;  3ZNG C;  2IO3 B;  2JPH A;  2NBU A;  3UIO B;  4K7U A;  4MSQ B;  3ZTD A;  2JT4 B;  3B08 A;  3MHS D;  4W9L A;  2ZPN A;  3A9K A;  3MJW A;  3KUZ A;  3RT3 B;  2RSU A;  3RYT A;  3DOW A;  5DPS A;  4EEW A;  3PPA A;  1TGZ B;  2K39 A;  5E6N A;  1YIW A;  4MEM A;  1WZ3 A;  4GB9 A;  3TIX A;  2L0F A;  1YQB A;  2ZVN A;  2JWZ A;  2KK8 A;  3QQ8 B;  3A9J B;  3IHP C;  3QHT A;  1WJN A;  3HIZ A;  4KZC A;  4E74 A;  2B3A A;  1P1A A;  2KFJ A;  2M8S A;  2MP2 B;  2REX A;  3M3J A;  2G45 B;  4OVV A;  4AUQ C;  2JF5 A;  3AU5 A;  2KN5 A;  2CHW A;  4GDK A;  2C60 A;  2PE9 A;  3LJ3 A;  3PRZ A;  4K7S A;  4BOZ B;  4NQL B;  2KKC A;  2N4F A;  1WR6 E;  1C1Y B;  2L76 A;  1P98 A;  1QZE A;  1V9J A;  1WRD B;  3PS6 A;  1YX6 B;  3A4S C;  4GGQ A;  1SIF A;  4MJS A;  5AZG A;  1H8C A;  4ICV A;  1WZ0 A;  2FAZ A;  3JSV A;  4GOC A;  1V2Y A;  5E6O A;  3V6E B;  4ICU A;  4GDK B;  2V1Y A;  2KTR A;  4DDI D;  1G6J A;  3DBS A;  4DXA B;  1P3Q U;  3QK0 A;  2LI5 A;  2WYQ A;  3NHE B;  3ZNH B;  3DVG X;  4RM8 A;  3S2A A;  4IM2 A;  3UIN B;  3UQA A;  1WY8 A;  1EF5 A;  1LM8 B;  4PS3 A;  5AZH A;  4JGH B;  1Q1O A;  2LUE A;  1WJ4 A;  3PHW B;  4A3O A;  3L10 B;  5LXI B;  2AYO B;  1NDD A;  2XBB C;  1WH3 A;  2FNJ B;  2KFK B;  1U4A A;  2PE6 B;  1Z2M A;  2NPT B;  4IWO A;  1VD2 A;  3GZN I;  2RR9 A;  1GJZ A;  4WJP A;  3ML9 A;  1XT9 B;  2KX3 A;  2KJ6 A;  3EHV A;  4GDL B;  1Q5W B;  4TKN A;  3APF A;  3BIN A;  4NPN A;  3TJP A;  1UGM A;  5IA7 A;  4JL9 A;  4JLC A;  4LDT D;  4A3P A;  1WM3 A;  4NAW A;  1Z5S B;  3M62 B;  3EC8 A;  5BO4 B;  1V5T A;  1R4M I;  2RD0 A;  3EFU A;  4ZRJ A;  4LDT B;  4PS7 A;  3VH4 B;  2DAF A;  1AAR A;  4KSL C;  3R7Q A;  1OTR B;  1GG3 A;  4TV3 A;  3V60 A;  2L7R A;  4JQW C;  1GUA B;  4FJV B;  3W1S C;  3P2B A;  5AEK B;  2ZJD A;  4IM3 A;  4E71 A;  4XX5 A;  2J0M A;  4ZRI A;  3IG3 A;  3X23 A;  3DPD A;  5CHV C;  2KWU B;  4W9I A;  2FCQ A;  2DYO A;  1WF9 A;  2L00 B;  3ZKJ C;  1NBF C;  2C7H A;  3R3M A;  2NR2 A;  3SD5 A;  4ANW A;  3CSF A;  1WX7 A;  4W9F A;  3TBL D;  5J2R A;  4B6W A;  4IWQ A;  3CMM B;  1KLV A;  2YLM A;  3H7P A;  3PRE A;  2ZCB A;  2R2O A;  4FLH A;  4DHZ B;  3PHX B;  3UQB A;  2ZVO A;  4F8C B;  3ZW3 A;  4TUU A;  2LGY A;  1OGW A;  1V5O A;  3PT2 B;  5HKH A;  3ZVV A;  2DZM A;  2FUH B;  2HE7 A;  2FCN A;  2KQ7 A;  2N9P C;  3PRM B;  4DDG D;  3N32 A;  2N9X A;  5C23 A;  1RFA A;  4GIV A;  3KW5 B;  1WYW B;  4CHK A;  3DVN V;  2DAJ A;  4KDI C;  3PSE B;  3VFK A;  4EUT A;  1UZX B;  2BKR B;  2HTH A;  2WX0 A;  2L3Z A;  2DZJ A;  2GBR A;  1WMH A;  1X1M A;  3JW0 X;  2LZ6 A;  4CO7 A;  2JRH A;  2DX5 B;  2LGX A;  2MW5 A;  4GU2 A;  3ZO5 B;  4W9E A;  5D2M B;  2KDI A;  3M95 A;  4IW0 A;  3QIJ A;  3TL5 A;  1E7U A;  4DHJ D;  4KZ0 A;  4FJZ A;  1UBI A;  4WJN A;  2I1K A;  2JZZ A;  2MWS B;  5GMV A;  1LXD A;  1FXT B;  2IBI B;  3U30 A;  1L7Y A;  3C0R B;  3QJZ A;  4W9C A;  3ZIM A;  2LXC A;  4TQ1 A;  3KH0 A;  2GBM A;  4KSK C;  4FBJ B;  2D3G A;  2K8H A;  3M63 B;  1GNU A;  3LDZ E;  1IYF A;  1VCB A;  4N9F 4;  2KFK A;  4NNJ B;  1XD3 B;  1EUV B;  2Z0D B;  5C1Z A;  1RAX A;  4AJW A;  3ZRF A;  2Y5B B;  5JHB A;  1UEL A;  3SHQ A;  4AJY B;  1WXM A;  4G11 A;  2DHZ A;  1MG8 A;  2QHO A;  3L0W B;  2KJR A;  3U7D A;  3RD2 A;  3ZNZ B;  4II3 B;  3WAM A;  1YX5 B;  3VDZ A;  2KJH B;  3GOE A;  4FHK A;  4KVG B;  2O6V A;  3QC8 B;  2NBW B;  3L17 A;  4IG7 B;  2KMA A;  1P9D U;  5JHA A;  2GMI C;  3QA8 A;  2EMT A;  1I42 A;  1LQB A;  2IO0 B;  2J0K A;  4WJQ A;  2KWV B;  1WE7 A;  1E8X A;  1Q0W B;  2KOX A;  3BY4 B;  2JXX A;  3KVF B;  3WAO A;  4ANU A;  3QWZ B;  3NY5 A;  4FUL A;  4WWO A;  4NJ7 A;  5KHQ A;  5LXH A;  1WGD A;  2K6D B;  3ECI A;  2AWT A;  2JUO A;  2DZI A;  3DBH I;  3HM3 A;  4GN1 A;  4MH0 E;  3JSV B;  1V86 A;  3HM6 X;  1WXA A;  2BF8 B;  4BKG A;  4NQK E;  2UYZ B;  3UIP B;  4MGY E;  4FN2 A;  1V6E A;  1GC6 A;  4BBN C;  3HHM A;  1KOT A;  5AZF A;  5G55 A;  3ZDT A;  2GBK A;  3CF6 E;  3CST A;  4ZDV A;  1P0R A;  2MBO A;  2W9N A;  4AWJ A;  2A5U A;  2KVR A;  2G3Q B;  4RM9 A;  4M0W B;  4BBN F;  3A33 B;  2FID A;  3KYD D;  1F9J A;  2MCN B;  2KDB A;  4M8N A;  2G4D B;  4IM0 A;  5EDS A;  4AOF A;  2BPS A;  2LAS A;  5DCN A;  1WIA A;  4W9J A;  3I3T B;  4WQO B;  2MBE A;  3TCA A;  3NOB A;  1E7V A;  3L13 A;  1R4N I;  2N7D A;  5J18 A;  2LGD A;  2N7E A;  4ZYN A;  3KYC D;  4HCP B;  3APD A;  4NAW B;  2ZEQ A;  2PJH A;  1XQQ A;  2LJ5 A;  4OVU A;  1OEY A;  4BKS D;  4WJO A;  1LFD A;  2KD0 A;  2LXA A;  2ZPY A;  1D3Z A;  2LVO A;  4W9G A;  4BKS A;  3R7R A;  1UD7 A;  4MEL A;  2LRU A;  2MBH A;  4EKU A;  4NJ6 A;  4W9K A;  4KIK A;  2MQJ A;  1E90 A;  2AEH A;  2N1V A;  2K6Q A;  3DVG Y;  2V4L A;  3B1L X;  5CTR C;  3DCG A;  2M17 A;  2RPQ A;  4B95 A;  4HK2 A;  5JZE B;  2AL3 A;  3RZF A;  1WX9 A;  5CHW A;  3A9K B;  4LCD E;  5TR5 A;  2LRW A;  3QX1 A;  3VTV A;  4I6N B;  3H7P B;  3A1Q A;  3B0A A;  3QCA A;  4HPL B;  3HK0 A;  4HJK A;  2BYV E;  2Z0E B;  5DPR A;  2IO2 B;  3R66 C;  4NY0 A;  2K25 A;  1ZKH A;  3RCZ A;  1IP9 A;  3DVN U;  2CKH B;  1SGH A;  2XK5 A;  3WAN A;  2LVP A;  1V80 A;  4EOY A;  2MA9 B;  1WR1 A;  2GBJ A;  4K1R B;  2YVC A;  1HE8 A;  1GC7 A;  3ONS A;  2CHX A;  2M0X A;  1KM7 A;  2CR5 A;  3H1U A;  3DDC B;  4WAA A;  3SU8 X;  2C9W B;  4PS8 A;  3VUX A;  2KTR B;  1E8Y A;  4W9D A;  2V3S A;  1WMH B;  1M94 A;  2BKF A;  3VVW B;  3PRP B;  3H6N A;  1TBE A;  4K81 A;  2C5L C;  3OJ3 A;  4II2 B;  3A4R A;  4TQ0 A;  3VTU A;  1YD8 U;  3D32 A;  4ANX A;  4KDL B;  5CHF A;  1RRB A;  2D2Q A;  2WX1 A;  5FR6 A;  2ASQ A;  2VRR B;  4KV2 A;  4EZK A;  2KO3 A;  4F7Z A;  1CMX B;  2KLG A;  2FIF A;  2N9E B;  2NBV B;  3PGE A;  3W1S A;  1A5R A;  3V62 A;  2UWQ A;  4DHJ B;  1NI2 A;  4GMV A;  5JH5 C;  2J7Q B;  3PV1 A;  1BT0 A;  3ZLZ A;  3O65 B;  3MTN B;  3ALB A;  1EO6 A;  2KXJ A;  2KDE B;  2KX0 A;  2XEW A;  1WFY A;  2LD9 A;  2RGF A;  4J6I A;  2IY0 B;  4WWP A;  2OJR A;  1J19 A;  3DQV A;  3NZS A;  2ZZP B;  3IVF A;  4I6P A;  3A1Q B;  4IWP A;  4A20 A; 
#chains in the Genus database with same CATH topology
 2LVQ A;  2WXR A;  3TEX A;  3FC4 A;  3V61 A;  2IYD B;  4FXC A;  2MRP A;  1QOA A;  4DBG A;  2LHD A;  1I4R A;  4MGI E;  1KH0 A;  2WWZ A;  1ZE3 D;  1H4R A;  2ZNV C;  2K3U A;  5DPT A;  3W1Y A;  1I35 A;  4KKJ A;  3TSS A;  1E5W A;  1WRI A;  1J0G A;  1ACC A;  3GE8 C;  2KC1 A;  2ACZ B;  1E8Z A;  4O1N A;  3IFW B;  1JAL A;  3FIL A;  3RMK C;  2SAK A;  2FCS A;  3H9D A;  3CIR B;  1JWM D;  3KUD B;  2MX2 A;  2D3A A;  2LHE A;  4WWN A;  3MC9 A;  3EEC A;  1E8W A;  1WSP A;  3HVD A;  3ZXR A;  1HTQ A;  3OLM D;  1JWS D;  4ZRK A;  1IBX A;  1WGH A;  4J3O D;  1QLB B;  3NVY A;  2BYF A;  2LWP A;  2M1M A;  4Q2J A;  5BYR A;  4HDO A;  1TZ1 A;  2J0J A;  1I4H A;  4IUM B;  1NI3 A;  1FO4 A;  4LJO B;  2BGF A;  3X0W A;  4GLS C;  2G4S A;  2W55 A;  4RCO A;  3VQI A;  1WI0 A;  3ZNI D;  4HWI B;  2BS4 B;  1EF1 A;  2N1W A;  4BKT A;  1IPG A;  2QJL A;  1K53 A;  3E9S A;  2L0T A;  2IO1 B;  1FCL A;  3Q8F A;  5D7G A;  1WGG A;  1IGC A;  3AU4 A;  4DK5 A;  1ZW7 A;  1SE2 A;  1DOX A;  4OHJ A;  2R2Q A;  2FCM A;  2INP E;  4DHZ E;  3NRZ A;  4OVZ A;  2GOW A;  1K52 A;  2IPK D;  1OQQ A;  3H7S A;  1MHX A;  2D11 A;  2EMS A;  2JZP A;  4KGT A;  4EFO A;  2O6V B;  4MDK E;  2EEL A;  3L54 A;  4RF0 A;  3Q8B A;  3W5V B;  4RGN A;  3B08 A;  3MHS D;  2AQ3 B;  2D5G A;  5EE9 A;  2RSU A;  4EEW A;  2K39 A;  4MEM A;  1YQ4 B;  4WIP A;  2ZVN A;  2JWZ A;  2KK8 A;  3IHP C;  4TMA B;  1WJN A;  2HDE A;  3O13 A;  3BVM A;  4OVV A;  1DYQ A;  4HPP A;  2WS3 B;  4GDK A;  2PE9 A;  2D3B A;  4NQL B;  1QZE A;  4GGQ A;  4MJS A;  1QQR A;  1V1P B;  3Q3O C;  4ICV A;  2FAZ A;  4ICU A;  2V1Y A;  2KTR A;  3P63 A;  1L4Z B;  4DDI D;  1G6J A;  4RFB A;  2RDG A;  2N7J A;  1P3Q U;  2LI5 A;  1JRP A;  3DVG X;  2WDR B;  4IM2 A;  3TEY A;  4P1B C;  1WY8 A;  1LM8 B;  2LUE A;  1WJ4 A;  3PHW B;  3L10 B;  2MJD A;  1NDD A;  1WH3 A;  2FNJ B;  4ACF A;  1QKZ A;  1E7P B;  3URY A;  1VD2 A;  3GZN I;  4WJP A;  2Y5C A;  1XO3 A;  2GI9 A;  3EHV A;  1T0Q C;  1Q5W B;  4A6Q A;  4NPN A;  1PFD A;  2RPV A;  4JL9 A;  3M62 B;  3EC8 A;  1GB4 A;  1V5T A;  3AE3 B;  2RD0 A;  3EFU A;  3VH4 B;  1KLG D;  1FNW A;  2WXG A;  3W1S C;  4YTM B;  4E71 A;  3IG3 A;  5IP4 D;  2KWU B;  4XGA B;  2L00 B;  3ZKJ C;  3KWL A;  4ANW A;  4MM3 B;  2PTL A;  4IWQ A;  3CMM B;  1N5W A;  2R2O A;  3BYT B;  4FLH A;  4TUU A;  2W3S A;  4OW0 A;  3PT2 B;  2DZM A;  1XLQ A;  2FUH B;  1YN4 A;  2JU6 X;  2FCN A;  2KQ7 A;  4DDG D;  1XXG A;  3N32 A;  2N9X A;  4GIV A;  3IT6 B;  4WUR A;  4CHK A;  4KDI C;  2NTT A;  4ZHO A;  3PSE B;  3VFK A;  4EUT A;  2HTH A;  2IGD A;  4YTN B;  2DZJ A;  1X1M A;  3JW0 X;  4BZA A;  4GU2 A;  3ZO5 B;  2KDI A;  3M95 A;  1KTK A;  2MWS B;  1LXD A;  1JML A;  3PO0 A;  4KSK C;  4LLG M;  4N9F 4;  1XD3 B;  2HJ1 A;  1UUP A;  1RYJ A;  1ENF A;  4XE0 A;  3T3O A;  5JHB A;  1P7F A;  3RNB C;  4WH4 A;  2DHZ A;  1MG8 A;  3ZNZ B;  3VDZ A;  3DBR B;  4FHK A;  1J7C A;  1PGB A;  3QC8 B;  1XLO A;  4DXF A;  2KMA A;  1P9D U;  5JHA A;  4C00 A;  4IOI E;  3ETR A;  2KWV B;  4HRS A;  1Q0W B;  4XYC A;  2WNM A;  3BY4 B;  2JXX A;  3WAO A;  3NY5 A;  4LNK A;  5BMH A;  2DLB A;  2L32 A;  3ECI A;  2AWT A;  3AEF B;  4BKG A;  3JSV B;  3N1Y C;  4REZ A;  3BK1 A;  1VZ8 A;  4MGY E;  5AUI A;  1GC6 A;  3R2T A;  4NAM A;  4OZB A;  1TS5 A;  3HUI A;  2KVR A;  3NVZ A;  2G3Q B;  2FID A;  1F9J A;  2MCN B;  2G4D B;  1D5X C;  2LGI A;  4IM0 A;  4AOF A;  1AN8 A;  3I9V 1;  1MHH E;  3NOB A;  1AWD A;  1HEZ E;  1J7B A;  3RNF C;  2ZEQ A;  1C78 A;  4WQM A;  3E56 A;  2KD0 A;  2LXA A;  4K3B A;  1XEE A;  2ZPY A;  1D3Z A;  4W9G A;  3RNE C;  1UF0 A;  3N1X C;  2K6Q A;  1AYF A;  4B95 A;  4HK2 A;  4BAX A;  1WX9 A;  2LRW A;  3Q3N C;  3VTV A;  3P4Q B;  1UWX A;  2Z0E B;  2IO2 B;  1YJJ A;  3AE2 B;  4A55 A;  3RCZ A;  3DVN U;  1ET6 A;  5LNK 1;  4EOY A;  2N0S B;  2GBJ A;  4C7Z A;  2YVC A;  3BYY B;  3Q3M C;  2PIA A;  3SU8 X;  4WAA A;  2C9W B;  2V3N A;  5C3J B;  1OFF A;  2VH2 A;  2IGG A;  1K50 A;  4II2 B;  4TQ0 A;  4HJG E;  1TS3 A;  3VTU A;  4KGR A;  3VR8 B;  2V0G A;  2KAC A;  2VRR B;  2R61 A;  4KV2 A;  1GOZ A;  4F7Z A;  1PGA A;  1FFV A;  1FNU A;  3PGE A;  1I4P A;  5H92 C;  3GE3 C;  1HZ5 A;  3ALB A;  1EO6 A;  3MC0 B;  5IN7 A;  4C7Y A;  2IY0 B;  3ZQ4 A;  4XDC A;  3A1Q B;  1Y8R C;  2L05 A;  4EZL A;  3T9L A;  1FPY A;  3WA0 A;  5L95 C;  1MFW A;  4N6E B;  1KFY B;  2O6V D;  2D07 B;  4L2Y A;  2CU1 A;  5D6J B;  3AEA B;  4MJS B;  3JYU A;  1SF0 A;  2HJ8 A;  4IDI A;  1HA5 A;  3H8H A;  3K9P B;  4XC2 A;  2BYE A;  1OQY A;  5L83 A;  1YNT E;  2QIL A;  1JWU D;  2NCN A;  4B0M A;  1TTN A;  2K1F A;  4AP4 C;  4I6L B;  1HXY D;  2KMC A;  3QAR A;  3K9O B;  2FE8 A;  1D5M C;  5LLI A;  2JRI B;  2GBN A;  2ONQ A;  3DBL I;  4AS1 A;  4FHJ A;  3AI5 A;  3VAW A;  1FEH A;  1JW9 D;  3PZD A;  4HKZ E;  1S1Q B;  2OOB B;  2CHZ A;  2KYW A;  1MJD A;  2K8C A;  3P4S B;  4JIO U;  4QAY A;  4X57 B;  2C7N B;  1TS4 A;  2N9L A;  4HLE A;  2IND C;  4HCN B;  5BYQ A;  4MGZ E;  3ZYY X;  2KAN A;  2WDT B;  3W2D A;  5IAA C;  3T8M A;  2BB5 A;  3A9J A;  4MGK E;  5MPO A;  2MHJ A;  4W9H A;  5TSS A;  3VUY A;  5D94 A;  3R8B A;  5KHO A;  4RGO S;  2CS4 A;  2DZK A;  1VR9 A;  3Q3F A;  2W82 A;  1STE A;  4MSM B;  2K22 A;  2KVZ A;  1LGR A;  1ZUD 2;  3P1M A;  5IKC M;  1KLU D;  3Q69 A;  2BB6 A;  2KQ4 X;  3AXC A;  1ISN A;  4ANV A;  4RGM A;  2M4N A;  3WCQ A;  2WXK A;  3DBR I;  4HPM B;  2CJO A;  4M02 A;  2QIE B;  2KQS A;  4MT5 A;  4PYZ A;  2NS5 A;  2EKI A;  4KKI A;  1E10 A;  1T6B X;  2IZV B;  2KLC A;  1YQ3 B;  2L83 A;  2JY6 A;  3VXW A;  3ZNG C;  1C77 A;  2E3T A;  4K7U A;  4MSQ B;  3ZTD A;  3AEG B;  4US8 A;  2RDH A;  3DOW A;  2E6X A;  5DPS A;  3PPA A;  1WZ3 A;  4GB9 A;  3MP9 A;  3HIZ A;  1WWT A;  3W9C B;  2KFJ A;  1P7E A;  1QOG A;  2CHW A;  3LJ3 A;  4K7S A;  1KF6 B;  1WR6 E;  2INC C;  1C1Y B;  2L76 A;  5LXI B;  3PS6 A;  3ABV B;  2WXN A;  4GDK B;  4LTU A;  1E6E B;  3PZ8 A;  4RM8 A;  3ZJU A;  1EF5 A;  4PS3 A;  1UGJ A;  4JGH B;  3VRA B;  3RFZ B;  3VR9 B;  2AYO B;  2XBB C;  1U4A A;  2PKO A;  1FRR A;  2NPT B;  5I4D A;  1GJZ A;  2KX3 A;  1I4Q A;  4CQN A;  4US9 A;  4TKN A;  2BT6 A;  1K51 A;  1VJK A;  2WDQ B;  4A3P A;  4NAW A;  1Z5S B;  3OG5 A;  1XLP A;  3FKY A;  3AE7 B;  4LDT B;  3R7Q A;  5D3I B;  4JQW C;  3P2B A;  5AEK B;  1EWY C;  3X23 A;  4S0R A;  1TT5 B;  2J42 A;  1SSN A;  1T0R C;  1WX7 A;  2MJE A;  3H7P A;  1NEN B;  4DHZ B;  2WXM A;  4JE3 B;  3UQB A;  4MH8 A;  4F8C B;  3ZW3 A;  1OGW A;  1V5O A;  1L5P A;  3KW5 B;  1FM0 D;  2DAJ A;  2RDB C;  2BKR B;  2WX0 A;  1VDV A;  1V97 A;  3KLS X;  2WQY B;  2MW5 A;  1UNS A;  5D2M B;  1YMH E;  3QIJ A;  1YN5 A;  2IBI B;  2OJW A;  3C0R B;  4W9C A;  1R4M B;  4LNI A;  3ZIM A;  4TQ1 A;  3KH0 A;  4FBJ B;  2D3G A;  3M63 B;  1GNU A;  3LDZ E;  1VCB A;  2KFK A;  4OZC A;  3C8Y A;  3AE1 B;  3V3X A;  1RAX A;  4AJW A;  3ZXV A;  1I4G A;  5HFY A;  1TZO A;  1FIQ A;  1M4V A;  3SHQ A;  4AJY B;  3B2G A;  3WAM A;  4DQO C;  3GOE A;  4YTP B;  1DOY A;  3L17 A;  2GMI C;  3QA8 A;  2EMT A;  1I42 A;  3B9J A;  1ZP0 B;  1TS2 A;  1ZDX A;  3AN1 A;  2WU2 B;  2KOX A;  1EM7 A;  3ZJV A;  3KVF B;  3MHZ A;  4M00 A;  4WWO A;  2DZI A;  2DWQ A;  1V86 A;  3HM6 X;  1WXA A;  3UIP B;  2UYZ B;  5HI1 A;  1MPE A;  4FN2 A;  1VRA B;  1KOT A;  2W3R A;  5AZF A;  3ZDT A;  4AWJ A;  4YXD B;  3Q2A C;  2M19 A;  4RM9 A;  1PGX A;  4C4V B;  2YEP F;  3KYD D;  1PUT A;  2OHF A;  4M8N A;  1SE3 A;  3RNA C;  1SEB D;  1E7V A;  1R4N I;  1CZP A;  4ZYN A;  3KYC D;  2BQQ A;  2PJH A;  1OEY A;  4BKS D;  4WJO A;  4ZRP A;  5HG2 A;  1CJE A;  2MBH A;  4EKU A;  3EA6 A;  4LNN A;  4W9K A;  4XWW A;  2AEH A;  3DVG Y;  2V4L A;  3GS2 A;  2M17 A;  2NMQ A;  2RPQ A;  5JZE B;  3RZF A;  3FAH A;  5CHW A;  4I6N B;  5JXV A;  2BTE A;  1FFU A;  1L6V A;  4HJK A;  2BYV E;  5DPR A;  3R66 C;  4NY0 A;  3WAN A;  2LVP A;  4HEA 1;  1ROE A;  3RN9 C;  1WR1 A;  4IKG A;  4K1R B;  3ONS A;  2CHX A;  1ZOY B;  2LGS A;  2UU7 A;  4W9D A;  4L1B A;  3PRP B;  3H6N A;  1ZPS A;  2C5L C;  3OJ3 A;  2QSD A;  3GZN B;  1B9R A;  3D32 A;  4ANX A;  2V4I B;  4ITK A;  1L0Y B;  2KO3 A;  1F2R I;  1CMX B;  2N9E B;  2NBV B;  3AEE B;  2PVO D;  2PW9 A;  3V62 A;  2UWQ A;  1NI2 A;  4GMV A;  2BYT A;  1BT0 A;  3ZLZ A;  4ARI A;  2L1A A;  1WFY A;  3P4R B;  4J6I A;  3C19 A;  2OJR A;  3NZS A;  4I6P A;  4IWP A;  4XDD A;  3NS8 A;  2PPH A;  3UGB B;  3VH3 B;  3ZRC A;  1E0Z A;  4M8M A;  2KTF A;  2C7M B;  2GB1 A;  2JZ3 B;  1WJ6 A;  1WM2 A;  3MFG A;  1WX8 A;  2LJI A;  1E9M A;  3OJ4 B;  3UF8 A;  5CX3 A;  2MSE D;  3I63 C;  4BOS C;  5FR3 A;  1YJ1 A;  3WAP A;  3NJT A;  2VZK D;  3L08 A;  3AE5 B;  3OAW A;  4HXD A;  4GXB A;  4C56 C;  1PYW D;  4F1S A;  2JYE A;  2IGH A;  1ZDV A;  2H89 B;  4S17 A;  1NYQ A;  1JRU A;  4G0N B;  1ZXH A;  3RNG C;  4CYE A;  1WGY A;  4ASW C;  2AL6 A;  4B0E A;  2PEA A;  4EZJ A;  4GDL A;  4PYU A;  1NYR A;  2EKE C;  1RWS A;  5G2N A;  1QOF A;  2PLP A;  1ZGU B;  3ENE A;  4LK0 M;  3CWI A;  4P7I A;  3SDL C;  2VH1 A;  2HD5 B;  1F77 A;  4LNF A;  1GPX A;  2L8J A;  4B9K A;  2VZK B;  3ZUN A;  2MLB A;  3VTW A;  2CU3 A;  3ZDM C;  2WXQ A;  3APC A;  1J8C A;  2PVG C;  3JVZ X;  3N30 A;  4KIK B;  2LUM A;  1V1P A;  4IC7 B;  4MM3 A;  2WXO A;  5EE1 A;  1RM6 C;  3ZTC A;  2ZNV B;  1EU4 A;  1F0Z A;  2KWC A;  1FXA A;  2JSV X;  1WJU A;  4N58 A;  4G50 A;  4YSZ B;  2AQ2 B;  3W5U B;  2QEJ C;  3BZD B;  2JWU A;  3NVV A;  5J17 A;  3RUL A;  2ZCC A;  3KUC B;  3IBE A;  2A4Z A;  3VUW A;  4GSW A;  2DEN B;  2MBB B;  2IY1 B;  4FA6 A;  3VRB B;  2KC2 A;  3B2F A;  2IJ0 A;  1V49 A;  1WXS A;  3WAL A;  1VZ7 A;  1GAQ B;  1C4A A;  1PQS A;  2V9H A;  1RLF A;  2J52 A;  2Z59 B;  1WYG A;  1HZ6 A;  2L52 A;  3EFC A;  4BFR A;  2K8B A;  2IO3 B;  2JPH A;  2BVC A;  3A9K A;  3MJW A;  1FNV A;  3KUZ A;  3RT3 B;  3RYT A;  3DHG C;  3NG0 A;  3TIX A;  2J53 A;  3QQ8 B;  3A9J B;  3QHT A;  4A90 A;  2KN4 A;  4E74 A;  2WP9 B;  2B3A A;  3KWV A;  4TSS A;  1P1A A;  2M8S A;  2MP2 B;  1FCC C;  4AUQ C;  2JF5 A;  2C60 A;  4A8X C;  1L6U A;  3PRZ A;  4BOZ B;  2KKC A;  1P98 A;  3DWM A;  1Y56 A;  5AZG A;  1YX6 B;  2GLS A;  1SIF A;  1H8C A;  1WZ0 A;  3U4E G;  2WXL A;  2QC8 A;  1GB1 A;  3U2S C;  4RGT A;  3IXS A;  3QK0 A;  2WYQ A;  3NHE B;  1TYG B;  5AZH A;  4A3O A;  2WXI A;  1TIF A;  1Z2M A;  4IWO A;  4K3C A;  1XT9 B;  2WDV B;  2ZW1 A;  4USA A;  3SFE B;  3APF A;  5IA7 A;  1UGM A;  5HHD G;  4JLC A;  4LDT D;  1I4X A;  1WM3 A;  3N9Y C;  1VZ6 A;  5BO4 B;  5T8I A;  1AAR A;  1OTR B;  4TV3 A;  3V60 A;  2L7R A;  1GUA B;  1VLB A;  4IM3 A;  4XX5 A;  1T5X D;  3DPD A;  5CHV C;  4W9I A;  1AW7 A;  1WF9 A;  1BUI C;  3CSF A;  1TKY A;  3TBL D;  5J2R A;  1SXT A;  2YLM A;  3PRE A;  2ZCB A;  3BII D;  3HVZ A;  3AE9 B;  3PHX B;  2LGY A;  4KGS A;  2WLB A;  2V3P A;  3PRM B;  1A70 A;  1WYW B;  3DVN V;  2G9H D;  1UZX B;  1D4B A;  1XCT L;  5E6J A;  4ZOH C;  2GBR A;  2DX5 B;  2LGX A;  4W9E A;  3J9C A;  4IW0 A;  4DHJ D;  3IAS 1;  3TL5 A;  1E7U A;  1QF6 A;  3DHI C;  4KZ0 A;  2KMM A;  4WJN A;  5GMV A;  3SR6 A;  3U30 A;  1L7Y A;  3DBL B;  3QJZ A;  2LXC A;  3GP7 A;  3ZJT A;  1YN3 A;  4NJC A;  1ZXI A;  5C1Z A;  4M0W A;  1N62 A;  1UEL A;  1WXM A;  2KDM A;  3U7D A;  3RD2 A;  4II3 B;  1YX5 B;  2KJH B;  1FXI A;  1F52 A;  4JX1 C;  4KVG B;  2HTM E;  4N59 A;  5G5H A;  2O6V A;  2WXJ A;  2Y3A A;  1I7H A;  4IG7 B;  1HQR D;  3EGR A;  3AH7 A;  2H88 B;  3Q14 C;  1LQB A;  2IO0 B;  2J0K A;  3BWU D;  1WE7 A;  1E8X A;  4P1C C;  5EE0 A;  3TEZ A;  4ANU A;  4FUL A;  5KHQ A;  5IO9 A;  5LXH A;  3Q8E A;  3DBH I;  4GN1 A;  2BF8 B;  4NQK E;  1C79 A;  1V6E A;  4BBN C;  4RNA A;  5G55 A;  2GBK A;  1R4N B;  3CST A;  1C76 A;  2MBO A;  4JWS C;  2A5U A;  4BBN F;  4M0W B;  3A33 B;  1L0X B;  4WWM A;  2LAS A;  5DCN A;  4W9J A;  3I3T B;  2MBE A;  5FKA C;  3TCA A;  2N7D A;  1MVK A;  1N61 A;  3LB8 C;  4HCP B;  3P4P B;  1XQQ A;  2LJ5 A;  4OVU A;  2JYT A;  3R2I A;  1LFD A;  5AUK A;  1N60 A;  1PDX A;  4PT5 A;  4MEL A;  3Q8A A;  1T0S C;  3N20 C;  1E90 A;  4HRO A;  2N1V A;  3LYY A;  3B1L X;  3AEC B;  3I5J C;  4WAF A;  3KQ4 A;  3A1Q A;  3B0A A;  2LEK A;  3QCA A;  5EE3 A;  2Y5P A;  2G1E A;  2XK5 A;  3SFD B;  3SEB A;  1GC7 A;  1KM7 A;  2YEP B;  4PS8 A;  4ARC A;  2KTR B;  1E8Y A;  2V3S A;  2BKF A;  2MJ3 A;  4K81 A;  4KX6 B;  2K9X A;  1JCK B;  1T3Q A;  3A4R A;  4A9A A;  3AEB B;  3N1Z C;  3U7Z A;  3TUO A;  1YD8 U;  2D2Q A;  2WX1 A;  1C4P A;  2KLG A;  2FIF A;  2M0A A;  1HTO A;  2QMT A;  1WXQ A;  1A5R A;  4DHJ B;  3O65 B;  2JQR B;  2KDE B;  2KX0 A;  2XEW A;  2RGF A;  3DQV A;  3IVF A;  4A20 A;  1OEY J;  2MH7 A;  5DPW A;  4K7W A;  1BXT A;  1QIL A;  1WGR A;  4URK A;  2O2V A;  3AE4 B;  4PK1 A;  3VHT C;  3L4P A;  4FJY A;  1V8C A;  1DGJ A;  2M56 B;  4HVB A;  2PMV A;  3RZW C;  3ML8 A;  2MP2 A;  2D3C A;  2I1J A;  1TJE A;  3RUI B;  1SBB B;  2RMM A;  1UBQ A;  2WGS A;  3V6C B;  1CQV A;  2BWF A;  5G5G A;  4LJP B;  3AMZ A;  3OWE B;  3RNC C;  1ESF A;  3P42 A;  3NZ3 A;  2D10 A;  2KDF B;  3BK2 A;  4RMA A;  4FAD A;  5D3D A;  3PLV A;  2NVU I;  4H2A A;  1C9F A;  1TY2 A;  2O2V B;  2OED A;  3BVG A;  3AUL A;  3PVL A;  3QAQ A;  2TSS A;  2W54 A;  1IBX B;  1C4C A;  2DYM A;  4YL8 A;  2BWE S;  2JVC A;  1V81 A;  2MEK A;  4C80 A;  2MBQ A;  2DYB A;  1QOB A;  2KNB A;  2BBC A;  4G3X B;  1WE6 A;  3IT4 B;  2KHW B;  4HDQ A;  4RH6 A;  1K8R B;  5E6P A;  3PTF C;  2DBY A;  1KJT A;  1ET9 A;  1L2N A;  4LNO A;  2JXT A;  1XF5 L;  2LFI A;  2WXF A;  3Q3J A;  4DWF A;  3FIL B;  3ZGZ A;  3L16 A;  2NPT A;  1S3S G;  4L23 A;  4E3C A;  1XCQ L;  1N5X A;  3U8Z A;  3PLU A;  4XZ4 A;  2ZW0 A;  4DXG A;  4BVU C;  4D2K A;  3NZU A;  3WIM A;  4P6V F;  5FK9 C;  1RFK A;  1UH6 A;  3HRD D;  2XN9 C;  3N3K B;  2KZR A;  2XK5 B;  1SE9 A;  1T0Y A;  1C3T A;  1WXV A;  4M01 A;  3TMP B;  2NBU A;  3UIO B;  2JT4 B;  1D6E C;  4W9L A;  2ZPN A;  3DBH B;  5E6N A;  1TGZ B;  1JQ4 A;  1YIW A;  1JRO A;  1TKE A;  5BMI A;  2L0F A;  1YQB A;  1IUE A;  2XNA C;  4NZL B;  2KT7 A;  3NUH B;  4KZC A;  2REX A;  1B1Z A;  2G45 B;  5IOI A;  2GRI A;  1FMA D;  2KN5 A;  3AU5 A;  2NTS A;  2N4F A;  1Q10 A;  1V9J A;  1WRD B;  3A4S C;  2N9K A;  5C2T B;  3JSV A;  4GOC A;  1V2Y A;  5E6O A;  1TY0 A;  3V6E B;  2AX5 A;  1V1O A;  3DBS A;  4HKQ A;  4DXA B;  4ZHP A;  1KRH A;  3ZNH B;  3S2A A;  3UIN B;  3UQA A;  3BVZ A;  1Q1O A;  2KFK B;  2PE6 B;  3MC8 A;  1SE4 A;  1YOV B;  2K5P A;  2RR9 A;  2J4X A;  2X38 A;  3ML9 A;  2CJN A;  2KJ6 A;  1D5Z C;  1R7S A;  4GDL B;  3BIN A;  3TJP A;  3LXF A;  2WXH A;  1R4M I;  4ZRJ A;  4PS7 A;  2DAF A;  4KSL C;  1GG3 A;  1L4D B;  4FJV B;  1TKG A;  3DHH C;  3Q8C A;  2ZJD A;  4OZA A;  2J0M A;  4ZRI A;  2FCQ A;  2DYO A;  3MJ5 A;  1OQR A;  1NBF C;  2C7H A;  3AB5 A;  2NR2 A;  3R3M A;  3SD5 A;  4W9F A;  1DOI A;  4B6W A;  1KLV A;  1SIJ A;  4R3D A;  1NVI D;  2QDF A;  4ZYS A;  2ZVO A;  1YJI A;  2INN E;  3ZVV A;  5HKH A;  2HE7 A;  3EUB 2;  2N9P C;  5C23 A;  1RFA A;  1FRD A;  2L3Z A;  2WU5 B;  3V05 A;  1WMH A;  2I2Y A;  3AE6 B;  2LZ6 A;  4CO7 A;  2JRH A;  2IDY A;  2I38 A;  3AE8 B;  2BW2 A;  1SJE D;  1EWC A;  4FJZ A;  1UBI A;  2I1K A;  2JZZ A;  2KAJ A;  1FXT B;  3PZ7 A;  2GBM A;  2K8H A;  3IAM 1;  1IYF A;  4NNJ B;  1EUV B;  2Z0D B;  3RPF C;  3ZRF A;  4MAC A;  2Y5B B;  4C4V A;  3NS1 A;  4G11 A;  2WHI A;  3RI7 C;  2QHO A;  1JWB D;  2KJR A;  3L0W B;  3NVW A;  2JX5 A;  1F2R C;  2NBW B;  4JPS A;  1L0V B;  2X8X X;  2K0P A;  2LMC A;  3AED B;  3AM9 A;  4WJQ A;  1MG4 A;  4YSY B;  2FUG 1;  3QWZ B;  2WXP A;  4NJ7 A;  3UI3 A;  1WGD A;  3DWG C;  2K6D B;  2JUO A;  3HM3 A;  4MH0 E;  2ICI A;  4UDU C;  1F1H A;  2Z8L A;  3HHM A;  3GB1 A;  2QCZ A;  3CF6 E;  4ZDV A;  1P0R A;  2W9N A;  1FD6 A;  3Q6B A;  1LO5 D;  1JWA D;  2KDB A;  4YSX B;  5EDS A;  1N6Z A;  2BPS A;  1WIA A;  1XLN A;  4WQO B;  3L13 A;  3TEW A;  5J18 A;  2LGD A;  2N7E A;  4YT0 B;  5GXG B;  1CK1 A;  3APD A;  4JWU C;  4NAW B;  1NEK B;  1UWM A;  1EU3 A;  4YWG G;  1MI0 A;  1N63 A;  4AQ7 A;  2LVO A;  4BKS A;  3R7R A;  1UD7 A;  2LRU A;  2AQ1 B;  1IGD A;  4NJ6 A;  4XWT A;  4KIK A;  2MQJ A;  1SJH D;  4P16 A;  1J7A A;  5CTR C;  3DCG A;  2AL3 A;  5TR5 A;  3A9K B;  4LCD E;  3QX1 A;  3H7P B;  2FBW B;  1WGK A;  5H8Y E;  4EE2 A;  4HPL B;  3HK0 A;  2K25 A;  1ZKH A;  1IP9 A;  2ON8 A;  2CKH B;  1SGH A;  3I57 A;  3T3N A;  1V80 A;  2MA9 B;  1HE8 A;  2M0X A;  2CR5 A;  3H1U A;  3DDC B;  3VUX A;  1WMH B;  1M94 A;  3VVW B;  1TBE A;  2B76 B;  2Q5W D;  1BML C;  4KDL B;  5CHF A;  1RRB A;  4ZRQ A;  2KWD A;  5FR6 A;  5BMG A;  2ASQ A;  4EZK A;  3AV8 A;  2DNF A;  2BS2 B;  2BS3 B;  3W1S A;  3U52 E;  5JH5 C;  2J7Q B;  3PV1 A;  3MTN B;  2KXJ A;  1SB3 C;  4RF1 A;  2LD9 A;  4WWP A;  1J19 A;  2SEB D;  5BYS A;  2ZZP B;  3M3J A;  1QT9 A; 
#chains in the Genus database with same CATH homology
 2LVQ A;  1Y8R C;  3NS8 A;  1OEY J;  2PPH A;  3UGB B;  2L05 A;  3V61 A;  2IYD B;  3VH3 B;  3ZRC A;  4EZL A;  4M8M A;  2KTF A;  3T9L A;  2C7M B;  2MRP A;  5DPW A;  4K7W A;  3WA0 A;  4DBG A;  5L95 C;  2JZ3 B;  1WGR A;  1WJ6 A;  1WM2 A;  2O6V D;  2D07 B;  2CU1 A;  4MGI E;  5D6J B;  1WX8 A;  2O2V A;  4URK A;  2WWZ A;  3OJ4 B;  1H4R A;  4MJS B;  2ZNV C;  3JYU A;  5DPT A;  3UF8 A;  3W1Y A;  1I35 A;  5CX3 A;  2MSE D;  3VHT C;  2HJ8 A;  4BOS C;  1YJ1 A;  4FJY A;  3WAP A;  4HVB A;  3L08 A;  3K9P B;  3OAW A;  4XC2 A;  2BYE A;  3RZW C;  4HXD A;  4GXB A;  1E5W A;  1J0G A;  1OQY A;  3ML8 A;  4F1S A;  2MP2 A;  5L83 A;  2I1J A;  2KC1 A;  3RUI B;  1E8Z A;  2NCN A;  3IFW B;  1JRU A;  1UBQ A;  4G0N B;  1TTN A;  2K1F A;  4AP4 C;  3V6C B;  4I6L B;  2FCS A;  3H9D A;  2KMC A;  3QAR A;  3K9O B;  2BWF A;  4YL8 A;  4LJP B;  3KUD B;  1WGY A;  4ASW C;  4CYE A;  2MX2 A;  2AL6 A;  2PEA A;  4WWN A;  4EZJ A;  4GDL A;  5LLI A;  4PYU A;  3EEC A;  2D10 A;  2KDF B;  2JRI B;  2EKE C;  2GBN A;  1E8W A;  3DBL I;  4RMA A;  5G2N A;  4FHJ A;  3AI5 A;  4FAD A;  3VAW A;  3PLV A;  3OLM D;  2NVU I;  1ZGU B;  3PZD A;  3ENE A;  1S1Q B;  2OOB B;  2CHZ A;  4ZRK A;  1WGH A;  2K8C A;  4JIO U;  4X57 B;  2BYF A;  2LWP A;  2M1M A;  2O2V B;  2C7N B;  4P7I A;  3SDL C;  4HLE A;  4HDO A;  1TZ1 A;  4HCN B;  2HD5 B;  3AUL A;  4MGZ E;  2J0J A;  3PVL A;  2L8J A;  4B9K A;  2KAN A;  2WDT B;  3ZUN A;  3QAQ A;  2MLB A;  4IUM B;  3VTW A;  5IAA C;  3ZDM C;  3T8M A;  3A9J A;  2DYM A;  3APC A;  3N30 A;  2BWE S;  3JVZ X;  2JVC A;  4LJO B;  4MGK E;  4KIK B;  2BGF A;  1J8C A;  3X0W A;  1V81 A;  2G4S A;  2MBQ A;  4IC7 B;  3VQI A;  2DYB A;  4W9H A;  1WI0 A;  2KNB A;  3VUY A;  4MM3 A;  5D94 A;  5KHO A;  3ZNI D;  3ZTC A;  2ZNV B;  4G3X B;  1WE6 A;  2CS4 A;  2KWC A;  4HWI B;  2DZK A;  2KHW B;  3Q3F A;  4HDQ A;  1EF1 A;  2N1W A;  4MSM B;  1WJU A;  4BKT A;  1IPG A;  1K8R B;  5E6P A;  3PTF C;  1KJT A;  1L2N A;  2L0T A;  4G50 A;  2IO1 B;  3AXC A;  1ISN A;  3Q3J A;  4ANV A;  5D7G A;  2M4N A;  4DWF A;  3L16 A;  2NPT A;  1WGG A;  2ZCC A;  3KUC B;  3IBE A;  3RUL A;  5J17 A;  1S3S G;  2A4Z A;  4E3C A;  3AU4 A;  3VUW A;  4DK5 A;  1ZW7 A;  4GSW A;  2DEN B;  3U8Z A;  3PLU A;  2MBB B;  4XZ4 A;  2IY1 B;  4FA6 A;  4BVU C;  3DBR I;  4HPM B;  2KC2 A;  2R2Q A;  2FCM A;  2KQS A;  3NZU A;  1V49 A;  1WXS A;  3WIM A;  4DHZ E;  3WAL A;  1PQS A;  2NS5 A;  4PYZ A;  2GOW A;  1UH6 A;  1RLF A;  3N3K B;  2Z59 B;  2KZR A;  2XK5 B;  3H7S A;  1SE9 A;  2D11 A;  1T0Y A;  2EMS A;  4EFO A;  1C3T A;  4BFR A;  2IZV B;  2O6V B;  2KLC A;  2K8B A;  1WXV A;  4MDK E;  2JY6 A;  3TMP B;  3L54 A;  3VXW A;  3ZNG C;  2IO3 B;  2JPH A;  2NBU A;  3UIO B;  4K7U A;  4MSQ B;  3ZTD A;  2JT4 B;  3B08 A;  3MHS D;  4W9L A;  2ZPN A;  3A9K A;  3MJW A;  3KUZ A;  3RT3 B;  2RSU A;  3RYT A;  3DOW A;  5DPS A;  4EEW A;  3PPA A;  1TGZ B;  2K39 A;  5E6N A;  1YIW A;  4MEM A;  1WZ3 A;  4GB9 A;  3TIX A;  2L0F A;  1YQB A;  2ZVN A;  2JWZ A;  2KK8 A;  3QQ8 B;  3A9J B;  3IHP C;  3QHT A;  1WJN A;  3HIZ A;  4KZC A;  4E74 A;  2B3A A;  1P1A A;  2KFJ A;  2M8S A;  2MP2 B;  2REX A;  3M3J A;  2G45 B;  4OVV A;  4AUQ C;  2JF5 A;  3AU5 A;  2KN5 A;  2CHW A;  4GDK A;  2C60 A;  2PE9 A;  3LJ3 A;  3PRZ A;  4K7S A;  4BOZ B;  4NQL B;  2KKC A;  2N4F A;  1WR6 E;  1C1Y B;  2L76 A;  1P98 A;  1QZE A;  1V9J A;  1WRD B;  3PS6 A;  1YX6 B;  3A4S C;  4GGQ A;  1SIF A;  4MJS A;  5AZG A;  1H8C A;  4ICV A;  1WZ0 A;  2FAZ A;  3JSV A;  4GOC A;  1V2Y A;  5E6O A;  3V6E B;  4ICU A;  4GDK B;  2V1Y A;  2KTR A;  4DDI D;  1G6J A;  3DBS A;  4DXA B;  1P3Q U;  3QK0 A;  2LI5 A;  2WYQ A;  3NHE B;  3ZNH B;  3DVG X;  4RM8 A;  3S2A A;  4IM2 A;  3UIN B;  3UQA A;  1WY8 A;  1EF5 A;  1LM8 B;  4PS3 A;  5AZH A;  4JGH B;  1Q1O A;  2LUE A;  1WJ4 A;  3PHW B;  4A3O A;  3L10 B;  5LXI B;  2AYO B;  1NDD A;  2XBB C;  1WH3 A;  2FNJ B;  2KFK B;  1U4A A;  2PE6 B;  1Z2M A;  2NPT B;  4IWO A;  1VD2 A;  3GZN I;  2RR9 A;  1GJZ A;  4WJP A;  3ML9 A;  1XT9 B;  2KX3 A;  2KJ6 A;  3EHV A;  4GDL B;  1Q5W B;  4TKN A;  3APF A;  3BIN A;  4NPN A;  3TJP A;  1UGM A;  5IA7 A;  4JL9 A;  4JLC A;  4LDT D;  4A3P A;  1WM3 A;  4NAW A;  1Z5S B;  3M62 B;  3EC8 A;  5BO4 B;  1V5T A;  1R4M I;  2RD0 A;  3EFU A;  4ZRJ A;  4LDT B;  4PS7 A;  3VH4 B;  2DAF A;  1AAR A;  4KSL C;  3R7Q A;  1OTR B;  1GG3 A;  4TV3 A;  3V60 A;  2L7R A;  4JQW C;  1GUA B;  4FJV B;  3W1S C;  3P2B A;  5AEK B;  2ZJD A;  4IM3 A;  4E71 A;  4XX5 A;  2J0M A;  4ZRI A;  3IG3 A;  3X23 A;  3DPD A;  5CHV C;  2KWU B;  4W9I A;  2FCQ A;  2DYO A;  1WF9 A;  2L00 B;  3ZKJ C;  1NBF C;  2C7H A;  3R3M A;  2NR2 A;  3SD5 A;  4ANW A;  3CSF A;  1WX7 A;  4W9F A;  3TBL D;  5J2R A;  4B6W A;  4IWQ A;  3CMM B;  1KLV A;  2YLM A;  3H7P A;  3PRE A;  2ZCB A;  2R2O A;  4FLH A;  4DHZ B;  3PHX B;  3UQB A;  2ZVO A;  4F8C B;  3ZW3 A;  4TUU A;  2LGY A;  1OGW A;  1V5O A;  3PT2 B;  5HKH A;  3ZVV A;  2DZM A;  2FUH B;  2HE7 A;  2FCN A;  2KQ7 A;  2N9P C;  3PRM B;  4DDG D;  3N32 A;  2N9X A;  5C23 A;  1RFA A;  4GIV A;  3KW5 B;  1WYW B;  4CHK A;  3DVN V;  2DAJ A;  4KDI C;  3PSE B;  3VFK A;  4EUT A;  1UZX B;  2BKR B;  2HTH A;  2WX0 A;  2L3Z A;  2DZJ A;  2GBR A;  1WMH A;  1X1M A;  3JW0 X;  2LZ6 A;  4CO7 A;  2JRH A;  2DX5 B;  2LGX A;  2MW5 A;  4GU2 A;  3ZO5 B;  4W9E A;  5D2M B;  2KDI A;  3M95 A;  4IW0 A;  3QIJ A;  3TL5 A;  1E7U A;  4DHJ D;  4KZ0 A;  4FJZ A;  1UBI A;  4WJN A;  2I1K A;  2JZZ A;  2MWS B;  5GMV A;  1LXD A;  1FXT B;  2IBI B;  3U30 A;  1L7Y A;  3C0R B;  3QJZ A;  4W9C A;  3ZIM A;  2LXC A;  4TQ1 A;  3KH0 A;  2GBM A;  4KSK C;  4FBJ B;  2D3G A;  2K8H A;  3M63 B;  1GNU A;  3LDZ E;  1IYF A;  1VCB A;  4N9F 4;  2KFK A;  4NNJ B;  1XD3 B;  1EUV B;  2Z0D B;  5C1Z A;  1RAX A;  4AJW A;  3ZRF A;  2Y5B B;  5JHB A;  1UEL A;  3SHQ A;  4AJY B;  1WXM A;  4G11 A;  2DHZ A;  1MG8 A;  2QHO A;  3L0W B;  2KJR A;  3U7D A;  3RD2 A;  3ZNZ B;  4II3 B;  3WAM A;  1YX5 B;  3VDZ A;  2KJH B;  3GOE A;  4FHK A;  4KVG B;  2O6V A;  3QC8 B;  2NBW B;  3L17 A;  4IG7 B;  2KMA A;  1P9D U;  5JHA A;  2GMI C;  3QA8 A;  2EMT A;  1I42 A;  1LQB A;  2IO0 B;  2J0K A;  4WJQ A;  2KWV B;  1WE7 A;  1E8X A;  1Q0W B;  2KOX A;  3BY4 B;  2JXX A;  3KVF B;  3WAO A;  4ANU A;  3QWZ B;  3NY5 A;  4FUL A;  4WWO A;  4NJ7 A;  5KHQ A;  5LXH A;  1WGD A;  2K6D B;  3ECI A;  2AWT A;  2JUO A;  2DZI A;  3DBH I;  3HM3 A;  4GN1 A;  4MH0 E;  3JSV B;  1V86 A;  3HM6 X;  1WXA A;  2BF8 B;  4BKG A;  4NQK E;  2UYZ B;  3UIP B;  4MGY E;  4FN2 A;  1V6E A;  1GC6 A;  4BBN C;  3HHM A;  1KOT A;  5AZF A;  5G55 A;  3ZDT A;  2GBK A;  3CF6 E;  3CST A;  4ZDV A;  1P0R A;  2MBO A;  2W9N A;  4AWJ A;  2A5U A;  2KVR A;  2G3Q B;  4RM9 A;  4M0W B;  4BBN F;  3A33 B;  2FID A;  3KYD D;  1F9J A;  2MCN B;  2KDB A;  4M8N A;  2G4D B;  4IM0 A;  5EDS A;  4AOF A;  2BPS A;  2LAS A;  5DCN A;  1WIA A;  4W9J A;  3I3T B;  4WQO B;  2MBE A;  3TCA A;  3NOB A;  1E7V A;  3L13 A;  1R4N I;  2N7D A;  5J18 A;  2LGD A;  2N7E A;  4ZYN A;  3KYC D;  4HCP B;  3APD A;  4NAW B;  2ZEQ A;  2PJH A;  1XQQ A;  2LJ5 A;  4OVU A;  1OEY A;  4BKS D;  4WJO A;  1LFD A;  2KD0 A;  2LXA A;  2ZPY A;  1D3Z A;  2LVO A;  4W9G A;  4BKS A;  3R7R A;  1UD7 A;  4MEL A;  2LRU A;  2MBH A;  4EKU A;  4NJ6 A;  4W9K A;  4KIK A;  2MQJ A;  1E90 A;  2AEH A;  2N1V A;  2K6Q A;  3DVG Y;  2V4L A;  3B1L X;  5CTR C;  3DCG A;  2M17 A;  2RPQ A;  4B95 A;  4HK2 A;  5JZE B;  2AL3 A;  3RZF A;  1WX9 A;  5CHW A;  3A9K B;  4LCD E;  5TR5 A;  2LRW A;  3QX1 A;  3VTV A;  4I6N B;  3H7P B;  3A1Q A;  3B0A A;  3QCA A;  4HPL B;  3HK0 A;  4HJK A;  2BYV E;  2Z0E B;  5DPR A;  2IO2 B;  3R66 C;  4NY0 A;  2K25 A;  1ZKH A;  3RCZ A;  1IP9 A;  3DVN U;  2CKH B;  1SGH A;  2XK5 A;  3WAN A;  2LVP A;  1V80 A;  4EOY A;  2MA9 B;  1WR1 A;  2GBJ A;  4K1R B;  2YVC A;  1HE8 A;  1GC7 A;  3ONS A;  2CHX A;  2M0X A;  1KM7 A;  2CR5 A;  3H1U A;  3DDC B;  4WAA A;  3SU8 X;  2C9W B;  4PS8 A;  3VUX A;  2KTR B;  1E8Y A;  4W9D A;  2V3S A;  1WMH B;  1M94 A;  2BKF A;  3VVW B;  3PRP B;  3H6N A;  1TBE A;  4K81 A;  2C5L C;  3OJ3 A;  4II2 B;  3A4R A;  4TQ0 A;  3VTU A;  1YD8 U;  3D32 A;  4ANX A;  4KDL B;  5CHF A;  1RRB A;  2D2Q A;  2WX1 A;  5FR6 A;  2ASQ A;  2VRR B;  4KV2 A;  4EZK A;  2KO3 A;  4F7Z A;  1CMX B;  2KLG A;  2FIF A;  2N9E B;  2NBV B;  3PGE A;  3W1S A;  1A5R A;  3V62 A;  2UWQ A;  4DHJ B;  1NI2 A;  4GMV A;  5JH5 C;  2J7Q B;  3PV1 A;  1BT0 A;  3ZLZ A;  3O65 B;  3MTN B;  3ALB A;  1EO6 A;  2KXJ A;  2KDE B;  2KX0 A;  2XEW A;  1WFY A;  2LD9 A;  2RGF A;  4J6I A;  2IY0 B;  4WWP A;  2OJR A;  1J19 A;  3DQV A;  3NZS A;  2ZZP B;  3IVF A;  4I6P A;  3A1Q B;  4IWP A;  4A20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...