2MRPA

Nmr solution structure of the ubiquitin like domain (ubl) of dna-damage-inducible 1 protein (ddi1)
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
79
structure length
79
Chain Sequence
b'DLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA damage-inducible protein 1
molecule tags Ubiquitin-binding protein
source organism Saccharomyces cerevisiae
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
total genus 8
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mrpA00
1V6EA 3ZUNA 1KJTA 4AWJA 1WJUA 4NQLB 3DVGY 2K25A 3HK0A 1WE6A 3ZNGC 4II3B 5G55A 5IAAC 2N7EA 2NBUA 5JHAA 4GIVA 4BKSD 1I35A 3M63B 2IBIB 2LXAA 1UZXB 4PYZA 3KUCB 2AL6A 3SU8X 3V62A 4ANUA 4K81A 1WYWB 2KZRA 2ASQA 4E71A 1GUAB 2B3AA 3LDZE 4KSLC 3ZNHB 1Z5SB 4GXBA 2IYDB 3A1QB 3UINB 3VUYA 4LJOB 2IO2B 5D6JB 2BYFA 3QCAA 2KXJA 4N9F4 2ZVOA 3PREA 2JXXA 3WIMA 4MSMB 2KD0A 1XT9B 2N1VA 2HJ8A 1GNUA 3NZUA 4G0NB 1E8XA 3A4RA 2G3QB 1P3QU 5TR5A 3RULA 1KLVA 4II2B 3M3JA 4WAAA 2AYOB 2M4NA 4NNJB 4JLCA 1WXVA 2LVOA 4DXAB 5G2NA 1IPGA 4EZJA 2KLCA 4W9IA 2PE9A 2L0TA 1EF1A 3ZKJC 2CS4A 2KKCA 3PRMB 2BKFA 3B08A 4RMAA 2NBVB 2KWUB 2DYBA 3JVZX 1C1YB 4ANXA 3KW5B 2EMTA 3MTNB 4BFRA 2LRWA 4K7SA 2LVPA 3TCAA 2KMAA 4FN2A 2HD5B 3EC8A 4TQ0A 3NOBA 3ML8A 2JZZA 2QHOA 1WX7A 1VD2A 2KTRA 3D32A 2K1FA 3DBLI 3RT3B 2RSUA 1YIWA 2CHWA 2KC1A 1C3TA 2MQJA 3UGBB 3ZTDA 2Z0EB 5E6NA 4PYUA 4HXDA 3SD5A 4BVUC 1F9JA 2YLMA 5FR6A 3AULA 1KOTA 4YL8A 2N4FA 2AL3A 2WX0A 3I3TB 4JQWC 3PS6A 4NQKE 1Z2MA 4IUMB 2J0JA 3VFKA 3EHVA 1EUVB 3H7PB 2KFKB 2N9EB 3OJ4B 3RZWC 3MHSD 2V1YA 5DCNA 4BOSC 2KLGA 1HE8A 1P9DU 1WM2A 3BINA 1GC6A 3A4SC 1ISNA 2MBEA 3PTFC 2Z59B 3Q3FA 3JSVA 1SGHA 3QHTA 1G6JA 3VTUA 4ICUA 1WMHA 2D11A 4ANVA 5HKHA 3ZNID 2FCSA 2L8JA 2MP2B 5D7GA 4GSWA 3S2AA 3HM6X 2LI5A 4TV3A 1BT0A 1YD8U 1WFYA 2AWTA 2REXA 3OJ3A 2Z0DB 1IP9A 2K6DB 2N1WA 3PRPB 2C60A 2KO3A 2DYMA 4IWPA 2DZJA 2ZNVB 2DHZA 2KWCA 3H1UA 2CHXA 1WX9A 4IG7B 4NY0A 1P1AA 1UBIA 1D3ZA 3H6NA 5DPRA 3U30A 5E6OA 1GC7A 2CU1A 2GBMA 2XK5B 3L54A 2V3SA 3N30A 2ZJDA 4GDLA 2MRPA 2DAFA 3CSFA 3QC8B 1I42A 3CF6E 3A9JB 4LCDE 5LXHA 4BBNF 4KSKC 1WXMA 4G3XB 2KOXA 3ML9A 4GB9A 1OEYJ 1H4RA 2K8BA 3VAWA 4OVVA 1YQBA 3RUIB 2J0MA 2JRIB 3L10B 1NDDA 2BGFA 4KZCA 5JH5C 1YX6B 3PHXB 1TGZB 5CHFA 3DVNU 3JSVB 4HDOA 3EFUA 3JW0X 4WJOA 2KFJA 3UQBA 4EEWA 3DBSA 2FUHB 4RM8A 3K9PB 3HHMA 3ZLZA 4KDIC 4NPNA 1XD3B 5BO4B 3M62B 2GBKA 2KMCA 2BPSA 2CKHB 4FULA 2MWSB 2NVUI 2ZZPB 4W9CA 4BKTA 2DYOA 5EDSA 1LFDA 1E7UA 2C7MB 1JRUA 3UIOB 2WYQA 2FCMA 4ZRJA 3Q3JA 5C1ZA 5AZGA 2AEHA 1KM7A 1WZ3A 4NAWB 1WH3A 2BF8B 1E7VA 4BOZB 2FIFA 1Y8RC 4W9FA 1E8ZA 3RCZA 2C5LC 3VH3B 1UGMA 2MLBA 2K8CA 5DPSA 4DK5A 4AOFA 5LLIA 3TJPA 2XK5A 2NBWB 1LQBA 2KDBA 2C7NB 4X57B 3VTVA 1V5OA 4GOCA 4NJ7A 3ZVVA 3X0WA 2JF5A 4GDLB 4XX5A 2DZIA 3ZRFA 4BKSA 3BY4B 2BYEA 2L05A 3QWZB 4XC2A 3VDZA 1WJ6A 1WRDB 3QX1A 4HJKA 3K9OB 1AARA 2NR2A 4MELA 2DZMA 2ZCCA 1CMXB 2O6VA 4KV2A 1WY8A 4LDTB 4DHZB 1V2YA 4W9LA 1PQSA 4W9EA 5GMVA 2D3GA 4FHJA 4A3OA 2MBOA 3MJWA 2LXCA 4MGZE 2DAJA 3ENEA 4DBGA 2MX2A 3OLMD 3DBHI 1EO6A 2BKRB 3L0WB 2XBBC 3M95A 3PV1A 2M0XA 2MW5A 4I6PA 3HM3A 1GJZA 1H8CA 1V80A 5KHOA 4DHJB 3X23A 1RLFA 2KFKA 3VXWA 2KNBA 4B95A 1XQQA 4MGYE 3H9DA 3GZNI 3OAWA 1J0GA 2GBRA 5CHWA 4WQOB 4MH0E 2LWPA 3NY5A 1TZ1A 2YVCA 4E74A 5KHQA 4NJ6A 5J2RA 1WX8A 2MSED 3KH0A 1RRBA 3RYTA 5AEKB 1WMHB 3DCGA 3VQIA 4WJPA 2IY1B 4IW0A 2KX0A 2K8HA 4EOYA 2O2VB 4MJSA 2M8SA 2MP2A 2N7DA 3AU4A 3C0RB 4HDQA 1ZGUB 2GMIC 3DQVA 2KX3A 3PRZA 3DVGX 1SIFA 2MCNB 2FCQA 4ICVA 4IWQA 3R7QA 5JZEB 2WWZA 1E5WA 4FJYA 3KYCD 4WJNA 2CR5A 4TQ1A 3APDA 1M94A 2A4ZA 3AU5A 2IY0B 1Q5WB 1J19A 4M0WB 2N9XA 3PGEA 3KUDB 4DDGD 4HWIB 3T8MA 3DBRI 4FJVB 2K39A 4KZ0A 5LXIB 2KN5A 2ZCBA 4URKA 3VUWA 3NS8A 3A9JA 2KC2A 2OOBB 2ZPNA 4IM0A 4EZLA 4AJWA 2Y5BB 2FNJB 3PVLA 3UF8A 2KANA 5IA7A 1V9JA 4IM2A 2IO3B 2JZ3B 2LZ6A 1S1QB 4WJQA 2KJ6A 4P7IA 2L76A 4ANWA 2WDTB 1WI0A 1WM3A 3QIJA 4PS8A 2KDIA 3H7SA 2LUEA 2LGXA 4W9DA 2ZVNA 3B1LX 4GDKA 1NBFC 2LRUA 2R2QA 1WGYA 2JT4B 3KYDD 2G45B 4ASWC 4CHKA 3HIZA 2NS5A 2O2VA 2PPHA 4MJSB 1E8WA 3A9KA 2LD9A 1WR6E 3VVWB 1WR1A 2JVCA 4DWFA 3IG3A 4K7UA 4A3PA 1NI2A 4W9JA 4XZ4A 4HK2A 4G11A 3DPDA 1FXTB 4IM3A 4AUQC 3WAPA 2W9NA 4NAWA 4E3CA 3V61A 4AJYB 4CO7A 2LGDA 2O6VD 3R3MA 4J6IA 4LDTD 4BKGA 3DVNV 4FJZA 2L00B 1YX5B 1LXDA 2JRHA 2KDFB 2ZEQA 3VUXA 2KTFA 3DDCB 2HTHA 1OEYA 3QK0A 2ZPYA 3VH4B 4GMVA 1P0RA 1WF9A 3KUZA 2L7RA 1ZKHA 1OTRB 2UWQA 4JIOU 2JWZA 2NPTA 3UIPB 4DHJD 3V6EB 3U7DA 4TKNA 2OJRA 2RR9A 1K8RB 1IYFA 2KJHB 2L0FA 1UH6A 2RD0A 3V6CB 3ZRCA 4B6WA 2O6VB 4DHZE 2MBHA 2GOWA 3WAMA 2IO1B 2V4LA 1WIAA 3P2BA 5L95C 1WGDA 3L08A 4IWOA 5D2MB 4EUTA 1OGWA 1V86A 4M8NA 1WJNA 1P98A 5AZHA 2DX5B 2G4SA 1L2NA 3VHTC 5J17A 1QZEA 1RAXA 2GBJA 4FHKA 4FBJB 1RFAA 4GGQA 2DZKA 2J7QB 4MDKE 2PJHA 1UELA 3GOEA 4TUUA 1Q1OA 4ZYNA 2UYZB 3B0AA 4HLEA 1V49A 4M8MA 4KIKA 3R66C 3ZDTA 3IBEA 4HPMB 1S3SG 3QAQA 2XEWA 3T9LA 3ZW3A 4MSQB 3ECIA 3L13A 3O65B 4EZKA 1WJ4A 4PS7A 1E8YA 4GU2A 4FLHA 4WWOA 5D94A 4A20A 2FCNA 5DPTA 3NHEB 3PSEB 3WALA 5CHVC 4ZRIA 3RZFA 4MM3A 5C23A 2LGYA 4K7WA 2LASA 3A33B 3A1QA 3IHPC 4W9HA 3U8ZA 2MBQA 4MGIE 4PS3A 2D2QA 1R4NI 3CSTA 4FADA 2IZVB 3CMMB 3W1YA 3PLVA 4HPLB 1UBQA 2IO0B 4G50A 4MGKE 3ZNZB 4HCNB 2N9PC 2RGFA 4JGHB 3PHWB 5E6PA 3TL5A 4F1SA 2G4DB 2LJ5A 3DOWA 3N3KB 4EFOA 3VTWA 2A5UA 3LJ3A 3N32A 5AZFA 2WX1A 3V60A 4HCPB 3KVFB 1SE9A 4ZRKA 3WANA 1WE7A 2EKEC 2HE7A 3PPAA 1WGRA 2FIDA 3SHQA 4IC7B 2DENB 2LVQA 3ALBA 1E90A 2BWFA 4GN1A 1GG3A 4FA6A 1T0YA 3WAOA 1X1MA 1EF5A 3IVFA 3QA8A 4GDKB 2I1KA 4KDLB 1L7YA 2C9WB 3ZO5B 3UQAA 3AXCA 3QARA 4OVUA 2PE6B 3RD2A 2M17A 3APFA 4CYEA 5J18A 3A9KB 2K6QA 2D10A 3ZDMC 5JHBA 5L83A 2KQSA 2KWVB 2L3ZA 4I6LB 1A5RA 3PLUA 2KTRB 3APCA 2VRRB 4I6NB 1WGHA 3L17A 2M1MA 3ZTCA 4B9KA 1YJ1A 2ZNVC 3PT2B 4DDID 3L16A 1MG8A 2C7HA 4JL9A 5CTRC 3TBLD 2BWES 2JY6A 2BYVE 2EMSA 1R4MI 2GBNA 4LJPB 4WWPA 4KVGB 3SDLC 4AP4C 2RPQA 4HVBA 3PZDA 2JPHA 3AI5A 1TTNA 4ZDVA 1U4AA 3H7PA 1V5TA 4WWNA 4W9KA 2NPTB 1TBEA 1WGGA 1J8CA 4K1RB 2D07B 2KHWB 4EKUA 4BBNC 5DPWA 4F8CB 3QJZA 1WXAA 2PEAA 3IFWB 3NZSA 1VCBA 1WZ0A 2J0KA 3WA0A 2MBBB 4F7ZA 1LM8B 2KQ7A 2NCNA 2KVRA 1UD7A 2JUOA 3EECA 4RM9A 1V81A 3W1SC 3TIXA 5CX3A 2CHZA 2KDEB 3ONSA 3R7RA 2KJRA 4MEMA 3QQ8B 3ZIMA 3TMPB 3JYUA 1OQYA 2R2OA 4W9GA 2KK8A 1Q0WB 1ZW7A 2MA9B 2I1JA 2FAZA 1WXSA 4KIKB 3W1SA
chains in the Genus database with same CATH superfamily
1V6EA 4WQMA 1VZ7A 3DVGY 2X8XX 4II3B 2I38A 1TJEA 1ACCA 3RN9C 2Y5PA 1I35A 3DWGC 2AL6A 3FAHA 3NS1A 4CQNA 2ASQA 3GP7A 4E71A 3LDZE 5FKAC 3HVDA 1Z5SB 4GXBA 3UINB 3QCAA 1UWXA 2MHJA 2JXXA 1MVKA 2W3SA 4G0NB 1V1OA 1P3QU 3M3JA 3P4RB 4JLCA 1C78A 3N20C 1BUIC 3AE2B 5G2NA 2KLCA 4W9IA 4ARIA 3ZKJC 2BKFA 3B2FA 2KWUB 3JVZX 1C1YB 4ANXA 2LRWA 4K7SA 4S17A 2KMAA 1QOFA 3EC8A 1YOVB 1ZDXA 3P63A 4O1NA 3ZQ4A 2WXPA 1FPYA 2CHWA 1TT5B 5G5GA 2WXGA 1HZ6A 2MQJA 3MC0B 3ZTDA 1SEBD 4BVUC 1D6EC 2N4FA 4JQWC 3PS6A 1EUVB 2N9EB 3N9YC 2V1YA 5FR3A 3R2IA 5DCNA 4B0MA 2KLGA 2V0GA 1WM2A 1T0RC 3JSVA 3P1MA 2BS3B 1J7BA 2HTME 1BT0A 1M4VA 1WFYA 2REXA 1OQQA 3OJ3A 3NZ3A 2OEDA 4YTMB 2M0AA 2H88B 2DYMA 2H89B 3H1UA 1HZ5A 2CHXA 1WX9A 4IG7B 1P1AA 1D3ZA 3H6NA 5DPRA 3W9CB 1TKGA 1TY2A 2SEBD 2VZKD 2CU1A 5E6OA 2V3SA 4BZAA 4KKIA 4RCOA 4BAXA 1HA5A 3A9JB 4LCDE 5LXHA 4BBNF 1WXMA 4G3XB 1H4RA 4MT5A 4QAYA 1NEKB 3RUIB 4KZCA 3BVMA 5CHFA 1GAQB 3DBSA 1CZPA 3K9PB 1F1HA 3HHMA 4KDIC 3ZLZA 4JE3B 4FULA 2J42A 4W9CA 1MHHE 3I5JC 2WYQA 3T3NA 2FCMA 1BMLC 1KM7A 3HRDD 4NAWB 2JYEA 5EE0A 4WH4A 3BIID 2FIFA 2LGSA 3FKYA 4W9FA 3VH3B 3U4EG 2K8CA 4YWGG 2NBWB 1LQBA 1HXYD 2AQ2B 3X0WA 2JF5A 4XX5A 3OWEB 3SFEB 5EE3A 1WRDB 3K9OB 4HROA 2DZMA 1CMXB 2O6VA 1PQSA 4FHJA 1PUTA 2MBOA 3MJWA 2IGDA 2LXCA 2MX2A 5HFYA 3DBHI 3EGRA 2LJIA 3ZXRA 1ZPSA 3HM3A 1V80A 5KHOA 3VXWA 3H9DA 3NY5A 4E74A 5IO9A 1WX8A 3I63C 3DCGA 4WJPA 4EOYA 2G9HD 2N7DA 4LK0M 3AU4A 1N60A 1UNSA 2DLBA 2KX3A 3PRZA 1YN3A 4IWQA 2WWZA 4FJYA 4WJNA 1EM7A 1IGDA 2A4ZA 3AU5A 1J19A 5FK9C 3PGEA 1C4AA 2IPKD 2D3AA 4NJCA 1L4ZB 2FNJB 2IO3B 2LZ6A 2D5GA 2KJ6A 1JWBD 4P7IA 2WDTB 1QLBB 3PZ7A 1D5MC 2KDIA 3H7SA 3OG5A 2LUEA 3PZ8A 4H2AA 2ZVNA 4PT5A 2LRUA 1WGYA 2JT4B 4ASWC 1V8CA 4OHJA 2NS5A 3A9KA 2LD9A 1WR1A 4K7UA 4XZ4A 4HK2A 4IM3A 4AUQC 4E3CA 4HJGE 2W9NA 4NAWA 4AJYB 2CJNA 4J6IA 4JX1C 4FJZA 2MEKA 1LXDA 2KDFB 4JWSC 1OEYA 2ZPYA 4LNNA 3VH4B 3KUZA 1JALA 2N0SB 2JWZA 2NPTA 3V6EB 4A55A 1T0SC 2OJRA 2J53A 2M56B 2KJHB 3ZRCA 2MBHA 3WAMA 1SSNA 4IWOA 1OGWA 4M8NA 1WJNA 1SB3C 3VHTC 4ZYSA 3AEBB 4FHKA 4GGQA 2DZKA 3AN1A 1FNWA 4AS1A 3IBEA 3QAQA 1K53A 3UI3A 2PVGC 1TS5A 1E8YA 4YT0B 3AE5B 4M00A 3PSEB 4RH6A 3WALA 5MPOA 2PMVA 4W9HA 3BK2A 4MGIE 2N9KA 1R4NI 2IZVB 3W1YA 3DBRB 5IKCM 1UBQA 2I2YA 3DOWA 3MP9A 2A5UA 1QOAA 2WX1A 3B2GA 1WRIA 4N6EB 2JWUA 2HE7A 2FIDA 3AEDB 1RYJA 4RGMA 2LVQA 2PVOD 1E90A 2BWFA 3J9CA 3WAOA 1D5XC 1EF5A 3CIRB 4GDKB 3R2TA 3MHZA 3VR9B 1MI0A 5BYQA 2M17A 2QIEB 2D10A 2CU3A 5L83A 3GE3C 1CQVA 3ZJUA 2QDFA 2N7JA 3APCA 1HTQA 3DHGC 4XGAB 3L16A 2VZKB 2JY6A 1NI3A 3PO0A 2GBNA 3BZDB 4WWPA 4KVGB 4ZDVA 1V5TA 2NPTB 1WGGA 1J8CA 4BBNC 1IUEA 4F8CB 1VCBA 2MBBB 1NYQA 2KQ7A 2NCNA 3N1ZC 2DWQA 3TIXA 4TMAB 2ZW1A 4KGSA 1XLNA 3KQ4A 2GI9A 1OQYA 1F77A 2KK8A 1Q0WB 4KIKB 3ZUNA 1KJTA 3ZJTA 1WJUA 3HK0A 1WE6A 5G55A 1EU3A 2N7EA 2LHEA 5EE9A 5IAAC 3EUB2 2LGIA 2EELA 1IBXB 4XWWA 3SU8X 1WYWB 3A1QB 3MFGA 1LGRA 4LJOB 2IO2B 4N9F4 2HJ1A 1N6ZA 3PREA 4MSMB 2N1VA 1XLOA 1P7FA 3A4RA 5TR5A 4ACFA 1KLVA 3GS2A 1VRAB 1QILA 2AYOB 1SF0A 2M4NA 4NNJB 4M01A 4EZJA 2RPVA 4ITKA 2L0TA 4OVZA 4RMAA 2RMMA 4YTPB 1QQRA 2KT7A 2K9XA 3TCAA 4FN2A 1XO3A 2HD5B 2IGGA 2JZZA 1E9MA 3P4SB 2K1FA 3RT3B 4RGNA 1YIWA 1C3TA 2R61A 3NG0A 5E6NA 2WHIA 1FEHA 5FR6A 5E6JA 2WX0A 3I3TB 1MG4A 4IUMB 5AUIA 1FIQA 3H7PB 2KFKB 3MHSD 1R4NB 2V4IB 1HE8A 1P9DU 2L1AA 1GC6A 1C4CA 1TY0A 3Q6BA 3PTFC 3Q3FA 3NVVA 4ICUA 4D2KA 1KLUD 2JZPA 1WMHA 1FFVA 1YQ3B 4ANVA 3IT6B 2WU5B 2L32A 1J7CA 1TYGB 2WXHA 1YD8U 2AWTA 2Z0DB 1IP9A 2WXKA 2N1WA 3FILB 2ZNVB 4M0WA 3WCQA 2GBMA 2XK5B 1FRDA 1KLGD 2ZJDA 3NVYA 3RNAC 4RGTA 4GB9A 2IGHA 1PFDA 4HKZE 2JRIB 2MH7A 2BGFA 1YX6B 1PYWD 1TGZB 5H8YE 3JSVB 4HDOA 4WJOA 2FUHB 4J3OD 4RM8A 2W55A 4US9A 2QILA 1P7EA 2L83A 3M62B 4YTNB 5D3IB 2CKHB 1PGBA 2INCC 4P1CC 3Q8AA 3IT4B 1CJEA 2AX5A 1JRUA 2BQQA 4ZRJA 3DHHC 5AZGA 1WZ3A 3RNFC 4BOZB 2J52A 1DGJA 3V05A 5DPSA 3TJPA 1UGJA 2XK5A 2KDBA 2C7NB 1F52A 4NJ7A 2BYEA 3QWZB 4IKGA 1WJ6A 2EKIA 1AARA 2NR2A 3ZYYX 2ICIA 4DHZB 4LDTB 1V2YA 4W9LA 4W9EA 5GMVA 2D3GA 3NRZA 1JWSD 1EO6A 2HDEA 2BKRB 2WQYB 3AECB 1GJZA 1RLFA 3GZNI 2GBRA 4LNOA 3MC9A 2MJEA 1TZ1A 5KHQA 4NJ6A 2MSED 1RRBA 2W82A 3BWUD 3Q8EA 4WWMA 3H8HA 2K8HA 4MJSA 2O2VB 2M8SA 4HDQA 1ZGUB 2GMIC 3DQVA 2MCNB 4ZRQA 4TQ1A 3APDA 2IY0B 1Q5WB 1GB4A 3R8BA 3BVZA 5HHDG 3VUWA 3NS8A 4EZLA 4YSZB 3PVLA 5IA7A 1BXTA 1E10A 1AN8A 2JZ3B 4LTUA 1S1QB 2FBWB 4A9AA 3TEZA 2LGXA 2WXIA 2G45B 3HIZA 2PPHA 2O2VA 4MJSB 2AQ1B 4KX6B 4DWFA 3P4QB 4G11A 4OZCA 1E0ZA 3AMZA 4LDTD 4BKGA 2ZW0A 1SE3A 2KMMA 2JRHA 3VUXA 2ON8A 2K0PA 3DDCB 4GMVA 1P0RA 3Q3NC 1TKYA 2L7RA 2PIAA 2UWQA 4JIOU 5AUKA 3UIPB 4DHJD 1L4DB 3U7DA 2XN9C 4TKNA 2RR9A 1K8RB 3V6CB 2E6XA 3P2BA 3RNBC 4OW0A 1XEEA 1V86A 4JWUC 1T0QC 5J17A 1QZEA 4FBJB 3GZNB 2RDHA 4TUUA 1Q1OA 4M8MA 3Q3OC 3R66C 3Q8BA 1D4BA 3T9LA 1I4PA 4MSQB 1YQ4B 4P1BC 3NVWA 4WWOA 3URYA 2W54A 3LB8C 1L0YB 1L6UA 3NHEB 1AYFA 5CHVC 4ZRIA 1VLBA 1L5PA 3BK1A 2LMCA 3A33B 3IHPC 3A1QA 3U8ZA 2MBQA 3CWIA 1K50A 2QC8A 2WXRA 4Q2JA 3CSTA 4FADA 2WS3B 5HG2A 3W5UB 4HCNB 2N9PC 5E6PA 2G4DB 3N3KB 3T3OA 5IP4D 5AZFA 1KH0A 3V60A 3KVFB 3DBLB 2N9LA 3Q2AC 3W5VB 1WE7A 3PPAA 1WGRA 4IC7B 1FD6A 2KN4A 3IVFA 3QA8A 2YEPF 3ZO5B 2KACA 3AXCA 4CYEA 4XYCA 4JPSA 1ZXHA 2KTRB 2VRRB 2WDQB 4LNIA 3PT2B 1E7PB 2C7HA 5BMIA 2BWES 2BYVE 2EMSA 1JQ4A 3H7PA 4W9KA 2QCZA 5DPWA 1L0XB 1WXAA 2PEAA 3IFWB 3NZSA 2LHDA 2J0KA 4KKJA 1LM8B 2WXNA 2KVRA 2B76B 4RM9A 2QMTA 1V81A 3MC8A 2CHZA 2KDEB 3ONSA 2J4XA 3R7RA 3LYYA 4MEMA 4RF0A 4REZA 2MA9B 2FAZA 2Q5WD 2FE8A 3Q8FA 4XDCA 4NQLB 3ZNGC 1T3QA 2DBYA 2IBIB 2LXAA 1UZXB 2V3NA 4K81A 2KZRA 1GUAB 1KTKA 2IYDB 2OJWA 3VUYA 4HPPA 5D6JB 3Q14C 1DOXA 3WIMA 2KD0A 1XT9B 3TEWA 1E8XA 1QF6A 2G3QB 3RULA 4II2B 1C9FA 3VR8B 1WXVA 1ET6A 1IPGA 5JXVA 2PE9A 2DNFA 4S0RA 2ACZB 2CS4A 1MHXA 2VH1A 2NBVB 2RDBC 4C7YA 4XWTA 1XLPA 1FFUA 3KW5B 2XNAC 3MTNB 3SFDB 3GE8C 2LVPA 1YN4A 2KVZA 1SJED 4TQ0A 3NOBA 1TS3A 2KTRA 3DBLI 2KC1A 5LNK1 3RI7C 3SD5A 1F9JA 3AULA 2AL3A 1MJDA 4NQKE 1QOBA 3VFKA 2J0JA 2LEKA 1PDXA 3EHVA 3RZWC 4BOSC 5BYSA 3A4SC 1KF6B 1ISNA 3AEAB 3AE8B 3DWMA 3AB5A 4WURA 2WXQA 3TUOA 5HKHA 2UU7A 2MJDA 3AEFB 2L8JA 2WDVB 5D7GA 4GSWA 3S2AA 1YN5A 2PKOA 2K6DB 3NJTA 2KO3A 3BYYB 2KWCA 4NY0A 1A70A 3U30A 5G5HA 1GC7A 5BMHA 3N30A 4GDLA 1I42A 4KSKC 3AE6B 2KOXA 3ML9A 2K8BA 3VAWA 1FXAA 2BT6A 1NDDA 1I4GA 5JH5C 3PHXB 1XF5L 1ET9A 3BVGA 3TSSA 3U7ZA 1XD3B 2GBKA 2LUMA 2G1EA 4BKTA 2C7MB 3UIOB 4AQ7A 5C1ZA 2KYWA 1FCLA 4LNFA 2BF8B 1HEZE 1E7VA 1Y8RC 1JROA 3RCZA 2C5LC 4EE2A 1UGMA 4AOFA 5LLIA 1ZUD2 3KLSX 3KWLA 4BKSA 2L05A 1E6EB 4C7ZA 3QX1A 4HJKA 4C56C 5I4DA 4MELA 1AWDA 2ZCCA 3AEEB 4UDUC 4MGZE 3ENEA 3OLMD 4WIPA 3NVZA 3M95A 2MW5A 3X23A 4B95A 2KNBA 4MGYE 1JCKB 1XXGA 5CHWA 2WGSA 1FM0D 2LWPA 1FNUA 1LO5D 3AEGB 3RYTA 5AEKB 3VQIA 2IY1B 4IW0A 1NVID 2KX0A 1ZP0B 2MP2A 4MM3B 3C0RB 3E9SA 1SIFA 2FCQA 3KYCD 2BTEA 2JXTA 4MACA 1FXIA 2PW9A 1M94A 1SJHD 2N9XA 4DDGD 3T8MA 2GLSA 3DBRI 1STEA 4FJVB 3C8YA 2KN5A 3A9JA 2KC2A 4IM0A 2ZPNA 1NENB 1TZOA 2Y5BB 3UF8A 1V1PA 2WU2B 3ETRA 4HEA1 2NMQA 5C2TB 2L76A 1WI0A 4PS8A 4GDKA 1NBFC 4TSSA 3KYDD 3AE3B 1PGXA 3I57A 5T8IA 1WR6E 2JX5A 2QSDA 3IG3A 2BB6A 1FXTB 3WAPA 1RFKA 1F0ZA 2LGDA 2O6VD 3R3MA 1YX5B 3N1XC 2ZEQA 1QT9A 2KTFA 1EWCA 2Y5CA 1KRHA 5BYRA 2K5PA 1V1PB 2O6VB 2GOWA 2IO1B 1N63A 1WGDA 5D2MB 3W2DA 4EUTA 4XDDA 1P98A 2G4SA 4P6VF 4US8A 1B9RA 1RAXA 2TSSA 1RFAA 2PJHA 3GOEA 2BVCA 4ZYNA 3B0AA 4KIKA 3ZDTA 1GPXA 1SE2A 3ECIA 3L13A 1HQRD 3O65B 1WJ4A 2IJ0A 4EZKA 4FLHA 5D94A 3LXFA 2FCNA 5DPTA 3RZFA 4MM3A 2LGYA 1DYQA 2LASA 3AV8A 2BS4B 1QOGA 2LFIA 4NZLB 4M02A 3CMMB 2BW2A 4L1BA 2IO0B 4YSXB 1UF0A 2RGFA 3DHIC 4JGHB 4YXDB 3TL5A 2LJ5A 4EFOA 1XLQA 1FRRA 4HCPB 1SE9A 3WANA 1N62A 2EKEC 3I9V1 3ALBA 1JWAD 1T0YA 1SBBB 1RM6C 1X1MA 3RMKC 2I1KA 1GOZA 4KDLB 1L7YA 3UQAA 2KDMA 3QARA 4OVUA 2PE6B 3RD2A 3APFA 5J18A 4C80A 3ZDMC 2L3ZA 1A5RA 2KAJA 3PLUA 1D5ZC 1I4XA 5TSSA 3ZTCA 1YJ1A 2ZNVC 4DDID 1VZ6A 4JL9A 5CTRC 1FO4A 1IBXA 2CJOA 4YSYB 3O13A 4FXCA 4HVBA 2JPHA 1TTNA 2D3BA 1TBEA 4A6QA 4K1RB 1C77A 3IAS1 3WA0A 2AQ3B 1VDVA 4F7ZA 2BYTA 3ABVB 2INPE 3EECA 3W1SC 5CX3A 3E56A 2KJRA 3TMPB 3JYUA 1OFFA 1WXSA 3W1SA 1V97A 4AWJA 2K25A 2NBUA 5JHAA 4GIVA 4BKSD 3M63B 1B1ZA 3FC4A 2MJ3A 4PYZA 3KUCB 4ANUA 5IOIA 3V62A 4K3BA 1JWMD 2ONQA 2B3AA 4KSLC 2YEPB 3RNEC 3ZNHB 3IAM1 2KWDA 4C4VA 1N61A 4XE0A 1GB1A 4OZAA 4RGOS 2BYFA 2KXJA 2ZVOA 1MPEA 3VRBB 1R7SA 2HJ8A 1GNUA 3NZUA 3N1YC 1WGKA 2WXLA 4WAAA 1JRPA 4LLGM 1K51A 2LVOA 4DXAB 1I4RA 1TKEA 1EF1A 1FCCC 2KKCA 4USAA 3PRMB 3B08A 1TS2A 3EFCA 2DYBA 1C4PA 2EMTA 4BFRA 2WNMA 1SIJA 1UWMA 3ML8A 4ZHOA 2K3UA 1JWUD 4C4VB 2QHOA 1WX7A 1VD2A 1FMAD 3D32A 4MH8A 4DXFA 2RSUA 3HVZA 3UGBB 2Z0EB 3ZGZA 4P16A 4HXDA 4PYUA 1DOYA 2YLMA 1VR9A 1KOTA 4YL8A 4HKQA 1Z2MA 2D3CA 2WXJA 3OJ4B 3AE7B 2WDRB 4C00A 2RDGA 4HRSA 3TEYA 3BINA 2MBEA 2Z59B 1G6JA 1SGHA 3QHTA 3VTUA 2BS2B 2QEJC 2D11A 3AH7A 3ZNID 1Y56A 2FCSA 4B0EA 2Z8LA 2MP2B 2BB5A 3HM6X 2LI5A 4TV3A 4OZBA 4RNAA 3PRPB 2C60A 4IWPA 2DZJA 4R3DA 2DHZA 4ZRPA 2WXMA 1L0VB 1UBIA 2INNE 4N59A 1YJIA 3L54A 2V3PA 1ZXIA 1VZ8A 2MRPA 2DAFA 2NTSA 3CSFA 3QC8B 2VH2A 3CF6E 1N5XA 3EA6A 1MFWA 1OEYJ 2BBCA 4OVVA 1YQBA 2J0MA 3L10B 3Q69A 3DVNU 1T6BX 2KQ4X 4LNKA 3EFUA 3JW0X 2KFJA 3UQBA 4EEWA 4NPNA 5BO4B 2KMCA 2BPSA 2Y3AA 2MWSB 1WYGA 2NVUI 2SAKA 2ZZPB 2DYOA 5EDSA 1LFDA 1E7UA 2GRIA 3Q3JA 2AEHA 1WH3A 3FILA 1C79A 1I4HA 1E8ZA 2MLBA 4DK5A 3U2SC 3SR6A 3DBHB 4X57B 3VTVA 1J7AA 1V5OA 4GOCA 3AE4B 4IDIA 3ZVVA 4GDLB 2DZIA 3ZRFA 3BY4B 4XC2A 1I7HA 3VDZA 1ESFA 3Q3MC 2OHFA 3IXSA 4KGRA 3RFZB 3B9JA 4KV2A 1WY8A 1WSPA 2L52A 4A3OA 3ZJVA 3AE1B 2DAJA 4DBGA 2PLPA 3C19A 3L0WB 2XBBC 3PV1A 2M0XA 4I6PA 1H8CA 4DHJB 2WLBA 4GLSC 2KFKA 1XQQA 1EWYC 3OAWA 1J0GA 2E3TA 4WQOB 4MH0E 1KFYB 2YVCA 2JYTA 5J2RA 3KH0A 1C76A 1WMHB 5C3JB 3ZXVA 1PGAA 2WP9B 1ROEA 1YJJA 3DVGX 1IGCA 1WWTA 3BYTB 1DOIA 4ICVA 3R7QA 5JZEB 1E5WA 2CR5A 4ZHPA 2INDC 1I4QA 4M0WB 1TS4A 3KUDB 2PTLA 4HWIB 2K39A 4KZ0A 5LXIB 2ZCBA 4URKA 3TEXA 2OOBB 3V3XA 1Q10A 4AJWA 4K3CA 2KANA 1EU4A 1V9JA 2W3RA 4IM2A 4WJQA 4PK1A 3U52E 4ANWA 3QIJA 1WM3A 2V9HA 1UUPA 4W9DA 3B1LX 3RNCC 5HI1A 3L4PA 2R2QA 1FNVA 3Q8CA 4CHKA 4A90A 1E8WA 3VVWB 1AW7A 2JVCA 4DQOC 4A3PA 1NI2A 4W9JA 2GB1A 3DPDA 4RFBA 3V61A 4CO7A 1JMLA 3DVNV 2L00B 3KWVA 2HTHA 3P4PB 1SXTA 3QK0A 1F2RI 4WAFA 1WF9A 1XCTL 1N5WA 1ZKHA 1OTRB 5GXGB 3AM9A 3RNGC 1IYFA 4DHZE 2L0FA 1UH6A 2RD0A 4B6WA 1XCQL 2K22A 2V4LA 1ENFA 1WIAA 4NAMA 5L95C 3L08A 1HTOA 5AZHA 2DX5B 1L2NA 1YNTE 2GBJA 2J7QB 1ZDVA 4MDKE 3MJ5A 1UELA 4RF1A 4ARCA 4KGTA 4L23A 2UYZB 4HLEA 1V49A 2M19A 4HPMB 1S3SG 2XEWA 3ZW3A 5EE1A 1WXQA 4PS7A 4GU2A 4A20A 1R4MB 1F2RC 1K52A 5C23A 4K7WA 2WXOA 2X38A 3VRAB 4PS3A 3HUIA 2D2QA 2JU6X 3PLVA 4HPLB 1QKZA 1OQRA 4G50A 4MGKE 4N58A 3ZNZB 3PHWB 1NYRA 4F1SA 3VTWA 3LJ3A 5BMGA 3N32A 3GB1A 1SE4A 2NTTA 2FUG1 1RWSA 4ZRKA 3SHQA 2DENB 1VJKA 4GN1A 1GG3A 4FA6A 1CK1A 2IDYA 1TIFA 2C9WB 4A8XC 3AE9B 1ZE3D 3A9KB 1L6VA 2K6QA 5JHBA 2KQSA 2KWVB 4I6LB 4I6NB 1WGHA 3L17A 2M1MA 2JQRB 2WXFA 4B9KA 1YMHE 1MG8A 2JSVX 3RPFC 3TBLD 1R4MI 4LJPB 3SEBA 3SDLC 4L2YA 2QJLA 2RPQA 4AP4C 3PZDA 1JW9D 3AI5A 1ZOYB 5D3DA 1U4AA 4WWNA 5IN7A 2D07B 2KHWB 4EKUA 3QJZA 1WZ0A 4DXGA 1UD7A 2JUOA 3P42A 4ZOHC 1T5XD 3NUHB 4IOIE 3QQ8B 3ZIMA 2R2OA 4W9GA 1ZW7A 2I1JA 5H92C
chains in the Genus database with same CATH topology
1V6EA 3ZUNA 1KJTA 4AWJA 1WJUA 4NQLB 3DVGY 2K25A 3HK0A 1WE6A 3ZNGC 4II3B 5G55A 5IAAC 2N7EA 2NBUA 5JHAA 4GIVA 4BKSD 1I35A 3M63B 2IBIB 2LXAA 1UZXB 4PYZA 3KUCB 2AL6A 3SU8X 3V62A 4ANUA 4K81A 1WYWB 2KZRA 2ASQA 4E71A 1GUAB 2B3AA 3LDZE 4KSLC 3ZNHB 1Z5SB 4GXBA 2IYDB 3A1QB 3UINB 3VUYA 4LJOB 2IO2B 5D6JB 2BYFA 3QCAA 2KXJA 4N9F4 2ZVOA 3PREA 2JXXA 3WIMA 4MSMB 2KD0A 1XT9B 2N1VA 2HJ8A 1GNUA 3NZUA 4G0NB 1E8XA 3A4RA 2G3QB 1P3QU 5TR5A 3RULA 1KLVA 4II2B 3M3JA 4WAAA 2AYOB 2M4NA 4NNJB 4JLCA 1WXVA 2LVOA 4DXAB 5G2NA 1IPGA 4EZJA 2KLCA 4W9IA 2PE9A 2L0TA 1EF1A 3ZKJC 2CS4A 2KKCA 3PRMB 2BKFA 3B08A 4RMAA 2NBVB 2KWUB 2DYBA 3JVZX 1C1YB 4ANXA 3KW5B 2EMTA 3MTNB 4BFRA 2LRWA 4K7SA 2LVPA 3TCAA 2KMAA 4FN2A 2HD5B 3EC8A 4TQ0A 3NOBA 3ML8A 2JZZA 2QHOA 1WX7A 1VD2A 2KTRA 3D32A 2K1FA 3DBLI 3RT3B 2RSUA 1YIWA 2CHWA 2KC1A 1C3TA 2MQJA 3UGBB 3ZTDA 2Z0EB 5E6NA 4PYUA 4HXDA 3SD5A 4BVUC 1F9JA 2YLMA 5FR6A 3AULA 1KOTA 4YL8A 2N4FA 2AL3A 2WX0A 3I3TB 4JQWC 3PS6A 4NQKE 1Z2MA 4IUMB 2J0JA 3VFKA 3EHVA 1EUVB 3H7PB 2KFKB 2N9EB 3OJ4B 3RZWC 3MHSD 2V1YA 5DCNA 4BOSC 2KLGA 1HE8A 1P9DU 1WM2A 3BINA 1GC6A 3A4SC 1ISNA 2MBEA 3PTFC 2Z59B 3Q3FA 3JSVA 1SGHA 3QHTA 1G6JA 3VTUA 4ICUA 1WMHA 2D11A 4ANVA 5HKHA 3ZNID 2FCSA 2L8JA 2MP2B 5D7GA 4GSWA 3S2AA 3HM6X 2LI5A 4TV3A 1BT0A 1YD8U 1WFYA 2AWTA 2REXA 3OJ3A 2Z0DB 1IP9A 2K6DB 2N1WA 3PRPB 2C60A 2KO3A 2DYMA 4IWPA 2DZJA 2ZNVB 2DHZA 2KWCA 3H1UA 2CHXA 1WX9A 4IG7B 4NY0A 1P1AA 1UBIA 1D3ZA 3H6NA 5DPRA 3U30A 5E6OA 1GC7A 2CU1A 2GBMA 2XK5B 3L54A 2V3SA 3N30A 2ZJDA 4GDLA 2MRPA 2DAFA 3CSFA 3QC8B 1I42A 3CF6E 3A9JB 4LCDE 5LXHA 4BBNF 4KSKC 1WXMA 4G3XB 2KOXA 3ML9A 4GB9A 1OEYJ 1H4RA 2K8BA 3VAWA 4OVVA 1YQBA 3RUIB 2J0MA 2JRIB 3L10B 1NDDA 2BGFA 4KZCA 5JH5C 1YX6B 3PHXB 1TGZB 5CHFA 3DVNU 3JSVB 4HDOA 3EFUA 3JW0X 4WJOA 2KFJA 3UQBA 4EEWA 3DBSA 2FUHB 4RM8A 3K9PB 3HHMA 3ZLZA 4KDIC 4NPNA 1XD3B 5BO4B 3M62B 2GBKA 2KMCA 2BPSA 2CKHB 4FULA 2MWSB 2NVUI 2ZZPB 4W9CA 4BKTA 2DYOA 5EDSA 1LFDA 1E7UA 2C7MB 1JRUA 3UIOB 2WYQA 2FCMA 4ZRJA 3Q3JA 5C1ZA 5AZGA 2AEHA 1KM7A 1WZ3A 4NAWB 1WH3A 2BF8B 1E7VA 4BOZB 2FIFA 1Y8RC 4W9FA 1E8ZA 3RCZA 2C5LC 3VH3B 1UGMA 2MLBA 2K8CA 5DPSA 4DK5A 4AOFA 5LLIA 3TJPA 2XK5A 2NBWB 1LQBA 2KDBA 2C7NB 4X57B 3VTVA 1V5OA 4GOCA 4NJ7A 3ZVVA 3X0WA 2JF5A 4GDLB 4XX5A 2DZIA 3ZRFA 4BKSA 3BY4B 2BYEA 2L05A 3QWZB 4XC2A 3VDZA 1WJ6A 1WRDB 3QX1A 4HJKA 3K9OB 1AARA 2NR2A 4MELA 2DZMA 2ZCCA 1CMXB 2O6VA 4KV2A 1WY8A 4LDTB 4DHZB 1V2YA 4W9LA 1PQSA 4W9EA 5GMVA 2D3GA 4FHJA 4A3OA 2MBOA 3MJWA 2LXCA 4MGZE 2DAJA 3ENEA 4DBGA 2MX2A 3OLMD 3DBHI 1EO6A 2BKRB 3L0WB 2XBBC 3M95A 3PV1A 2M0XA 2MW5A 4I6PA 3HM3A 1GJZA 1H8CA 1V80A 5KHOA 4DHJB 3X23A 1RLFA 2KFKA 3VXWA 2KNBA 4B95A 1XQQA 4MGYE 3H9DA 3GZNI 3OAWA 1J0GA 2GBRA 5CHWA 4WQOB 4MH0E 2LWPA 3NY5A 1TZ1A 2YVCA 4E74A 5KHQA 4NJ6A 5J2RA 1WX8A 2MSED 3KH0A 1RRBA 3RYTA 5AEKB 1WMHB 3DCGA 3VQIA 4WJPA 2IY1B 4IW0A 2KX0A 2K8HA 4EOYA 2O2VB 4MJSA 2M8SA 2MP2A 2N7DA 3AU4A 3C0RB 4HDQA 1ZGUB 2GMIC 3DQVA 2KX3A 3PRZA 3DVGX 1SIFA 2MCNB 2FCQA 4ICVA 4IWQA 3R7QA 5JZEB 2WWZA 1E5WA 4FJYA 3KYCD 4WJNA 2CR5A 4TQ1A 3APDA 1M94A 2A4ZA 3AU5A 2IY0B 1Q5WB 1J19A 4M0WB 2N9XA 3PGEA 3KUDB 4DDGD 4HWIB 3T8MA 3DBRI 4FJVB 2K39A 4KZ0A 5LXIB 2KN5A 2ZCBA 4URKA 3VUWA 3NS8A 3A9JA 2KC2A 2OOBB 2ZPNA 4IM0A 4EZLA 4AJWA 2Y5BB 2FNJB 3PVLA 3UF8A 2KANA 5IA7A 1V9JA 4IM2A 2IO3B 2JZ3B 2LZ6A 1S1QB 4WJQA 2KJ6A 4P7IA 2L76A 4ANWA 2WDTB 1WI0A 1WM3A 3QIJA 4PS8A 2KDIA 3H7SA 2LUEA 2LGXA 4W9DA 2ZVNA 3B1LX 4GDKA 1NBFC 2LRUA 2R2QA 1WGYA 2JT4B 3KYDD 2G45B 4ASWC 4CHKA 3HIZA 2NS5A 2O2VA 2PPHA 4MJSB 1E8WA 3A9KA 2LD9A 1WR6E 3VVWB 1WR1A 2JVCA 4DWFA 3IG3A 4K7UA 4A3PA 1NI2A 4W9JA 4XZ4A 4HK2A 4G11A 3DPDA 1FXTB 4IM3A 4AUQC 3WAPA 2W9NA 4NAWA 4E3CA 3V61A 4AJYB 4CO7A 2LGDA 2O6VD 3R3MA 4J6IA 4LDTD 4BKGA 3DVNV 4FJZA 2L00B 1YX5B 1LXDA 2JRHA 2KDFB 2ZEQA 3VUXA 2KTFA 3DDCB 2HTHA 1OEYA 3QK0A 2ZPYA 3VH4B 4GMVA 1P0RA 1WF9A 3KUZA 2L7RA 1ZKHA 1OTRB 2UWQA 4JIOU 2JWZA 2NPTA 3UIPB 4DHJD 3V6EB 3U7DA 4TKNA 2OJRA 2RR9A 1K8RB 1IYFA 2KJHB 2L0FA 1UH6A 2RD0A 3V6CB 3ZRCA 4B6WA 2O6VB 4DHZE 2MBHA 2GOWA 3WAMA 2IO1B 2V4LA 1WIAA 3P2BA 5L95C 1WGDA 3L08A 4IWOA 5D2MB 4EUTA 1OGWA 1V86A 4M8NA 1WJNA 1P98A 5AZHA 2DX5B 2G4SA 1L2NA 3VHTC 5J17A 1QZEA 1RAXA 2GBJA 4FHKA 4FBJB 1RFAA 4GGQA 2DZKA 2J7QB 4MDKE 2PJHA 1UELA 3GOEA 4TUUA 1Q1OA 4ZYNA 2UYZB 3B0AA 4HLEA 1V49A 4M8MA 4KIKA 3R66C 3ZDTA 3IBEA 4HPMB 1S3SG 3QAQA 2XEWA 3T9LA 3ZW3A 4MSQB 3ECIA 3L13A 3O65B 4EZKA 1WJ4A 4PS7A 1E8YA 4GU2A 4FLHA 4WWOA 5D94A 4A20A 2FCNA 5DPTA 3NHEB 3PSEB 3WALA 5CHVC 4ZRIA 3RZFA 4MM3A 5C23A 2LGYA 4K7WA 2LASA 3A33B 3A1QA 3IHPC 4W9HA 3U8ZA 2MBQA 4MGIE 4PS3A 2D2QA 1R4NI 3CSTA 4FADA 2IZVB 3CMMB 3W1YA 3PLVA 4HPLB 1UBQA 2IO0B 4G50A 4MGKE 3ZNZB 4HCNB 2N9PC 2RGFA 4JGHB 3PHWB 5E6PA 3TL5A 4F1SA 2G4DB 2LJ5A 3DOWA 3N3KB 4EFOA 3VTWA 2A5UA 3LJ3A 3N32A 5AZFA 2WX1A 3V60A 4HCPB 3KVFB 1SE9A 4ZRKA 3WANA 1WE7A 2EKEC 2HE7A 3PPAA 1WGRA 2FIDA 3SHQA 4IC7B 2DENB 2LVQA 3ALBA 1E90A 2BWFA 4GN1A 1GG3A 4FA6A 1T0YA 3WAOA 1X1MA 1EF5A 3IVFA 3QA8A 4GDKB 2I1KA 4KDLB 1L7YA 2C9WB 3ZO5B 3UQAA 3AXCA 3QARA 4OVUA 2PE6B 3RD2A 2M17A 3APFA 4CYEA 5J18A 3A9KB 2K6QA 2D10A 3ZDMC 5JHBA 5L83A 2KQSA 2KWVB 2L3ZA 4I6LB 1A5RA 3PLUA 2KTRB 3APCA 2VRRB 4I6NB 1WGHA 3L17A 2M1MA 3ZTCA 4B9KA 1YJ1A 2ZNVC 3PT2B 4DDID 3L16A 1MG8A 2C7HA 4JL9A 5CTRC 3TBLD 2BWES 2JY6A 2BYVE 2EMSA 1R4MI 2GBNA 4LJPB 4WWPA 4KVGB 3SDLC 4AP4C 2RPQA 4HVBA 3PZDA 2JPHA 3AI5A 1TTNA 4ZDVA 1U4AA 3H7PA 1V5TA 4WWNA 4W9KA 2NPTB 1TBEA 1WGGA 1J8CA 4K1RB 2D07B 2KHWB 4EKUA 4BBNC 5DPWA 4F8CB 3QJZA 1WXAA 2PEAA 3IFWB 3NZSA 1VCBA 1WZ0A 2J0KA 3WA0A 2MBBB 4F7ZA 1LM8B 2KQ7A 2NCNA 2KVRA 1UD7A 2JUOA 3EECA 4RM9A 1V81A 3W1SC 3TIXA 5CX3A 2CHZA 2KDEB 3ONSA 3R7RA 2KJRA 4MEMA 3QQ8B 3ZIMA 3TMPB 3JYUA 1OQYA 2R2OA 4W9GA 2KK8A 1Q0WB 1ZW7A 2MA9B 2I1JA 2FAZA 1WXSA 4KIKB 3W1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6E A;  3ZUN A;  1KJT A;  4AWJ A;  1WJU A;  4NQL B;  3DVG Y;  2K25 A;  3HK0 A;  1WE6 A;  3ZNG C;  4II3 B;  5G55 A;  5IAA C;  2N7E A;  2NBU A;  5JHA A;  4GIV A;  4BKS D;  1I35 A;  3M63 B;  2IBI B;  2LXA A;  1UZX B;  4PYZ A;  3KUC B;  2AL6 A;  3SU8 X;  3V62 A;  4ANU A;  4K81 A;  1WYW B;  2KZR A;  2ASQ A;  4E71 A;  1GUA B;  2B3A A;  3LDZ E;  4KSL C;  3ZNH B;  1Z5S B;  4GXB A;  2IYD B;  3A1Q B;  3UIN B;  3VUY A;  4LJO B;  2IO2 B;  5D6J B;  2BYF A;  3QCA A;  2KXJ A;  4N9F 4;  2ZVO A;  3PRE A;  2JXX A;  3WIM A;  4MSM B;  2KD0 A;  1XT9 B;  2N1V A;  2HJ8 A;  1GNU A;  3NZU A;  4G0N B;  1E8X A;  3A4R A;  2G3Q B;  1P3Q U;  5TR5 A;  3RUL A;  1KLV A;  4II2 B;  3M3J A;  4WAA A;  2AYO B;  2M4N A;  4NNJ B;  4JLC A;  1WXV A;  2LVO A;  4DXA B;  5G2N A;  1IPG A;  4EZJ A;  2KLC A;  4W9I A;  2PE9 A;  2L0T A;  1EF1 A;  3ZKJ C;  2CS4 A;  2KKC A;  3PRM B;  2BKF A;  3B08 A;  4RMA A;  2NBV B;  2KWU B;  2DYB A;  3JVZ X;  1C1Y B;  4ANX A;  3KW5 B;  2EMT A;  3MTN B;  4BFR A;  2LRW A;  4K7S A;  2LVP A;  3TCA A;  2KMA A;  4FN2 A;  2HD5 B;  3EC8 A;  4TQ0 A;  3NOB A;  3ML8 A;  2JZZ A;  2QHO A;  1WX7 A;  1VD2 A;  2KTR A;  3D32 A;  2K1F A;  3DBL I;  3RT3 B;  2RSU A;  1YIW A;  2CHW A;  2KC1 A;  1C3T A;  2MQJ A;  3UGB B;  3ZTD A;  2Z0E B;  5E6N A;  4PYU A;  4HXD A;  3SD5 A;  4BVU C;  1F9J A;  2YLM A;  5FR6 A;  3AUL A;  1KOT A;  4YL8 A;  2N4F A;  2AL3 A;  2WX0 A;  3I3T B;  4JQW C;  3PS6 A;  4NQK E;  1Z2M A;  4IUM B;  2J0J A;  3VFK A;  3EHV A;  1EUV B;  3H7P B;  2KFK B;  2N9E B;  3OJ4 B;  3RZW C;  3MHS D;  2V1Y A;  5DCN A;  4BOS C;  2KLG A;  1HE8 A;  1P9D U;  1WM2 A;  3BIN A;  1GC6 A;  3A4S C;  1ISN A;  2MBE A;  3PTF C;  2Z59 B;  3Q3F A;  3JSV A;  1SGH A;  3QHT A;  1G6J A;  3VTU A;  4ICU A;  1WMH A;  2D11 A;  4ANV A;  5HKH A;  3ZNI D;  2FCS A;  2L8J A;  2MP2 B;  5D7G A;  4GSW A;  3S2A A;  3HM6 X;  2LI5 A;  4TV3 A;  1BT0 A;  1YD8 U;  1WFY A;  2AWT A;  2REX A;  3OJ3 A;  2Z0D B;  1IP9 A;  2K6D B;  2N1W A;  3PRP B;  2C60 A;  2KO3 A;  2DYM A;  4IWP A;  2DZJ A;  2ZNV B;  2DHZ A;  2KWC A;  3H1U A;  2CHX A;  1WX9 A;  4IG7 B;  4NY0 A;  1P1A A;  1UBI A;  1D3Z A;  3H6N A;  5DPR A;  3U30 A;  5E6O A;  1GC7 A;  2CU1 A;  2GBM A;  2XK5 B;  3L54 A;  2V3S A;  3N30 A;  2ZJD A;  4GDL A;  2MRP A;  2DAF A;  3CSF A;  3QC8 B;  1I42 A;  3CF6 E;  3A9J B;  4LCD E;  5LXH A;  4BBN F;  4KSK C;  1WXM A;  4G3X B;  2KOX A;  3ML9 A;  4GB9 A;  1OEY J;  1H4R A;  2K8B A;  3VAW A;  4OVV A;  1YQB A;  3RUI B;  2J0M A;  2JRI B;  3L10 B;  1NDD A;  2BGF A;  4KZC A;  5JH5 C;  1YX6 B;  3PHX B;  1TGZ B;  5CHF A;  3DVN U;  3JSV B;  4HDO A;  3EFU A;  3JW0 X;  4WJO A;  2KFJ A;  3UQB A;  4EEW A;  3DBS A;  2FUH B;  4RM8 A;  3K9P B;  3HHM A;  3ZLZ A;  4KDI C;  4NPN A;  1XD3 B;  5BO4 B;  3M62 B;  2GBK A;  2KMC A;  2BPS A;  2CKH B;  4FUL A;  2MWS B;  2NVU I;  2ZZP B;  4W9C A;  4BKT A;  2DYO A;  5EDS A;  1LFD A;  1E7U A;  2C7M B;  1JRU A;  3UIO B;  2WYQ A;  2FCM A;  4ZRJ A;  3Q3J A;  5C1Z A;  5AZG A;  2AEH A;  1KM7 A;  1WZ3 A;  4NAW B;  1WH3 A;  2BF8 B;  1E7V A;  4BOZ B;  2FIF A;  1Y8R C;  4W9F A;  1E8Z A;  3RCZ A;  2C5L C;  3VH3 B;  1UGM A;  2MLB A;  2K8C A;  5DPS A;  4DK5 A;  4AOF A;  5LLI A;  3TJP A;  2XK5 A;  2NBW B;  1LQB A;  2KDB A;  2C7N B;  4X57 B;  3VTV A;  1V5O A;  4GOC A;  4NJ7 A;  3ZVV A;  3X0W A;  2JF5 A;  4GDL B;  4XX5 A;  2DZI A;  3ZRF A;  4BKS A;  3BY4 B;  2BYE A;  2L05 A;  3QWZ B;  4XC2 A;  3VDZ A;  1WJ6 A;  1WRD B;  3QX1 A;  4HJK A;  3K9O B;  1AAR A;  2NR2 A;  4MEL A;  2DZM A;  2ZCC A;  1CMX B;  2O6V A;  4KV2 A;  1WY8 A;  4LDT B;  4DHZ B;  1V2Y A;  4W9L A;  1PQS A;  4W9E A;  5GMV A;  2D3G A;  4FHJ A;  4A3O A;  2MBO A;  3MJW A;  2LXC A;  4MGZ E;  2DAJ A;  3ENE A;  4DBG A;  2MX2 A;  3OLM D;  3DBH I;  1EO6 A;  2BKR B;  3L0W B;  2XBB C;  3M95 A;  3PV1 A;  2M0X A;  2MW5 A;  4I6P A;  3HM3 A;  1GJZ A;  1H8C A;  1V80 A;  5KHO A;  4DHJ B;  3X23 A;  1RLF A;  2KFK A;  3VXW A;  2KNB A;  4B95 A;  1XQQ A;  4MGY E;  3H9D A;  3GZN I;  3OAW A;  1J0G A;  2GBR A;  5CHW A;  4WQO B;  4MH0 E;  2LWP A;  3NY5 A;  1TZ1 A;  2YVC A;  4E74 A;  5KHQ A;  4NJ6 A;  5J2R A;  1WX8 A;  2MSE D;  3KH0 A;  1RRB A;  3RYT A;  5AEK B;  1WMH B;  3DCG A;  3VQI A;  4WJP A;  2IY1 B;  4IW0 A;  2KX0 A;  2K8H A;  4EOY A;  2O2V B;  4MJS A;  2M8S A;  2MP2 A;  2N7D A;  3AU4 A;  3C0R B;  4HDQ A;  1ZGU B;  2GMI C;  3DQV A;  2KX3 A;  3PRZ A;  3DVG X;  1SIF A;  2MCN B;  2FCQ A;  4ICV A;  4IWQ A;  3R7Q A;  5JZE B;  2WWZ A;  1E5W A;  4FJY A;  3KYC D;  4WJN A;  2CR5 A;  4TQ1 A;  3APD A;  1M94 A;  2A4Z A;  3AU5 A;  2IY0 B;  1Q5W B;  1J19 A;  4M0W B;  2N9X A;  3PGE A;  3KUD B;  4DDG D;  4HWI B;  3T8M A;  3DBR I;  4FJV B;  2K39 A;  4KZ0 A;  5LXI B;  2KN5 A;  2ZCB A;  4URK A;  3VUW A;  3NS8 A;  3A9J A;  2KC2 A;  2OOB B;  2ZPN A;  4IM0 A;  4EZL A;  4AJW A;  2Y5B B;  2FNJ B;  3PVL A;  3UF8 A;  2KAN A;  5IA7 A;  1V9J A;  4IM2 A;  2IO3 B;  2JZ3 B;  2LZ6 A;  1S1Q B;  4WJQ A;  2KJ6 A;  4P7I A;  2L76 A;  4ANW A;  2WDT B;  1WI0 A;  1WM3 A;  3QIJ A;  4PS8 A;  2KDI A;  3H7S A;  2LUE A;  2LGX A;  4W9D A;  2ZVN A;  3B1L X;  4GDK A;  1NBF C;  2LRU A;  2R2Q A;  1WGY A;  2JT4 B;  3KYD D;  2G45 B;  4ASW C;  4CHK A;  3HIZ A;  2NS5 A;  2O2V A;  2PPH A;  4MJS B;  1E8W A;  3A9K A;  2LD9 A;  1WR6 E;  3VVW B;  1WR1 A;  2JVC A;  4DWF A;  3IG3 A;  4K7U A;  4A3P A;  1NI2 A;  4W9J A;  4XZ4 A;  4HK2 A;  4G11 A;  3DPD A;  1FXT B;  4IM3 A;  4AUQ C;  3WAP A;  2W9N A;  4NAW A;  4E3C A;  3V61 A;  4AJY B;  4CO7 A;  2LGD A;  2O6V D;  3R3M A;  4J6I A;  4LDT D;  4BKG A;  3DVN V;  4FJZ A;  2L00 B;  1YX5 B;  1LXD A;  2JRH A;  2KDF B;  2ZEQ A;  3VUX A;  2KTF A;  3DDC B;  2HTH A;  1OEY A;  3QK0 A;  2ZPY A;  3VH4 B;  4GMV A;  1P0R A;  1WF9 A;  3KUZ A;  2L7R A;  1ZKH A;  1OTR B;  2UWQ A;  4JIO U;  2JWZ A;  2NPT A;  3UIP B;  4DHJ D;  3V6E B;  3U7D A;  4TKN A;  2OJR A;  2RR9 A;  1K8R B;  1IYF A;  2KJH B;  2L0F A;  1UH6 A;  2RD0 A;  3V6C B;  3ZRC A;  4B6W A;  2O6V B;  4DHZ E;  2MBH A;  2GOW A;  3WAM A;  2IO1 B;  2V4L A;  1WIA A;  3P2B A;  5L95 C;  1WGD A;  3L08 A;  4IWO A;  5D2M B;  4EUT A;  1OGW A;  1V86 A;  4M8N A;  1WJN A;  1P98 A;  5AZH A;  2DX5 B;  2G4S A;  1L2N A;  3VHT C;  5J17 A;  1QZE A;  1RAX A;  2GBJ A;  4FHK A;  4FBJ B;  1RFA A;  4GGQ A;  2DZK A;  2J7Q B;  4MDK E;  2PJH A;  1UEL A;  3GOE A;  4TUU A;  1Q1O A;  4ZYN A;  2UYZ B;  3B0A A;  4HLE A;  1V49 A;  4M8M A;  4KIK A;  3R66 C;  3ZDT A;  3IBE A;  4HPM B;  1S3S G;  3QAQ A;  2XEW A;  3T9L A;  3ZW3 A;  4MSQ B;  3ECI A;  3L13 A;  3O65 B;  4EZK A;  1WJ4 A;  4PS7 A;  1E8Y A;  4GU2 A;  4FLH A;  4WWO A;  5D94 A;  4A20 A;  2FCN A;  5DPT A;  3NHE B;  3PSE B;  3WAL A;  5CHV C;  4ZRI A;  3RZF A;  4MM3 A;  5C23 A;  2LGY A;  4K7W A;  2LAS A;  3A33 B;  3A1Q A;  3IHP C;  4W9H A;  3U8Z A;  2MBQ A;  4MGI E;  4PS3 A;  2D2Q A;  1R4N I;  3CST A;  4FAD A;  2IZV B;  3CMM B;  3W1Y A;  3PLV A;  4HPL B;  1UBQ A;  2IO0 B;  4G50 A;  4MGK E;  3ZNZ B;  4HCN B;  2N9P C;  2RGF A;  4JGH B;  3PHW B;  5E6P A;  3TL5 A;  4F1S A;  2G4D B;  2LJ5 A;  3DOW A;  3N3K B;  4EFO A;  3VTW A;  2A5U A;  3LJ3 A;  3N32 A;  5AZF A;  2WX1 A;  3V60 A;  4HCP B;  3KVF B;  1SE9 A;  4ZRK A;  3WAN A;  1WE7 A;  2EKE C;  2HE7 A;  3PPA A;  1WGR A;  2FID A;  3SHQ A;  4IC7 B;  2DEN B;  2LVQ A;  3ALB A;  1E90 A;  2BWF A;  4GN1 A;  1GG3 A;  4FA6 A;  1T0Y A;  3WAO A;  1X1M A;  1EF5 A;  3IVF A;  3QA8 A;  4GDK B;  2I1K A;  4KDL B;  1L7Y A;  2C9W B;  3ZO5 B;  3UQA A;  3AXC A;  3QAR A;  4OVU A;  2PE6 B;  3RD2 A;  2M17 A;  3APF A;  4CYE A;  5J18 A;  3A9K B;  2K6Q A;  2D10 A;  3ZDM C;  5JHB A;  5L83 A;  2KQS A;  2KWV B;  2L3Z A;  4I6L B;  1A5R A;  3PLU A;  2KTR B;  3APC A;  2VRR B;  4I6N B;  1WGH A;  3L17 A;  2M1M A;  3ZTC A;  4B9K A;  1YJ1 A;  2ZNV C;  3PT2 B;  4DDI D;  3L16 A;  1MG8 A;  2C7H A;  4JL9 A;  5CTR C;  3TBL D;  2BWE S;  2JY6 A;  2BYV E;  2EMS A;  1R4M I;  2GBN A;  4LJP B;  4WWP A;  4KVG B;  3SDL C;  4AP4 C;  2RPQ A;  4HVB A;  3PZD A;  2JPH A;  3AI5 A;  1TTN A;  4ZDV A;  1U4A A;  3H7P A;  1V5T A;  4WWN A;  4W9K A;  2NPT B;  1TBE A;  1WGG A;  1J8C A;  4K1R B;  2D07 B;  2KHW B;  4EKU A;  4BBN C;  5DPW A;  4F8C B;  3QJZ A;  1WXA A;  2PEA A;  3IFW B;  3NZS A;  1VCB A;  1WZ0 A;  2J0K A;  3WA0 A;  2MBB B;  4F7Z A;  1LM8 B;  2KQ7 A;  2NCN A;  2KVR A;  1UD7 A;  2JUO A;  3EEC A;  4RM9 A;  1V81 A;  3W1S C;  3TIX A;  5CX3 A;  2CHZ A;  2KDE B;  3ONS A;  3R7R A;  2KJR A;  4MEM A;  3QQ8 B;  3ZIM A;  3TMP B;  3JYU A;  1OQY A;  2R2O A;  4W9G A;  2KK8 A;  1Q0W B;  1ZW7 A;  2MA9 B;  2I1J A;  2FAZ A;  1WXS A;  4KIK B;  3W1S A; 
#chains in the Genus database with same CATH topology
 1V6E A;  4WQM A;  1VZ7 A;  3DVG Y;  2X8X X;  4II3 B;  2I38 A;  1TJE A;  1ACC A;  3RN9 C;  2Y5P A;  1I35 A;  3DWG C;  2AL6 A;  3FAH A;  3NS1 A;  4CQN A;  2ASQ A;  3GP7 A;  4E71 A;  3LDZ E;  5FKA C;  3HVD A;  1Z5S B;  4GXB A;  3UIN B;  3QCA A;  1UWX A;  2MHJ A;  2JXX A;  1MVK A;  2W3S A;  4G0N B;  1V1O A;  1P3Q U;  3M3J A;  3P4R B;  4JLC A;  1C78 A;  3N20 C;  1BUI C;  3AE2 B;  5G2N A;  2KLC A;  4W9I A;  4ARI A;  3ZKJ C;  2BKF A;  3B2F A;  2KWU B;  3JVZ X;  1C1Y B;  4ANX A;  2LRW A;  4K7S A;  4S17 A;  2KMA A;  1QOF A;  3EC8 A;  1YOV B;  1ZDX A;  3P63 A;  4O1N A;  3ZQ4 A;  2WXP A;  1FPY A;  2CHW A;  1TT5 B;  5G5G A;  2WXG A;  1HZ6 A;  2MQJ A;  3MC0 B;  3ZTD A;  1SEB D;  4BVU C;  1D6E C;  2N4F A;  4JQW C;  3PS6 A;  1EUV B;  2N9E B;  3N9Y C;  2V1Y A;  5FR3 A;  3R2I A;  5DCN A;  4B0M A;  2KLG A;  2V0G A;  1WM2 A;  1T0R C;  3JSV A;  3P1M A;  2BS3 B;  1J7B A;  2HTM E;  1BT0 A;  1M4V A;  1WFY A;  2REX A;  1OQQ A;  3OJ3 A;  3NZ3 A;  2OED A;  4YTM B;  2M0A A;  2H88 B;  2DYM A;  2H89 B;  3H1U A;  1HZ5 A;  2CHX A;  1WX9 A;  4IG7 B;  1P1A A;  1D3Z A;  3H6N A;  5DPR A;  3W9C B;  1TKG A;  1TY2 A;  2SEB D;  2VZK D;  2CU1 A;  5E6O A;  2V3S A;  4BZA A;  4KKI A;  4RCO A;  4BAX A;  1HA5 A;  3A9J B;  4LCD E;  5LXH A;  4BBN F;  1WXM A;  4G3X B;  1H4R A;  4MT5 A;  4QAY A;  1NEK B;  3RUI B;  4KZC A;  3BVM A;  5CHF A;  1GAQ B;  3DBS A;  1CZP A;  3K9P B;  1F1H A;  3HHM A;  4KDI C;  3ZLZ A;  4JE3 B;  4FUL A;  2J42 A;  4W9C A;  1MHH E;  3I5J C;  2WYQ A;  3T3N A;  2FCM A;  1BML C;  1KM7 A;  3HRD D;  4NAW B;  2JYE A;  5EE0 A;  4WH4 A;  3BII D;  2FIF A;  2LGS A;  3FKY A;  4W9F A;  3VH3 B;  3U4E G;  2K8C A;  4YWG G;  2NBW B;  1LQB A;  1HXY D;  2AQ2 B;  3X0W A;  2JF5 A;  4XX5 A;  3OWE B;  3SFE B;  5EE3 A;  1WRD B;  3K9O B;  4HRO A;  2DZM A;  1CMX B;  2O6V A;  1PQS A;  4FHJ A;  1PUT A;  2MBO A;  3MJW A;  2IGD A;  2LXC A;  2MX2 A;  5HFY A;  3DBH I;  3EGR A;  2LJI A;  3ZXR A;  1ZPS A;  3HM3 A;  1V80 A;  5KHO A;  3VXW A;  3H9D A;  3NY5 A;  4E74 A;  5IO9 A;  1WX8 A;  3I63 C;  3DCG A;  4WJP A;  4EOY A;  2G9H D;  2N7D A;  4LK0 M;  3AU4 A;  1N60 A;  1UNS A;  2DLB A;  2KX3 A;  3PRZ A;  1YN3 A;  4IWQ A;  2WWZ A;  4FJY A;  4WJN A;  1EM7 A;  1IGD A;  2A4Z A;  3AU5 A;  1J19 A;  5FK9 C;  3PGE A;  1C4A A;  2IPK D;  2D3A A;  4NJC A;  1L4Z B;  2FNJ B;  2IO3 B;  2LZ6 A;  2D5G A;  2KJ6 A;  1JWB D;  4P7I A;  2WDT B;  1QLB B;  3PZ7 A;  1D5M C;  2KDI A;  3H7S A;  3OG5 A;  2LUE A;  3PZ8 A;  4H2A A;  2ZVN A;  4PT5 A;  2LRU A;  1WGY A;  2JT4 B;  4ASW C;  1V8C A;  4OHJ A;  2NS5 A;  3A9K A;  2LD9 A;  1WR1 A;  4K7U A;  4XZ4 A;  4HK2 A;  4IM3 A;  4AUQ C;  4E3C A;  4HJG E;  2W9N A;  4NAW A;  4AJY B;  2CJN A;  4J6I A;  4JX1 C;  4FJZ A;  2MEK A;  1LXD A;  2KDF B;  4JWS C;  1OEY A;  2ZPY A;  4LNN A;  3VH4 B;  3KUZ A;  1JAL A;  2N0S B;  2JWZ A;  2NPT A;  3V6E B;  4A55 A;  1T0S C;  2OJR A;  2J53 A;  2M56 B;  2KJH B;  3ZRC A;  2MBH A;  3WAM A;  1SSN A;  4IWO A;  1OGW A;  4M8N A;  1WJN A;  1SB3 C;  3VHT C;  4ZYS A;  3AEB B;  4FHK A;  4GGQ A;  2DZK A;  3AN1 A;  1FNW A;  4AS1 A;  3IBE A;  3QAQ A;  1K53 A;  3UI3 A;  2PVG C;  1TS5 A;  1E8Y A;  4YT0 B;  3AE5 B;  4M00 A;  3PSE B;  4RH6 A;  3WAL A;  5MPO A;  2PMV A;  4W9H A;  3BK2 A;  4MGI E;  2N9K A;  1R4N I;  2IZV B;  3W1Y A;  3DBR B;  5IKC M;  1UBQ A;  2I2Y A;  3DOW A;  3MP9 A;  2A5U A;  1QOA A;  2WX1 A;  3B2G A;  1WRI A;  4N6E B;  2JWU A;  2HE7 A;  2FID A;  3AED B;  1RYJ A;  4RGM A;  2LVQ A;  2PVO D;  1E90 A;  2BWF A;  3J9C A;  3WAO A;  1D5X C;  1EF5 A;  3CIR B;  4GDK B;  3R2T A;  3MHZ A;  3VR9 B;  1MI0 A;  5BYQ A;  2M17 A;  2QIE B;  2D10 A;  2CU3 A;  5L83 A;  3GE3 C;  1CQV A;  3ZJU A;  2QDF A;  2N7J A;  3APC A;  1HTQ A;  3DHG C;  4XGA B;  3L16 A;  2VZK B;  2JY6 A;  1NI3 A;  3PO0 A;  2GBN A;  3BZD B;  4WWP A;  4KVG B;  4ZDV A;  1V5T A;  2NPT B;  1WGG A;  1J8C A;  4BBN C;  1IUE A;  4F8C B;  1VCB A;  2MBB B;  1NYQ A;  2KQ7 A;  2NCN A;  3N1Z C;  2DWQ A;  3TIX A;  4TMA B;  2ZW1 A;  4KGS A;  1XLN A;  3KQ4 A;  2GI9 A;  1OQY A;  1F77 A;  2KK8 A;  1Q0W B;  4KIK B;  3ZUN A;  1KJT A;  3ZJT A;  1WJU A;  3HK0 A;  1WE6 A;  5G55 A;  1EU3 A;  2N7E A;  2LHE A;  5EE9 A;  5IAA C;  3EUB 2;  2LGI A;  2EEL A;  1IBX B;  4XWW A;  3SU8 X;  1WYW B;  3A1Q B;  3MFG A;  1LGR A;  4LJO B;  2IO2 B;  4N9F 4;  2HJ1 A;  1N6Z A;  3PRE A;  4MSM B;  2N1V A;  1XLO A;  1P7F A;  3A4R A;  5TR5 A;  4ACF A;  1KLV A;  3GS2 A;  1VRA B;  1QIL A;  2AYO B;  1SF0 A;  2M4N A;  4NNJ B;  4M01 A;  4EZJ A;  2RPV A;  4ITK A;  2L0T A;  4OVZ A;  4RMA A;  2RMM A;  4YTP B;  1QQR A;  2KT7 A;  2K9X A;  3TCA A;  4FN2 A;  1XO3 A;  2HD5 B;  2IGG A;  2JZZ A;  1E9M A;  3P4S B;  2K1F A;  3RT3 B;  4RGN A;  1YIW A;  1C3T A;  2R61 A;  3NG0 A;  5E6N A;  2WHI A;  1FEH A;  5FR6 A;  5E6J A;  2WX0 A;  3I3T B;  1MG4 A;  4IUM B;  5AUI A;  1FIQ A;  3H7P B;  2KFK B;  3MHS D;  1R4N B;  2V4I B;  1HE8 A;  1P9D U;  2L1A A;  1GC6 A;  1C4C A;  1TY0 A;  3Q6B A;  3PTF C;  3Q3F A;  3NVV A;  4ICU A;  4D2K A;  1KLU D;  2JZP A;  1WMH A;  1FFV A;  1YQ3 B;  4ANV A;  3IT6 B;  2WU5 B;  2L32 A;  1J7C A;  1TYG B;  2WXH A;  1YD8 U;  2AWT A;  2Z0D B;  1IP9 A;  2WXK A;  2N1W A;  3FIL B;  2ZNV B;  4M0W A;  3WCQ A;  2GBM A;  2XK5 B;  1FRD A;  1KLG D;  2ZJD A;  3NVY A;  3RNA C;  4RGT A;  4GB9 A;  2IGH A;  1PFD A;  4HKZ E;  2JRI B;  2MH7 A;  2BGF A;  1YX6 B;  1PYW D;  1TGZ B;  5H8Y E;  3JSV B;  4HDO A;  4WJO A;  2FUH B;  4J3O D;  4RM8 A;  2W55 A;  4US9 A;  2QIL A;  1P7E A;  2L83 A;  3M62 B;  4YTN B;  5D3I B;  2CKH B;  1PGB A;  2INC C;  4P1C C;  3Q8A A;  3IT4 B;  1CJE A;  2AX5 A;  1JRU A;  2BQQ A;  4ZRJ A;  3DHH C;  5AZG A;  1WZ3 A;  3RNF C;  4BOZ B;  2J52 A;  1DGJ A;  3V05 A;  5DPS A;  3TJP A;  1UGJ A;  2XK5 A;  2KDB A;  2C7N B;  1F52 A;  4NJ7 A;  2BYE A;  3QWZ B;  4IKG A;  1WJ6 A;  2EKI A;  1AAR A;  2NR2 A;  3ZYY X;  2ICI A;  4DHZ B;  4LDT B;  1V2Y A;  4W9L A;  4W9E A;  5GMV A;  2D3G A;  3NRZ A;  1JWS D;  1EO6 A;  2HDE A;  2BKR B;  2WQY B;  3AEC B;  1GJZ A;  1RLF A;  3GZN I;  2GBR A;  4LNO A;  3MC9 A;  2MJE A;  1TZ1 A;  5KHQ A;  4NJ6 A;  2MSE D;  1RRB A;  2W82 A;  3BWU D;  3Q8E A;  4WWM A;  3H8H A;  2K8H A;  4MJS A;  2O2V B;  2M8S A;  4HDQ A;  1ZGU B;  2GMI C;  3DQV A;  2MCN B;  4ZRQ A;  4TQ1 A;  3APD A;  2IY0 B;  1Q5W B;  1GB4 A;  3R8B A;  3BVZ A;  5HHD G;  3VUW A;  3NS8 A;  4EZL A;  4YSZ B;  3PVL A;  5IA7 A;  1BXT A;  1E10 A;  1AN8 A;  2JZ3 B;  4LTU A;  1S1Q B;  2FBW B;  4A9A A;  3TEZ A;  2LGX A;  2WXI A;  2G45 B;  3HIZ A;  2PPH A;  2O2V A;  4MJS B;  2AQ1 B;  4KX6 B;  4DWF A;  3P4Q B;  4G11 A;  4OZC A;  1E0Z A;  3AMZ A;  4LDT D;  4BKG A;  2ZW0 A;  1SE3 A;  2KMM A;  2JRH A;  3VUX A;  2ON8 A;  2K0P A;  3DDC B;  4GMV A;  1P0R A;  3Q3N C;  1TKY A;  2L7R A;  2PIA A;  2UWQ A;  4JIO U;  5AUK A;  3UIP B;  4DHJ D;  1L4D B;  3U7D A;  2XN9 C;  4TKN A;  2RR9 A;  1K8R B;  3V6C B;  2E6X A;  3P2B A;  3RNB C;  4OW0 A;  1XEE A;  1V86 A;  4JWU C;  1T0Q C;  5J17 A;  1QZE A;  4FBJ B;  3GZN B;  2RDH A;  4TUU A;  1Q1O A;  4M8M A;  3Q3O C;  3R66 C;  3Q8B A;  1D4B A;  3T9L A;  1I4P A;  4MSQ B;  1YQ4 B;  4P1B C;  3NVW A;  4WWO A;  3URY A;  2W54 A;  3LB8 C;  1L0Y B;  1L6U A;  3NHE B;  1AYF A;  5CHV C;  4ZRI A;  1VLB A;  1L5P A;  3BK1 A;  2LMC A;  3A33 B;  3IHP C;  3A1Q A;  3U8Z A;  2MBQ A;  3CWI A;  1K50 A;  2QC8 A;  2WXR A;  4Q2J A;  3CST A;  4FAD A;  2WS3 B;  5HG2 A;  3W5U B;  4HCN B;  2N9P C;  5E6P A;  2G4D B;  3N3K B;  3T3O A;  5IP4 D;  5AZF A;  1KH0 A;  3V60 A;  3KVF B;  3DBL B;  2N9L A;  3Q2A C;  3W5V B;  1WE7 A;  3PPA A;  1WGR A;  4IC7 B;  1FD6 A;  2KN4 A;  3IVF A;  3QA8 A;  2YEP F;  3ZO5 B;  2KAC A;  3AXC A;  4CYE A;  4XYC A;  4JPS A;  1ZXH A;  2KTR B;  2VRR B;  2WDQ B;  4LNI A;  3PT2 B;  1E7P B;  2C7H A;  5BMI A;  2BWE S;  2BYV E;  2EMS A;  1JQ4 A;  3H7P A;  4W9K A;  2QCZ A;  5DPW A;  1L0X B;  1WXA A;  2PEA A;  3IFW B;  3NZS A;  2LHD A;  2J0K A;  4KKJ A;  1LM8 B;  2WXN A;  2KVR A;  2B76 B;  4RM9 A;  2QMT A;  1V81 A;  3MC8 A;  2CHZ A;  2KDE B;  3ONS A;  2J4X A;  3R7R A;  3LYY A;  4MEM A;  4RF0 A;  4REZ A;  2MA9 B;  2FAZ A;  2Q5W D;  2FE8 A;  3Q8F A;  4XDC A;  4NQL B;  3ZNG C;  1T3Q A;  2DBY A;  2IBI B;  2LXA A;  1UZX B;  2V3N A;  4K81 A;  2KZR A;  1GUA B;  1KTK A;  2IYD B;  2OJW A;  3VUY A;  4HPP A;  5D6J B;  3Q14 C;  1DOX A;  3WIM A;  2KD0 A;  1XT9 B;  3TEW A;  1E8X A;  1QF6 A;  2G3Q B;  3RUL A;  4II2 B;  1C9F A;  3VR8 B;  1WXV A;  1ET6 A;  1IPG A;  5JXV A;  2PE9 A;  2DNF A;  4S0R A;  2ACZ B;  2CS4 A;  1MHX A;  2VH1 A;  2NBV B;  2RDB C;  4C7Y A;  4XWT A;  1XLP A;  1FFU A;  3KW5 B;  2XNA C;  3MTN B;  3SFD B;  3GE8 C;  2LVP A;  1YN4 A;  2KVZ A;  1SJE D;  4TQ0 A;  3NOB A;  1TS3 A;  2KTR A;  3DBL I;  2KC1 A;  5LNK 1;  3RI7 C;  3SD5 A;  1F9J A;  3AUL A;  2AL3 A;  1MJD A;  4NQK E;  1QOB A;  3VFK A;  2J0J A;  2LEK A;  1PDX A;  3EHV A;  3RZW C;  4BOS C;  5BYS A;  3A4S C;  1KF6 B;  1ISN A;  3AEA B;  3AE8 B;  3DWM A;  3AB5 A;  4WUR A;  2WXQ A;  3TUO A;  5HKH A;  2UU7 A;  2MJD A;  3AEF B;  2L8J A;  2WDV B;  5D7G A;  4GSW A;  3S2A A;  1YN5 A;  2PKO A;  2K6D B;  3NJT A;  2KO3 A;  3BYY B;  2KWC A;  4NY0 A;  1A70 A;  3U30 A;  5G5H A;  1GC7 A;  5BMH A;  3N30 A;  4GDL A;  1I42 A;  4KSK C;  3AE6 B;  2KOX A;  3ML9 A;  2K8B A;  3VAW A;  1FXA A;  2BT6 A;  1NDD A;  1I4G A;  5JH5 C;  3PHX B;  1XF5 L;  1ET9 A;  3BVG A;  3TSS A;  3U7Z A;  1XD3 B;  2GBK A;  2LUM A;  2G1E A;  4BKT A;  2C7M B;  3UIO B;  4AQ7 A;  5C1Z A;  2KYW A;  1FCL A;  4LNF A;  2BF8 B;  1HEZ E;  1E7V A;  1Y8R C;  1JRO A;  3RCZ A;  2C5L C;  4EE2 A;  1UGM A;  4AOF A;  5LLI A;  1ZUD 2;  3KLS X;  3KWL A;  4BKS A;  2L05 A;  1E6E B;  4C7Z A;  3QX1 A;  4HJK A;  4C56 C;  5I4D A;  4MEL A;  1AWD A;  2ZCC A;  3AEE B;  4UDU C;  4MGZ E;  3ENE A;  3OLM D;  4WIP A;  3NVZ A;  3M95 A;  2MW5 A;  3X23 A;  4B95 A;  2KNB A;  4MGY E;  1JCK B;  1XXG A;  5CHW A;  2WGS A;  1FM0 D;  2LWP A;  1FNU A;  1LO5 D;  3AEG B;  3RYT A;  5AEK B;  3VQI A;  2IY1 B;  4IW0 A;  1NVI D;  2KX0 A;  1ZP0 B;  2MP2 A;  4MM3 B;  3C0R B;  3E9S A;  1SIF A;  2FCQ A;  3KYC D;  2BTE A;  2JXT A;  4MAC A;  1FXI A;  2PW9 A;  1M94 A;  1SJH D;  2N9X A;  4DDG D;  3T8M A;  2GLS A;  3DBR I;  1STE A;  4FJV B;  3C8Y A;  2KN5 A;  3A9J A;  2KC2 A;  4IM0 A;  2ZPN A;  1NEN B;  1TZO A;  2Y5B B;  3UF8 A;  1V1P A;  2WU2 B;  3ETR A;  4HEA 1;  2NMQ A;  5C2T B;  2L76 A;  1WI0 A;  4PS8 A;  4GDK A;  1NBF C;  4TSS A;  3KYD D;  3AE3 B;  1PGX A;  3I57 A;  5T8I A;  1WR6 E;  2JX5 A;  2QSD A;  3IG3 A;  2BB6 A;  1FXT B;  3WAP A;  1RFK A;  1F0Z A;  2LGD A;  2O6V D;  3R3M A;  1YX5 B;  3N1X C;  2ZEQ A;  1QT9 A;  2KTF A;  1EWC A;  2Y5C A;  1KRH A;  5BYR A;  2K5P A;  1V1P B;  2O6V B;  2GOW A;  2IO1 B;  1N63 A;  1WGD A;  5D2M B;  3W2D A;  4EUT A;  4XDD A;  1P98 A;  2G4S A;  4P6V F;  4US8 A;  1B9R A;  1RAX A;  2TSS A;  1RFA A;  2PJH A;  3GOE A;  2BVC A;  4ZYN A;  3B0A A;  4KIK A;  3ZDT A;  1GPX A;  1SE2 A;  3ECI A;  3L13 A;  1HQR D;  3O65 B;  1WJ4 A;  2IJ0 A;  4EZK A;  4FLH A;  5D94 A;  3LXF A;  2FCN A;  5DPT A;  3RZF A;  4MM3 A;  2LGY A;  1DYQ A;  2LAS A;  3AV8 A;  2BS4 B;  1QOG A;  2LFI A;  4NZL B;  4M02 A;  3CMM B;  2BW2 A;  4L1B A;  2IO0 B;  4YSX B;  1UF0 A;  2RGF A;  3DHI C;  4JGH B;  4YXD B;  3TL5 A;  2LJ5 A;  4EFO A;  1XLQ A;  1FRR A;  4HCP B;  1SE9 A;  3WAN A;  1N62 A;  2EKE C;  3I9V 1;  3ALB A;  1JWA D;  1T0Y A;  1SBB B;  1RM6 C;  1X1M A;  3RMK C;  2I1K A;  1GOZ A;  4KDL B;  1L7Y A;  3UQA A;  2KDM A;  3QAR A;  4OVU A;  2PE6 B;  3RD2 A;  3APF A;  5J18 A;  4C80 A;  3ZDM C;  2L3Z A;  1A5R A;  2KAJ A;  3PLU A;  1D5Z C;  1I4X A;  5TSS A;  3ZTC A;  1YJ1 A;  2ZNV C;  4DDI D;  1VZ6 A;  4JL9 A;  5CTR C;  1FO4 A;  1IBX A;  2CJO A;  4YSY B;  3O13 A;  4FXC A;  4HVB A;  2JPH A;  1TTN A;  2D3B A;  1TBE A;  4A6Q A;  4K1R B;  1C77 A;  3IAS 1;  3WA0 A;  2AQ3 B;  1VDV A;  4F7Z A;  2BYT A;  3ABV B;  2INP E;  3EEC A;  3W1S C;  5CX3 A;  3E56 A;  2KJR A;  3TMP B;  3JYU A;  1OFF A;  1WXS A;  3W1S A;  1V97 A;  4AWJ A;  2K25 A;  2NBU A;  5JHA A;  4GIV A;  4BKS D;  3M63 B;  1B1Z A;  3FC4 A;  2MJ3 A;  4PYZ A;  3KUC B;  4ANU A;  5IOI A;  3V62 A;  4K3B A;  1JWM D;  2ONQ A;  2B3A A;  4KSL C;  2YEP B;  3RNE C;  3ZNH B;  3IAM 1;  2KWD A;  4C4V A;  1N61 A;  4XE0 A;  1GB1 A;  4OZA A;  4RGO S;  2BYF A;  2KXJ A;  2ZVO A;  1MPE A;  3VRB B;  1R7S A;  2HJ8 A;  1GNU A;  3NZU A;  3N1Y C;  1WGK A;  2WXL A;  4WAA A;  1JRP A;  4LLG M;  1K51 A;  2LVO A;  4DXA B;  1I4R A;  1TKE A;  1EF1 A;  1FCC C;  2KKC A;  4USA A;  3PRM B;  3B08 A;  1TS2 A;  3EFC A;  2DYB A;  1C4P A;  2EMT A;  4BFR A;  2WNM A;  1SIJ A;  1UWM A;  3ML8 A;  4ZHO A;  2K3U A;  1JWU D;  4C4V B;  2QHO A;  1WX7 A;  1VD2 A;  1FMA D;  3D32 A;  4MH8 A;  4DXF A;  2RSU A;  3HVZ A;  3UGB B;  2Z0E B;  3ZGZ A;  4P16 A;  4HXD A;  4PYU A;  1DOY A;  2YLM A;  1VR9 A;  1KOT A;  4YL8 A;  4HKQ A;  1Z2M A;  2D3C A;  2WXJ A;  3OJ4 B;  3AE7 B;  2WDR B;  4C00 A;  2RDG A;  4HRS A;  3TEY A;  3BIN A;  2MBE A;  2Z59 B;  1G6J A;  1SGH A;  3QHT A;  3VTU A;  2BS2 B;  2QEJ C;  2D11 A;  3AH7 A;  3ZNI D;  1Y56 A;  2FCS A;  4B0E A;  2Z8L A;  2MP2 B;  2BB5 A;  3HM6 X;  2LI5 A;  4TV3 A;  4OZB A;  4RNA A;  3PRP B;  2C60 A;  4IWP A;  2DZJ A;  4R3D A;  2DHZ A;  4ZRP A;  2WXM A;  1L0V B;  1UBI A;  2INN E;  4N59 A;  1YJI A;  3L54 A;  2V3P A;  1ZXI A;  1VZ8 A;  2MRP A;  2DAF A;  2NTS A;  3CSF A;  3QC8 B;  2VH2 A;  3CF6 E;  1N5X A;  3EA6 A;  1MFW A;  1OEY J;  2BBC A;  4OVV A;  1YQB A;  2J0M A;  3L10 B;  3Q69 A;  3DVN U;  1T6B X;  2KQ4 X;  4LNK A;  3EFU A;  3JW0 X;  2KFJ A;  3UQB A;  4EEW A;  4NPN A;  5BO4 B;  2KMC A;  2BPS A;  2Y3A A;  2MWS B;  1WYG A;  2NVU I;  2SAK A;  2ZZP B;  2DYO A;  5EDS A;  1LFD A;  1E7U A;  2GRI A;  3Q3J A;  2AEH A;  1WH3 A;  3FIL A;  1C79 A;  1I4H A;  1E8Z A;  2MLB A;  4DK5 A;  3U2S C;  3SR6 A;  3DBH B;  4X57 B;  3VTV A;  1J7A A;  1V5O A;  4GOC A;  3AE4 B;  4IDI A;  3ZVV A;  4GDL B;  2DZI A;  3ZRF A;  3BY4 B;  4XC2 A;  1I7H A;  3VDZ A;  1ESF A;  3Q3M C;  2OHF A;  3IXS A;  4KGR A;  3RFZ B;  3B9J A;  4KV2 A;  1WY8 A;  1WSP A;  2L52 A;  4A3O A;  3ZJV A;  3AE1 B;  2DAJ A;  4DBG A;  2PLP A;  3C19 A;  3L0W B;  2XBB C;  3PV1 A;  2M0X A;  4I6P A;  1H8C A;  4DHJ B;  2WLB A;  4GLS C;  2KFK A;  1XQQ A;  1EWY C;  3OAW A;  1J0G A;  2E3T A;  4WQO B;  4MH0 E;  1KFY B;  2YVC A;  2JYT A;  5J2R A;  3KH0 A;  1C76 A;  1WMH B;  5C3J B;  3ZXV A;  1PGA A;  2WP9 B;  1ROE A;  1YJJ A;  3DVG X;  1IGC A;  1WWT A;  3BYT B;  1DOI A;  4ICV A;  3R7Q A;  5JZE B;  1E5W A;  2CR5 A;  4ZHP A;  2IND C;  1I4Q A;  4M0W B;  1TS4 A;  3KUD B;  2PTL A;  4HWI B;  2K39 A;  4KZ0 A;  5LXI B;  2ZCB A;  4URK A;  3TEX A;  2OOB B;  3V3X A;  1Q10 A;  4AJW A;  4K3C A;  2KAN A;  1EU4 A;  1V9J A;  2W3R A;  4IM2 A;  4WJQ A;  4PK1 A;  3U52 E;  4ANW A;  3QIJ A;  1WM3 A;  2V9H A;  1UUP A;  4W9D A;  3B1L X;  3RNC C;  5HI1 A;  3L4P A;  2R2Q A;  1FNV A;  3Q8C A;  4CHK A;  4A90 A;  1E8W A;  3VVW B;  1AW7 A;  2JVC A;  4DQO C;  4A3P A;  1NI2 A;  4W9J A;  2GB1 A;  3DPD A;  4RFB A;  3V61 A;  4CO7 A;  1JML A;  3DVN V;  2L00 B;  3KWV A;  2HTH A;  3P4P B;  1SXT A;  3QK0 A;  1F2R I;  4WAF A;  1WF9 A;  1XCT L;  1N5W A;  1ZKH A;  1OTR B;  5GXG B;  3AM9 A;  3RNG C;  1IYF A;  4DHZ E;  2L0F A;  1UH6 A;  2RD0 A;  4B6W A;  1XCQ L;  2K22 A;  2V4L A;  1ENF A;  1WIA A;  4NAM A;  5L95 C;  3L08 A;  1HTO A;  5AZH A;  2DX5 B;  1L2N A;  1YNT E;  2GBJ A;  2J7Q B;  1ZDV A;  4MDK E;  3MJ5 A;  1UEL A;  4RF1 A;  4ARC A;  4KGT A;  4L23 A;  2UYZ B;  4HLE A;  1V49 A;  2M19 A;  4HPM B;  1S3S G;  2XEW A;  3ZW3 A;  5EE1 A;  1WXQ A;  4PS7 A;  4GU2 A;  4A20 A;  1R4M B;  1F2R C;  1K52 A;  5C23 A;  4K7W A;  2WXO A;  2X38 A;  3VRA B;  4PS3 A;  3HUI A;  2D2Q A;  2JU6 X;  3PLV A;  4HPL B;  1QKZ A;  1OQR A;  4G50 A;  4MGK E;  4N58 A;  3ZNZ B;  3PHW B;  1NYR A;  4F1S A;  3VTW A;  3LJ3 A;  5BMG A;  3N32 A;  3GB1 A;  1SE4 A;  2NTT A;  2FUG 1;  1RWS A;  4ZRK A;  3SHQ A;  2DEN B;  1VJK A;  4GN1 A;  1GG3 A;  4FA6 A;  1CK1 A;  2IDY A;  1TIF A;  2C9W B;  4A8X C;  3AE9 B;  1ZE3 D;  3A9K B;  1L6V A;  2K6Q A;  5JHB A;  2KQS A;  2KWV B;  4I6L B;  4I6N B;  1WGH A;  3L17 A;  2M1M A;  2JQR B;  2WXF A;  4B9K A;  1YMH E;  1MG8 A;  2JSV X;  3RPF C;  3TBL D;  1R4M I;  4LJP B;  3SEB A;  3SDL C;  4L2Y A;  2QJL A;  2RPQ A;  4AP4 C;  3PZD A;  1JW9 D;  3AI5 A;  1ZOY B;  5D3D A;  1U4A A;  4WWN A;  5IN7 A;  2D07 B;  2KHW B;  4EKU A;  3QJZ A;  1WZ0 A;  4DXG A;  1UD7 A;  2JUO A;  3P42 A;  4ZOH C;  1T5X D;  3NUH B;  4IOI E;  3QQ8 B;  3ZIM A;  2R2O A;  4W9G A;  1ZW7 A;  2I1J A;  5H92 C; 
#chains in the Genus database with same CATH homology
 1V6E A;  3ZUN A;  1KJT A;  4AWJ A;  1WJU A;  4NQL B;  3DVG Y;  2K25 A;  3HK0 A;  1WE6 A;  3ZNG C;  4II3 B;  5G55 A;  5IAA C;  2N7E A;  2NBU A;  5JHA A;  4GIV A;  4BKS D;  1I35 A;  3M63 B;  2IBI B;  2LXA A;  1UZX B;  4PYZ A;  3KUC B;  2AL6 A;  3SU8 X;  3V62 A;  4ANU A;  4K81 A;  1WYW B;  2KZR A;  2ASQ A;  4E71 A;  1GUA B;  2B3A A;  3LDZ E;  4KSL C;  3ZNH B;  1Z5S B;  4GXB A;  2IYD B;  3A1Q B;  3UIN B;  3VUY A;  4LJO B;  2IO2 B;  5D6J B;  2BYF A;  3QCA A;  2KXJ A;  4N9F 4;  2ZVO A;  3PRE A;  2JXX A;  3WIM A;  4MSM B;  2KD0 A;  1XT9 B;  2N1V A;  2HJ8 A;  1GNU A;  3NZU A;  4G0N B;  1E8X A;  3A4R A;  2G3Q B;  1P3Q U;  5TR5 A;  3RUL A;  1KLV A;  4II2 B;  3M3J A;  4WAA A;  2AYO B;  2M4N A;  4NNJ B;  4JLC A;  1WXV A;  2LVO A;  4DXA B;  5G2N A;  1IPG A;  4EZJ A;  2KLC A;  4W9I A;  2PE9 A;  2L0T A;  1EF1 A;  3ZKJ C;  2CS4 A;  2KKC A;  3PRM B;  2BKF A;  3B08 A;  4RMA A;  2NBV B;  2KWU B;  2DYB A;  3JVZ X;  1C1Y B;  4ANX A;  3KW5 B;  2EMT A;  3MTN B;  4BFR A;  2LRW A;  4K7S A;  2LVP A;  3TCA A;  2KMA A;  4FN2 A;  2HD5 B;  3EC8 A;  4TQ0 A;  3NOB A;  3ML8 A;  2JZZ A;  2QHO A;  1WX7 A;  1VD2 A;  2KTR A;  3D32 A;  2K1F A;  3DBL I;  3RT3 B;  2RSU A;  1YIW A;  2CHW A;  2KC1 A;  1C3T A;  2MQJ A;  3UGB B;  3ZTD A;  2Z0E B;  5E6N A;  4PYU A;  4HXD A;  3SD5 A;  4BVU C;  1F9J A;  2YLM A;  5FR6 A;  3AUL A;  1KOT A;  4YL8 A;  2N4F A;  2AL3 A;  2WX0 A;  3I3T B;  4JQW C;  3PS6 A;  4NQK E;  1Z2M A;  4IUM B;  2J0J A;  3VFK A;  3EHV A;  1EUV B;  3H7P B;  2KFK B;  2N9E B;  3OJ4 B;  3RZW C;  3MHS D;  2V1Y A;  5DCN A;  4BOS C;  2KLG A;  1HE8 A;  1P9D U;  1WM2 A;  3BIN A;  1GC6 A;  3A4S C;  1ISN A;  2MBE A;  3PTF C;  2Z59 B;  3Q3F A;  3JSV A;  1SGH A;  3QHT A;  1G6J A;  3VTU A;  4ICU A;  1WMH A;  2D11 A;  4ANV A;  5HKH A;  3ZNI D;  2FCS A;  2L8J A;  2MP2 B;  5D7G A;  4GSW A;  3S2A A;  3HM6 X;  2LI5 A;  4TV3 A;  1BT0 A;  1YD8 U;  1WFY A;  2AWT A;  2REX A;  3OJ3 A;  2Z0D B;  1IP9 A;  2K6D B;  2N1W A;  3PRP B;  2C60 A;  2KO3 A;  2DYM A;  4IWP A;  2DZJ A;  2ZNV B;  2DHZ A;  2KWC A;  3H1U A;  2CHX A;  1WX9 A;  4IG7 B;  4NY0 A;  1P1A A;  1UBI A;  1D3Z A;  3H6N A;  5DPR A;  3U30 A;  5E6O A;  1GC7 A;  2CU1 A;  2GBM A;  2XK5 B;  3L54 A;  2V3S A;  3N30 A;  2ZJD A;  4GDL A;  2MRP A;  2DAF A;  3CSF A;  3QC8 B;  1I42 A;  3CF6 E;  3A9J B;  4LCD E;  5LXH A;  4BBN F;  4KSK C;  1WXM A;  4G3X B;  2KOX A;  3ML9 A;  4GB9 A;  1OEY J;  1H4R A;  2K8B A;  3VAW A;  4OVV A;  1YQB A;  3RUI B;  2J0M A;  2JRI B;  3L10 B;  1NDD A;  2BGF A;  4KZC A;  5JH5 C;  1YX6 B;  3PHX B;  1TGZ B;  5CHF A;  3DVN U;  3JSV B;  4HDO A;  3EFU A;  3JW0 X;  4WJO A;  2KFJ A;  3UQB A;  4EEW A;  3DBS A;  2FUH B;  4RM8 A;  3K9P B;  3HHM A;  3ZLZ A;  4KDI C;  4NPN A;  1XD3 B;  5BO4 B;  3M62 B;  2GBK A;  2KMC A;  2BPS A;  2CKH B;  4FUL A;  2MWS B;  2NVU I;  2ZZP B;  4W9C A;  4BKT A;  2DYO A;  5EDS A;  1LFD A;  1E7U A;  2C7M B;  1JRU A;  3UIO B;  2WYQ A;  2FCM A;  4ZRJ A;  3Q3J A;  5C1Z A;  5AZG A;  2AEH A;  1KM7 A;  1WZ3 A;  4NAW B;  1WH3 A;  2BF8 B;  1E7V A;  4BOZ B;  2FIF A;  1Y8R C;  4W9F A;  1E8Z A;  3RCZ A;  2C5L C;  3VH3 B;  1UGM A;  2MLB A;  2K8C A;  5DPS A;  4DK5 A;  4AOF A;  5LLI A;  3TJP A;  2XK5 A;  2NBW B;  1LQB A;  2KDB A;  2C7N B;  4X57 B;  3VTV A;  1V5O A;  4GOC A;  4NJ7 A;  3ZVV A;  3X0W A;  2JF5 A;  4GDL B;  4XX5 A;  2DZI A;  3ZRF A;  4BKS A;  3BY4 B;  2BYE A;  2L05 A;  3QWZ B;  4XC2 A;  3VDZ A;  1WJ6 A;  1WRD B;  3QX1 A;  4HJK A;  3K9O B;  1AAR A;  2NR2 A;  4MEL A;  2DZM A;  2ZCC A;  1CMX B;  2O6V A;  4KV2 A;  1WY8 A;  4LDT B;  4DHZ B;  1V2Y A;  4W9L A;  1PQS A;  4W9E A;  5GMV A;  2D3G A;  4FHJ A;  4A3O A;  2MBO A;  3MJW A;  2LXC A;  4MGZ E;  2DAJ A;  3ENE A;  4DBG A;  2MX2 A;  3OLM D;  3DBH I;  1EO6 A;  2BKR B;  3L0W B;  2XBB C;  3M95 A;  3PV1 A;  2M0X A;  2MW5 A;  4I6P A;  3HM3 A;  1GJZ A;  1H8C A;  1V80 A;  5KHO A;  4DHJ B;  3X23 A;  1RLF A;  2KFK A;  3VXW A;  2KNB A;  4B95 A;  1XQQ A;  4MGY E;  3H9D A;  3GZN I;  3OAW A;  1J0G A;  2GBR A;  5CHW A;  4WQO B;  4MH0 E;  2LWP A;  3NY5 A;  1TZ1 A;  2YVC A;  4E74 A;  5KHQ A;  4NJ6 A;  5J2R A;  1WX8 A;  2MSE D;  3KH0 A;  1RRB A;  3RYT A;  5AEK B;  1WMH B;  3DCG A;  3VQI A;  4WJP A;  2IY1 B;  4IW0 A;  2KX0 A;  2K8H A;  4EOY A;  2O2V B;  4MJS A;  2M8S A;  2MP2 A;  2N7D A;  3AU4 A;  3C0R B;  4HDQ A;  1ZGU B;  2GMI C;  3DQV A;  2KX3 A;  3PRZ A;  3DVG X;  1SIF A;  2MCN B;  2FCQ A;  4ICV A;  4IWQ A;  3R7Q A;  5JZE B;  2WWZ A;  1E5W A;  4FJY A;  3KYC D;  4WJN A;  2CR5 A;  4TQ1 A;  3APD A;  1M94 A;  2A4Z A;  3AU5 A;  2IY0 B;  1Q5W B;  1J19 A;  4M0W B;  2N9X A;  3PGE A;  3KUD B;  4DDG D;  4HWI B;  3T8M A;  3DBR I;  4FJV B;  2K39 A;  4KZ0 A;  5LXI B;  2KN5 A;  2ZCB A;  4URK A;  3VUW A;  3NS8 A;  3A9J A;  2KC2 A;  2OOB B;  2ZPN A;  4IM0 A;  4EZL A;  4AJW A;  2Y5B B;  2FNJ B;  3PVL A;  3UF8 A;  2KAN A;  5IA7 A;  1V9J A;  4IM2 A;  2IO3 B;  2JZ3 B;  2LZ6 A;  1S1Q B;  4WJQ A;  2KJ6 A;  4P7I A;  2L76 A;  4ANW A;  2WDT B;  1WI0 A;  1WM3 A;  3QIJ A;  4PS8 A;  2KDI A;  3H7S A;  2LUE A;  2LGX A;  4W9D A;  2ZVN A;  3B1L X;  4GDK A;  1NBF C;  2LRU A;  2R2Q A;  1WGY A;  2JT4 B;  3KYD D;  2G45 B;  4ASW C;  4CHK A;  3HIZ A;  2NS5 A;  2O2V A;  2PPH A;  4MJS B;  1E8W A;  3A9K A;  2LD9 A;  1WR6 E;  3VVW B;  1WR1 A;  2JVC A;  4DWF A;  3IG3 A;  4K7U A;  4A3P A;  1NI2 A;  4W9J A;  4XZ4 A;  4HK2 A;  4G11 A;  3DPD A;  1FXT B;  4IM3 A;  4AUQ C;  3WAP A;  2W9N A;  4NAW A;  4E3C A;  3V61 A;  4AJY B;  4CO7 A;  2LGD A;  2O6V D;  3R3M A;  4J6I A;  4LDT D;  4BKG A;  3DVN V;  4FJZ A;  2L00 B;  1YX5 B;  1LXD A;  2JRH A;  2KDF B;  2ZEQ A;  3VUX A;  2KTF A;  3DDC B;  2HTH A;  1OEY A;  3QK0 A;  2ZPY A;  3VH4 B;  4GMV A;  1P0R A;  1WF9 A;  3KUZ A;  2L7R A;  1ZKH A;  1OTR B;  2UWQ A;  4JIO U;  2JWZ A;  2NPT A;  3UIP B;  4DHJ D;  3V6E B;  3U7D A;  4TKN A;  2OJR A;  2RR9 A;  1K8R B;  1IYF A;  2KJH B;  2L0F A;  1UH6 A;  2RD0 A;  3V6C B;  3ZRC A;  4B6W A;  2O6V B;  4DHZ E;  2MBH A;  2GOW A;  3WAM A;  2IO1 B;  2V4L A;  1WIA A;  3P2B A;  5L95 C;  1WGD A;  3L08 A;  4IWO A;  5D2M B;  4EUT A;  1OGW A;  1V86 A;  4M8N A;  1WJN A;  1P98 A;  5AZH A;  2DX5 B;  2G4S A;  1L2N A;  3VHT C;  5J17 A;  1QZE A;  1RAX A;  2GBJ A;  4FHK A;  4FBJ B;  1RFA A;  4GGQ A;  2DZK A;  2J7Q B;  4MDK E;  2PJH A;  1UEL A;  3GOE A;  4TUU A;  1Q1O A;  4ZYN A;  2UYZ B;  3B0A A;  4HLE A;  1V49 A;  4M8M A;  4KIK A;  3R66 C;  3ZDT A;  3IBE A;  4HPM B;  1S3S G;  3QAQ A;  2XEW A;  3T9L A;  3ZW3 A;  4MSQ B;  3ECI A;  3L13 A;  3O65 B;  4EZK A;  1WJ4 A;  4PS7 A;  1E8Y A;  4GU2 A;  4FLH A;  4WWO A;  5D94 A;  4A20 A;  2FCN A;  5DPT A;  3NHE B;  3PSE B;  3WAL A;  5CHV C;  4ZRI A;  3RZF A;  4MM3 A;  5C23 A;  2LGY A;  4K7W A;  2LAS A;  3A33 B;  3A1Q A;  3IHP C;  4W9H A;  3U8Z A;  2MBQ A;  4MGI E;  4PS3 A;  2D2Q A;  1R4N I;  3CST A;  4FAD A;  2IZV B;  3CMM B;  3W1Y A;  3PLV A;  4HPL B;  1UBQ A;  2IO0 B;  4G50 A;  4MGK E;  3ZNZ B;  4HCN B;  2N9P C;  2RGF A;  4JGH B;  3PHW B;  5E6P A;  3TL5 A;  4F1S A;  2G4D B;  2LJ5 A;  3DOW A;  3N3K B;  4EFO A;  3VTW A;  2A5U A;  3LJ3 A;  3N32 A;  5AZF A;  2WX1 A;  3V60 A;  4HCP B;  3KVF B;  1SE9 A;  4ZRK A;  3WAN A;  1WE7 A;  2EKE C;  2HE7 A;  3PPA A;  1WGR A;  2FID A;  3SHQ A;  4IC7 B;  2DEN B;  2LVQ A;  3ALB A;  1E90 A;  2BWF A;  4GN1 A;  1GG3 A;  4FA6 A;  1T0Y A;  3WAO A;  1X1M A;  1EF5 A;  3IVF A;  3QA8 A;  4GDK B;  2I1K A;  4KDL B;  1L7Y A;  2C9W B;  3ZO5 B;  3UQA A;  3AXC A;  3QAR A;  4OVU A;  2PE6 B;  3RD2 A;  2M17 A;  3APF A;  4CYE A;  5J18 A;  3A9K B;  2K6Q A;  2D10 A;  3ZDM C;  5JHB A;  5L83 A;  2KQS A;  2KWV B;  2L3Z A;  4I6L B;  1A5R A;  3PLU A;  2KTR B;  3APC A;  2VRR B;  4I6N B;  1WGH A;  3L17 A;  2M1M A;  3ZTC A;  4B9K A;  1YJ1 A;  2ZNV C;  3PT2 B;  4DDI D;  3L16 A;  1MG8 A;  2C7H A;  4JL9 A;  5CTR C;  3TBL D;  2BWE S;  2JY6 A;  2BYV E;  2EMS A;  1R4M I;  2GBN A;  4LJP B;  4WWP A;  4KVG B;  3SDL C;  4AP4 C;  2RPQ A;  4HVB A;  3PZD A;  2JPH A;  3AI5 A;  1TTN A;  4ZDV A;  1U4A A;  3H7P A;  1V5T A;  4WWN A;  4W9K A;  2NPT B;  1TBE A;  1WGG A;  1J8C A;  4K1R B;  2D07 B;  2KHW B;  4EKU A;  4BBN C;  5DPW A;  4F8C B;  3QJZ A;  1WXA A;  2PEA A;  3IFW B;  3NZS A;  1VCB A;  1WZ0 A;  2J0K A;  3WA0 A;  2MBB B;  4F7Z A;  1LM8 B;  2KQ7 A;  2NCN A;  2KVR A;  1UD7 A;  2JUO A;  3EEC A;  4RM9 A;  1V81 A;  3W1S C;  3TIX A;  5CX3 A;  2CHZ A;  2KDE B;  3ONS A;  3R7R A;  2KJR A;  4MEM A;  3QQ8 B;  3ZIM A;  3TMP B;  3JYU A;  1OQY A;  2R2O A;  4W9G A;  2KK8 A;  1Q0W B;  1ZW7 A;  2MA9 B;  2I1J A;  2FAZ A;  1WXS A;  4KIK B;  3W1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...