2MS8A

Solution nmr structure of mavs card
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
102
structure length
102
Chain Sequence
GSMPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of helical filaments by solid-state NMR spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Mitochondrial antiviral-signaling protein
total genus 33
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2014-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2ms8A00
4QOBA 4LWDA 1WH4A 2OF5A 3MOPG 4P4HA 4JQWA 2YGSA 2O71A 3CL3A 4DWNA 2DBDA 4IZ7B 2D96A 4RHWA 4E9MA 4N1LA 3YGSC 2L9MA 4UZ0A 1UCPA 2LS7A 2MS8A 2G7RA 2F1SA 2N97A 2LWDA 4F44A 2B1WA 2N7ZA 3KATA 1YGOA 2IB1A 4A2QA 1DDFA 4NQKA 4EWIA 1E41A 4P4HI 2DBGA 2OF5H 2L6AA 1D2ZA 1CWWA 1CY5A 2NZ7A 4O9FA 1ICHA 4D8OA 2A9IA 4ZBWA 2KN6A 2A5YB 1A1ZA 3EZQB 2KM6A 2N83A 2LWEA 2MPCA 4O7QA 1A1WA 4RHWE 4I16A 2NAQA 3MOPK 1WMGA 3J63A 2N80A 2MB9A 2NSNA 1PN5A 4M9XA 2HM2Q 4M9ZA 4N1KA 1Z6TA 2DO9A 2GF5A 2DBHA 4O6XA 4IZAB 3YGSP 1C15A 4FH0A 2DBFA 2YU0A 4F42A 3CRDA 4M9SA 4O9LA 3EZQA 1WXPA 3LQRA 2N00A 4N1JA 2YVIA 1D2ZB 2MN4A 3QF2A 1E3YA 4JUPA 4A2WA 4IZ5E 3J6JA 2VGQA 3LQQA 2P1HA 2YQFA 2BBRA 2M5VA 3MOPA 2BBZA 1N3KA 1DGNA 2MS7A 1FADA 2N1FA 3T6PA 1NGRA
chains in the Genus database with same CATH superfamily
4QOBA 4LWDA 1WH4A 2OF5A 3MOPG 4P4HA 4JQWA 2YGSA 2O71A 3CL3A 4DWNA 2DBDA 4IZ7B 2D96A 4RHWA 4E9MA 4N1LA 3YGSC 2L9MA 4UZ0A 1UCPA 2LS7A 2MS8A 2G7RA 2F1SA 2N97A 2LWDA 4F44A 2B1WA 2N7ZA 3KATA 1YGOA 2IB1A 4A2QA 1DDFA 4NQKA 4EWIA 1E41A 4P4HI 2DBGA 2OF5H 2L6AA 1D2ZA 1CWWA 1CY5A 2NZ7A 4O9FA 1ICHA 4D8OA 2A9IA 4ZBWA 2KN6A 2A5YB 1A1ZA 3EZQB 2KM6A 2N83A 2LWEA 2MPCA 4O7QA 1A1WA 4RHWE 4I16A 2NAQA 2MJMA 3MOPK 1WMGA 3J63A 2N80A 2MB9A 2NSNA 1PN5A 4M9XA 2HM2Q 4M9ZA 4N1KA 1Z6TA 2DO9A 2GF5A 2DBHA 4O6XA 4IZAB 3YGSP 1C15A 4FH0A 2DBFA 2YU0A 4F42A 3CRDA 4M9SA 4O9LA 3EZQA 1WXPA 3LQRA 2N00A 4N1JA 2YVIA 1D2ZB 2MN4A 3QF2A 1E3YA 4JUPA 4A2WA 4IZ5E 3J6JA 2VGQA 3LQQA 2P1HA 2YQFA 2BBRA 2M5VA 3MOPA 2BBZA 1N3KA 1DGNA 2MS7A 1FADA 2N1FA 2XV9A 3T6PA 1NGRA
chains in the Genus database with same CATH topology
4QOBA 4LWDA 1WH4A 2OF5A 3MOPG 4P4HA 4JQWA 2YGSA 2O71A 3CL3A 4DWNA 2DBDA 4IZ7B 2D96A 4RHWA 4E9MA 4N1LA 3YGSC 2L9MA 4UZ0A 1UCPA 2LS7A 2MS8A 2G7RA 2F1SA 2N97A 2LWDA 4F44A 2B1WA 2N7ZA 3KATA 1YGOA 2IB1A 4A2QA 1DDFA 4NQKA 4EWIA 1E41A 4P4HI 2DBGA 2OF5H 2L6AA 1D2ZA 1CWWA 1CY5A 2NZ7A 4O9FA 1ICHA 4D8OA 2A9IA 4ZBWA 2KN6A 2A5YB 1A1ZA 3EZQB 2KM6A 2N83A 2LWEA 2MPCA 4O7QA 1A1WA 4RHWE 4I16A 2NAQA 2MJMA 3MOPK 1WMGA 3J63A 2N80A 2MB9A 2NSNA 1PN5A 4M9XA 2HM2Q 4M9ZA 4N1KA 1Z6TA 2DO9A 2GF5A 2DBHA 4O6XA 4IZAB 3YGSP 1C15A 4FH0A 2DBFA 2YU0A 4F42A 3CRDA 4M9SA 4O9LA 3EZQA 1WXPA 3LQRA 2N00A 4N1JA 2YVIA 1D2ZB 2MN4A 3QF2A 1E3YA 4JUPA 4A2WA 4IZ5E 3J6JA 2VGQA 3LQQA 2P1HA 2YQFA 2BBRA 2M5VA 3MOPA 2BBZA 1N3KA 1DGNA 2MS7A 1FADA 2N1FA 2XV9A 3T6PA 1NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QOB A;  4LWD A;  1WH4 A;  2OF5 A;  3MOP G;  4P4H A;  4JQW A;  2YGS A;  2O71 A;  3CL3 A;  4DWN A;  2DBD A;  4IZ7 B;  2D96 A;  4RHW A;  4E9M A;  4N1L A;  3YGS C;  2L9M A;  4UZ0 A;  1UCP A;  2LS7 A;  2MS8 A;  2G7R A;  2F1S A;  2N97 A;  2LWD A;  4F44 A;  2B1W A;  2N7Z A;  3KAT A;  1YGO A;  2IB1 A;  4A2Q A;  1DDF A;  4NQK A;  4EWI A;  1E41 A;  4P4H I;  2DBG A;  2OF5 H;  2L6A A;  1D2Z A;  1CWW A;  1CY5 A;  2NZ7 A;  4O9F A;  1ICH A;  4D8O A;  2A9I A;  4ZBW A;  2KN6 A;  2A5Y B;  1A1Z A;  3EZQ B;  2KM6 A;  2N83 A;  2LWE A;  2MPC A;  4O7Q A;  1A1W A;  4RHW E;  4I16 A;  2NAQ A;  3MOP K;  1WMG A;  3J63 A;  2N80 A;  2MB9 A;  2NSN A;  1PN5 A;  4M9X A;  2HM2 Q;  4M9Z A;  4N1K A;  1Z6T A;  2DO9 A;  2GF5 A;  2DBH A;  4O6X A;  4IZA B;  3YGS P;  1C15 A;  4FH0 A;  2DBF A;  2YU0 A;  4F42 A;  3CRD A;  4M9S A;  4O9L A;  3EZQ A;  1WXP A;  3LQR A;  2N00 A;  4N1J A;  2YVI A;  1D2Z B;  2MN4 A;  3QF2 A;  1E3Y A;  4JUP A;  4A2W A;  4IZ5 E;  3J6J A;  2VGQ A;  3LQQ A;  2P1H A;  2YQF A;  2BBR A;  2M5V A;  3MOP A;  2BBZ A;  1N3K A;  1DGN A;  2MS7 A;  1FAD A;  2N1F A;  3T6P A;  1NGR A; 
#chains in the Genus database with same CATH topology
 4QOB A;  4LWD A;  1WH4 A;  2OF5 A;  3MOP G;  4P4H A;  4JQW A;  2YGS A;  2O71 A;  3CL3 A;  4DWN A;  2DBD A;  4IZ7 B;  2D96 A;  4RHW A;  4E9M A;  4N1L A;  3YGS C;  2L9M A;  4UZ0 A;  1UCP A;  2LS7 A;  2MS8 A;  2G7R A;  2F1S A;  2N97 A;  2LWD A;  4F44 A;  2B1W A;  2N7Z A;  3KAT A;  1YGO A;  2IB1 A;  4A2Q A;  1DDF A;  4NQK A;  4EWI A;  1E41 A;  4P4H I;  2DBG A;  2OF5 H;  2L6A A;  1D2Z A;  1CWW A;  1CY5 A;  2NZ7 A;  4O9F A;  1ICH A;  4D8O A;  2A9I A;  4ZBW A;  2KN6 A;  2A5Y B;  1A1Z A;  3EZQ B;  2KM6 A;  2N83 A;  2LWE A;  2MPC A;  4O7Q A;  1A1W A;  4RHW E;  4I16 A;  2NAQ A;  2MJM A;  3MOP K;  1WMG A;  3J63 A;  2N80 A;  2MB9 A;  2NSN A;  1PN5 A;  4M9X A;  2HM2 Q;  4M9Z A;  4N1K A;  1Z6T A;  2DO9 A;  2GF5 A;  2DBH A;  4O6X A;  4IZA B;  3YGS P;  1C15 A;  4FH0 A;  2DBF A;  2YU0 A;  4F42 A;  3CRD A;  4M9S A;  4O9L A;  3EZQ A;  1WXP A;  3LQR A;  2N00 A;  4N1J A;  2YVI A;  1D2Z B;  2MN4 A;  3QF2 A;  1E3Y A;  4JUP A;  4A2W A;  4IZ5 E;  3J6J A;  2VGQ A;  3LQQ A;  2P1H A;  2YQF A;  2BBR A;  2M5V A;  3MOP A;  2BBZ A;  1N3K A;  1DGN A;  2MS7 A;  1FAD A;  2N1F A;  2XV9 A;  3T6P A;  1NGR A; 
#chains in the Genus database with same CATH homology
 4QOB A;  4LWD A;  1WH4 A;  2OF5 A;  3MOP G;  4P4H A;  4JQW A;  2YGS A;  2O71 A;  3CL3 A;  4DWN A;  2DBD A;  4IZ7 B;  2D96 A;  4RHW A;  4E9M A;  4N1L A;  3YGS C;  2L9M A;  4UZ0 A;  1UCP A;  2LS7 A;  2MS8 A;  2G7R A;  2F1S A;  2N97 A;  2LWD A;  4F44 A;  2B1W A;  2N7Z A;  3KAT A;  1YGO A;  2IB1 A;  4A2Q A;  1DDF A;  4NQK A;  4EWI A;  1E41 A;  4P4H I;  2DBG A;  2OF5 H;  2L6A A;  1D2Z A;  1CWW A;  1CY5 A;  2NZ7 A;  4O9F A;  1ICH A;  4D8O A;  2A9I A;  4ZBW A;  2KN6 A;  2A5Y B;  1A1Z A;  3EZQ B;  2KM6 A;  2N83 A;  2LWE A;  2MPC A;  4O7Q A;  1A1W A;  4RHW E;  4I16 A;  2NAQ A;  2MJM A;  3MOP K;  1WMG A;  3J63 A;  2N80 A;  2MB9 A;  2NSN A;  1PN5 A;  4M9X A;  2HM2 Q;  4M9Z A;  4N1K A;  1Z6T A;  2DO9 A;  2GF5 A;  2DBH A;  4O6X A;  4IZA B;  3YGS P;  1C15 A;  4FH0 A;  2DBF A;  2YU0 A;  4F42 A;  3CRD A;  4M9S A;  4O9L A;  3EZQ A;  1WXP A;  3LQR A;  2N00 A;  4N1J A;  2YVI A;  1D2Z B;  2MN4 A;  3QF2 A;  1E3Y A;  4JUP A;  4A2W A;  4IZ5 E;  3J6J A;  2VGQ A;  3LQQ A;  2P1H A;  2YQF A;  2BBR A;  2M5V A;  3MOP A;  2BBZ A;  1N3K A;  1DGN A;  2MS7 A;  1FAD A;  2N1F A;  2XV9 A;  3T6P A;  1NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...