2MSSA

Musashi1 rbd2, nmr
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
75
structure length
75
Chain Sequence
KIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, backbone dynamics and interactions with RNA of the C-terminal RNA-binding domain of a mouse neural RNA-binding protein, Musashi1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords PROTEIN (MUSASHI1)
total genus 10
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mssA00
2XS5A 1ZH5A 3MD1A 2A3JA 2JRSA 3UCUP 1PGZA 2CQIA 2DO0A 1RKJA 1DZ5A 2AD9A 1WI6A 2J0SD 2CPJA 2AYGA 1FNXH 2DHXA 3CD6S 2MQPA 2HGNA 3UWTA 2RRBA 1K8AT 1SJRA 4WFBQ 1X4CA 2D9PA 2F3JA 2KXNB 3VAJA 2F9DA 2D9OA 2LXIA 2ZJQQ 2LCWA 4WCEQ 4WFAQ 3CF5Q 1M5OC 1DBDA 1S79A 1U1LA 3SDEA 1UW4A 2RUGA 3U1LA 3CPWR 1VBZA 2M88A 2MZTA 4PRFA 1SJQA 2CPIA 3Q2SC 2KRRA 2MXYA 2DB1A 3CCLS 2CPXA 2M4MA 2CQCA 2DH8A 2OSQA 1WF0A 2OIHA 1VQ4S 1P1TA 2RU3A 1NU4A 5DETA 1U6FA 2N7CA 1YHQS 2MKIA 5DM7Q 2MB0B 2QEXS 3RW7A 2XS7A 1ZZFA 2L08A 1FHTA 2YH0A 3UCZP 4LIRA 3G8TA 2ADCA 1WG1A 1X4DA 2OTLS 2GO9A 1A7GE 5LJ5Y 2K8GA 4TU8A 1RK8A 2DIUA 2CPZA 2DNKA 3BS9A 1YIJS 1KD1T 2E5GA 4P6QA 2E44A 4W90B 2CQBA 1U1NA 1FJCA 2JX2A 3V4MA 4Y0FA 1KC8T 2HZCA 1Q7YT 2U1AA 2RRAA 1VQ6S 5IM0B 5CXTA 5LSOA 1X4FA 2DGQA 1QVGR 2LQ5A 2KXFA 5DM6Q 2CPYA 5D78A 2HYIB 2YTCA 1U1KA 3G96A 5GMKa 4CQ1A 2CQ3A 5GAEU 3G4SS 2KN4A 1VC0A 5HL7Q 2UP1A 2DGTA 1WHWA 2M8DB 1SJFA 5DDOC 3MOJB 4F26A 3MD3A 1WHVA 3R1LA 1WHXA 2QA4S 4WFNQ 3VAMA 4IOCQ 4OZ1A 2BZ2A 2MZRA 3MDFA 3L3CA 2O3DA 3CXCR 4U67Q 1SXLA 3CCUS 1L3KA 2JVRA 3D2WA 2YH1A 3MXHP 2KRBA 4IUFA 1UP1A 1HD0A 1X5OA 2RNEA 2RS2A 1OIAA 1JJ2R 1SJ3P 3NMRA 5D77A 1FJ7A 2MSSA 5HO4A 4LJMA 1U2FA 2X1FA 1JJHA 4OZ0A 2CQ0A 2MKJA 3CC4S 2M7SA 2KM8B 2CQPA 4RU2A 1N54B 3I56S 1FO1A 2JVOA 2AYEA 2DH9A 2AYMA 1VQOS 2G1DA 2DO4A 2EK1A 2KG0A 1VQ9S 1H6KX 3CUNA 2M2BA 1M1KT 2DNQA 3CCMS 2MQLA 1HL6A 5IQQA 2MQNA 5EN1A 1X4BA 5GVQA 2ERRA 1R8HA 3VAGA 2VOPA 3SXLA 1YJ9S 1NO8A 5LJ3Y 2CQ2A 3DXBA 1VQPS 4YOEA 1WTBA 4CH0S 2OSRA 2E5HA 1R8PA 2X1BA 1DRZA 2GHPA 3TYTA 2OTJS 3IRWP 2KT5A 1U1MA 2DGVA 1SJ4P 2MKSA 1UFWA 2CPDA 3VALA 2FC9A 3S7RA 2Q79A 5ITHA 3ULHA 3B4DA 2L41A 2MKHA 5JVGQ 4Y00A 2RS8A 3CC2S 4WKRA 3NNCA 4WIIA 1HD1A 2MY8A 2CJKA 4M5DB 1WELA 1H2TZ 2E5IA 5IFMA 2MJUA 2DHGA 3TP2A 3NS6A 1PO6A 2VODA 1Q86T 4PKDB 3CCQS 3UE2A 5CA5A 2XB2D 4WF9Q 3CCJS 2CQ1A 2N82B 4ERDA 2X1AA 3N9UC 2MQOA 4W92B 4QU6A 2MKKA 4C7QA 2X1GA 1WI8A 2KVIA 3MI7X 2DGXA 2N3LA 1VBXA 1X4EA 2XNRA 3CC7S 1IQTA 2PE8A 1M5PC 3US5A 4C0OC 2M70A 2HGLA 2KFYA 1WG5A 1S72S 4V19X 1YJNS 2VONA 5H1SV 5LSLA 1N52B 2E5JA 1AUDA 1UAWA 3CMES 1WG4A 2CPFA 1KOHA 2NLWA 1OO0B 1VQ7S 3MURP 2M52A 1N88A 2CQGA 4CH1A 2LKZA 5MLCV 3UD3P 3P3DA 2F9JA 2LA6A 2RQ4A 3S01A 1JMTA 4YUDA 3CTRA 1URNA 2I38A 4J5OA 1KQSR 1YI2S 1VQ8S 3UCGA 3R27A 3CMAS 2VOOA 3Q2TC 2DIVA 2LECA 2B0GA 4LMZA 2LXUA 2G0CA 4ZKAA 4QU7A 3MUVP 2DNLA 4TLQA 4IOAQ 2EK6A 3EX7B 2FHOB 3P49B 1FJEB 3G9CA 1WEYA 2DISA 5IM0A 3IWNC 1VQ5S 2MZ1A 2J0QD 2DNHA 1YJWS 2MYFA 1KOOA 4TU7A 3NNAA 2DHSA 2KH9A 2K3KA 2CQHA 2ZJRQ 4UY8T 1NJIT 1K9MT 2AYBA 2MZQA 1A9NB 2MGZA 5DDQC 3NNHA 4A8XA 1VC5A 3VF0B 2CPHA 2DNOA 1U6BA 2MGZB 4IO9Q 2DNRA 4PR6A 3J7YU 3EGNA 5GADU 1U1PA 2KI2A 2G4BA 2DGWA 3JB9k 3BO3A 1ZZNA 2MMYA 3BO2A 1X5TA 1H2UX 1H2VZ 1P27B 2XS2A 2L9WA 1VQKS 2M9KA 1WF2A 2DNPA 2DNYA 2RQCA 3I55S 2EVZA 1WEXA 1WF1A 3VAKA 2BOPA 2DHAA 1OWXA 1OPIA 1YITS 1XN9A 5DDPC 2M8HA 3THPA 1M5KC 4C4WA 1G2EA 2LYVA 3J7ZT 3MUTP 4F02A 5CYJA 1U1QA 3NS5A 4YB1P 3THTA 2I2YA 1D8ZA 3H2UB 4UQTA 2CQDA 2HGMA 2LEBA 3LQVA 2DNMA 4FXWA 1Q82T 3ZZYA 1WWHA 2HVZA 1M5VC 2ADBA 2KXHA 2RVJA 2MSTA 1VQMS 3G6ES 3U1MA 5DDRC 3P6YC 5GAGU 2WBRA 3PIPQ 2MZSA 1BY9A 2MHNA 4FXVA 4QQBA 1W2BR 3CCVS 1N8RT 2J76E 1X4GA 2KG1A 4QPTA 2QFJA 2U2FA 3S8SA 4F25A 5LXRA 2DGOA 4TU9A 3FEYB 2DNNA 4ED5A 1QM9A 3FEXB 3MUMP 2NZ4A 3ZZZA 1WHYA 1D9AA 3SDEB 3G8SA 1X4AA 2YKAA 1VQNS 5GAHU 1O0PA 3R1HA 5JVHQ 2V94A 1VC6A 3CCSS 3VAIA 2J8AA 2KM8C 2MZJA 4Z2XA 3RW6A 3CULA 1U1OA 2FY1A 3G71S 1U1RA 2DNGA 1X5SA 4BS2A 1JJ4A 3OW2R 2MPUA 2KU7A 2DK2A 2CQ4A 3EGZA 2OJ3A 2DH7A 3HI9A 3B4MA 1VBYA 2YWKA 1HA1A 2MY7A 2D3OR 3S6EA 1X4HA 2N3OA 2ZJPQ 1DHMA 1YTYA 2MQQA 2LEAA 2DITA 1YWXA 3UD4P 4CIOA 2CPEA 1FT8A 4EGLA 1B7FA 2KYXA 5BJRA 3CCES 1F9FA 2LMIA 2PEHA 3H2VE 5FJ4A 1Q81T 3BEGB 3VAHA 1M90T 2KHCA 2FC8A 2DNZA 2MJNA 1WEZA 2JWNA 2XSFA 2DGSA 2DGUA 3K0JA 1QVFR 2LA4A 3TO8A 3HHNB 1X5PA 3LPYA 2XNQA 3PIOQ 5LXYA 1CVJA 1FXLA 2MKCA 3BO4A 1VQLS 2M0GB 3VAFA 3SMZA 1X0FA 3CCRS 2MQMA 2FPHX 2RT3A 2SXLA 3P5TL 3DLLQ 1K73T
chains in the Genus database with same CATH superfamily
3POTA 3VQSA 3BR8A 1ZH5A 3IG1B 3IA0A 4CTAA 3GR1A 2KFZA 2BJDA 3CJ8A 2IM2A 2HHHF 2CQIA 1QLNA 2Z58B 3OBIA 5CYQB 3MAQA 2CJXB 3KKFA 2R7SA 3VZIA 1FJGF 1FE0A 1OY9A 1S12A 2HNYA 5DLFA 2XCPA 3HLUA 3HHKA 3OHBA 5SZTA 3TA1A 1XERA 3NGSA 4RL1A 3W60A 5I42A 3EJMA 3CD6S 1U26A 3M30A 4DUZJ 3PXGa 3A13A 2MQPA 1JLFA 1RP5A 5ETQA 5C2GA 4DV5J 3HX9A 1SJRA 2B4OA 4WFBQ 2D9PA 4RWWA 1K8AT 2HKEA 3LPEA 2GVZA 1O8BA 4Y3CA 4C3LA 2KXNB 3J7YI 4DL4A 4KGMA 1U4BA 2GIQA 2LXIA 2ZJQQ 5J2NB 1YRXA 2IYIA 4DV2F 2LLZA 2YWHA 1RB0A 4KHMA 1RAAB 4DPWA 5DGAA 5HAOA 3GR0A 1TL7A 2LQ9A 1KDNA 1HKAA 1RABB 2XHCA 4I7FA 3UDLA 3W8GA 3TZZA 4HDHA 1K0VA 4QIWD 1XQIA 2B9XA 3DHWC 4I2PA 5KFWA 1YQHA 1M1KT 3ITHA 4LF8F 1UWBA 3P8BB 3KLIA 1N0VC 1VHFA 2OPQA 5L1IA 2OH2A 2R7TA 1SH0A 3ZO7A 4YMEA 1S97A 3KYLA 4UT4A 2VBYA 1RWKB 2QYCA 2QA4G 1SB6A 2V50A 3ZZ0A 2HHVA 1NU4A 3SV3A 4KH0B 2D3UA 1C0UB 1YKWA 2RIJA 2WVCA 3M32B 3M6UA 3I0SA 3NAIA 4NEZA 3PJWA 3PYGA 3MCSA 4MT1A 3PJXA 2F8MA 5DM7Q 2JLFA 3JSYA 1Q4RA 3BGUA 2OEJA 2E29A 1ZZFA 2GQCA 1U0SA 1FHTA 4P9SA 1KS2A 2XHWA 2Q6CA 2HHWA 2W8KA 2PD1A 2OTLS 2QLWA 2GO9A 2O67A 3CJ0A 2BE2B 3R7BB 3AODA 1CC7A 4FYXB 2L48A 3IR7B 3TEHB 1S9EB 3UVJA 4TU8A 2R2RA 4DPOA 1YIJS 3DLBA 1Z4UA 3HVWA 3KLGB 2E44A 1T9WA 3A3OB 4W90B 2WONA 3KXDA 1FJCA 1T3OA 4DCJB 5HQMA 3MM6A 5C24B 1Q1KA 2HZCA 2Y1LB 3D4JA 2BRLA 2U1AA 5C25A 3RRHA 2V4QA 3GSDA 4FYYB 5J2PA 3PW5A 2JLGA 2DGQA 1QVGR 1U02A 4P52A 3J7A1 1U47A 1EETA 2WW4A 5B08A 4KIAA 2IA6A 3VGVA 2AJQA 4O3PA 5H9FJ 1JKHA 3LAKA 4FPIA 2IM1A 3IAS9 5CZVA 1K1QA 5LM7E 4CH7A 4ED6A 2NXJA 4WYWA 3G96A 1U1KA 1R27B 1SKWA 1NLKL 1RAFB 4BDPA 1UPMB 2A2CA 4CQ1A 4A8WA 4XPCA 3PW0A 4ZDNA 2UUAJ 2CQ3A 2EI5A 4QW8A 1T9XA 5DQHA 2PEBA 2DPJA 2WB4A 1ZOTA 1G1XA 4DR3J 3R5BA 4CM0A 2DPIA 1VRTA 1K47A 2J0WA 4OX6A 3A12A 4KC5A 4JV5F 3DGPA 4K8RA 4RW8B 1RT7A 3DMJA 4HT7A 2AGOA 1NK9A 1SJFA 3AJ2A 2NSCA 1IKYA 5E3AA 1IBKJ 2DY1A 1QJHA 1IQZA 3T6JA 1IBCB 1FFSB 5CYMA 5D4OA 2HHSA 4F3OA 2IM3A 1FTRA 4F26A 3PYDA 2W2NP 3EE3A 2QMWA 2PMZD 5E41A 4DV4F 3R1LA 3HD2A 1UJ6A 2IYGA 3Q8YA 1RHRB 5ETNA 4OHZA 4N8NA 3RTVA 2QA4S 3MECB 3HM9A 3VAMA 2H1YA 1N34J 2BW7A 5KFSA 4OZ1A 4IOCQ 1X0PA 3UI3A 2GVDA 2BV3A 3KHGA 3HDSA 3PHTA 5DQGA 3WX4A 1NMEB 4ETXA 1J27A 1MWZA 2XMMA 3H7HB 4H4KA 8ATCB 3CXCR 1RT1B 3B8HA 3I5BA 4QYZK 4DSEA 4LRAA 5EDWA 1KLMB 1CQNA 1L3KA 1YZ7A 2JVRA 2JZ5A 3MPUB 3D2WA 2W2PP 4ECRA 2ZH7A 1HI8A 1LW2B 1HD0A 4IUFA 4RW4B 1ZPVA 2IM0A 4GVBA 2HRYA 4ER8A 2RNEA 2ZM6J 2H65B 1OIAA 4M8LA 2RS2A 4I67A 4ZJQA 1BLUA 1S9EA 3MPVA 3TJ8A 4Y6IA 2R2UA 4ID8A 4JV0A 1SJ3P 3MTKA 1SVDA 2IIHA 1Y4ZB 4Q2MA 3J80Y 1FWKA 2HBYB 5KFTA 2MSSA 3MM5A 2R7QA 1GMVA 2GMJA 4C11A 4QWBA 1NM2A 4DV3J 2P5VA 1F5AA 2DY9A 5A8KB 2MKJA 4LF5F 3BGRA 3CDUA 1KLMA 2M7SA 4XIUA 3MFHA 3ZNUA 1EETB 3IR6B 5HMYA 4OHWA 1S4FA 4DCPB 2GQQA 2HVIA 1GXUA 4NL5A 1XNQF 5IOLA 1Y9OA 1NK6A 2MKYA 2Z2LA 2FVQA 2XMAA 1SUQB 2DH9A 1JLGB 1T94A 3NGKA 1NJYA 1EB0A 3AJDA 4JI3F 2RDDA 3H2LA 2YWGA 3L09A 2ZH5A 4HT5A 2EK1A 2VL1A 5K8MA 2K06A 5KT3A 3EUNA 5A6WA 4C98A 1RUSA 2M2BA 3CDBA 3MAAA 4RUCA 1SBRA 1IR0A 4JP8A 3IMQJ 1RLDA 4KAIA 4L76A 4NLUA 4XK8C 3ZZUA 3GIRA 2COLA 4LVNP 4NMXA 4X4QA 1UVJA 3TRGA 4B3OA 1RLCL 4FBUA 5K8OA 2MQNA 1NDLA 4WZMA 3SEOA 3RAXA 5EN1A 1FF2A 2CWXA 3CO9A 2BUNA 4XDDA 1E6VB 3IR5B 4BCAA 4GKJJ 4LQ3A 4I68A 4C6AA 3T1YF 2W9BA 2ERRA 3FDSA 3ZZTA 3VAGA 1IJFB 3D0HE 1IKWB 2UU9J 1TKXA 4FF4A 3FJ2A 3DC2A 3D6HB 3M32A 3U02A 4F0KA 1LWFA 3CO0P 3GV5B 2GHWA 3DXBA 1LK5A 4D3GA 4DR1J 4DS4A 1VQPS 3N6MA 4NXNF 2ZUAA 3SFGA 1WTBA 4LFBF 5F41A 3GIJA 1DTQB 2X1BA 3ZTPA 3I31A 1QSLA 1RWPB 4Q43A 2B9WA 4IH7A 5BYSA 3CJTA 3KLIB 3D68A 1Q7LB 2KT5A 1TP7A 2XWYA 1FD2A 4RW7B 2VIHA 1S77D 3H98A 1E6VA 1WOOA 4KFBB 3S7RA 3A3NB 5ITHA 3QO9B 4P72A 3Q8VA 3BGFA 4DL2A 4UY85 2EC0A 1HYSA 3EXYA 3AQPA 5A6PA 5JVGQ 3QPIA 4OI3A 4DCOB 2IVMA 2QV6A 3R97A 2CIMA 4HEA9 1Q8BA 4CLLA 4U96A 2OGUA 2PI4A 2PSZA 4Q8EA 3NNCA 4DQPA 4Q0BA 1PYSB 2E5IA 4U9RA 2MJUA 3OFGA 1DTQA 1F3VA 1F0XA 1FCAA 3KJQB 3R3TA 5KFGA 5B0CA 3O3LA 3PEHA 3TZXA 1MWYA 1PJ6A 4DG1B 2C28A 3RBXA 4A8FA 4TYAA 4FVCA 2ZVSA 3UE2A 3BYRA 1EAYC 3K5PA 4LR9A 4DS5A 2ZKTA 4B9NA 2XB2D 3CCJS 5KOXA 5L8RC 2N82B 4NYOA 3HF5A 2CVEA 3N9UC 4OX9F 1GXLA 2RHSB 3A8KA 1P8GA 2OP5A 3RGIA 4QPXA 4MAKA 2MQOA 2X1GA 1NXIA 5FLXU 1SC1B 3NGDA 1F5BA 4B9VA 1SH2A 1YJUA 2YVSA 1U49A 4USVA 4DDFA 1XMQF 3MAAB 3MI7X 2CNNB 2DGXA 4FN5A 4PXCA 4JI2F 3W62A 2W2OP 5LMUJ 1D0EA 5HLFB 2C2NA 3QSIA 4PQAA 4R0JA 5LMUF 2XNRA 1XIQA 2H54B 3K5MA 4K4VA 2HHPA 4RZRA 2C2KB 3MEEA 4NZ6A 3GP9A 4LSNA 3GV8B 5ETPA 2A2DA 2R7RA 2F63A 1FERA 3EMTA 3JS9A 3NS7B 2YX7A 3BN7A 4ZP6A 1FKPA 3TVKA 3US5A 1C0TB 2GJ2A 4C0OC 3KK3A 1S0MA 4JV5J 2WHOA 4M5HA 4YY3F 3G6YA 4Q0BB 4DV4J 2HQ3A 2GFFA 4J9SA 3IP0A 3NL0A 4ILMA 4KGKA 3PO5A 3C16A 4S0MA 2H4WB 3JSBA 1RZMA 2V8HA 4WE1A 1SI9A 2B4PA 1U8WA 2C2MB 1XMBA 4RW6B 2JH3A 1B99A 3W66A 4TN2A 4YR0A 1N48A 3B54A 4WK3A 4PABA 5CYMB 3SSRA 3DI6A 1CG2A 4RPFA 1TFWA 1LFWA 1N88A 2M52A 2Q1LA 2ZITA 1MMNA 5THWA 5MLCV 1T95A 1VIXA 3UD3P 2F9JA 5DLGA 1HWJA 3KK2A 3N6LA 2DVIA 2XYPB 2VKRA 2WRMA 2ZEJA 2JL9A 4Q45A 3CTRA 1URNA 3IWXA 1KQSR 1YI2S 4JI8J 3R27A 3CMAS 2UUBF 1DARA 2DIVA 3LALA 4H4OB 2VDHA 2LECA 2LXUA 1VJWA 2G0CA 2GV1A 4ZKAA 3KLHA 1ZTTA 1B70B 4QWCA 4IRDA 4USKA 1MSWD 2ZKUA 4X62F 2DRAA 2DNLA 4IOBA 3V2UC 4C8NA 4CO1A 4TXSA 5FD1A 4IOAQ 1FD8A 2ATCB 2CKWA 3HVRA 5D3GA 3D6FB 3GJRB 4N41A 2DISA 4O3QA 2J0QD 2CZVC 2VC1A 3KJNB 4WU3A 2VPYB 3PO4A 2J0XA 3HT0A 1JXEA 3IO1A 1YBTA 1QUPA 2YKOA 1KOOA 3O5TB 4QYZJ 4NLPA 4M5JA 3BYPA 3MTJA 3BBBA 3BV8A 2GAGC 1C1BA 1TKZB 2P9GA 2ZJRQ 1V3ZA 1ULRA 3LGHA 3MGJA 5FIIA 4C8MA 1HNIA 1BUXA 1RXOB 3OL7A 2D7SA 4WXWA 2MGZA 2DR6A 4FS2A 4FNHA 4H54A 4NA2A 3P4UB 4LF1A 4EBCA 3DRPA 2X51A 1WUUA 2ZOFA 2D3O1 4ES1A 1RTDB 5A2QU 1P9YA 1I6JA 1NDKA 1ZS6A 3IBCB 4OYPA 1WKJA 1H72C 3DRYA 4MMOA 5GADU 2FY8A 1U1PA 2NXCA 1GMWD 5J2PB 3J81j 5D4PA 3MEDA 3IN5A 1XR5A 2NSBA 3UDVA 3BO3A 4DR5F 3AOAA 4XPEA 2MMYA 3OFFA 2HZVA 2HRUA 2VG5A 1H2UX 4GVBB 1S1VA 2P6SA 3A8JA 1XNRF 4WIQA 3QO9A 1EHWA 1ICEB 1NCLA 1TAQA 4JI0J 4KE5A 5BR8J 5D3GB 1Y00A 4MYUA 1RWWB 4F4AA 2EVZA 1WEXA 3VAKA 1WSRA 2DHAA 4R5PB 2UXCJ 2UUCF 3QT7A 3T1AA 4OI4A 5LMNF 2M8HA 2YNHA 3I82A 2M5YA 1M5KC 1G2EA 1CPZA 4KY3A 4W92B 4JI6F 1HBMA 2B7BB 1X31C 1CJVB 4NLDA 3MUTP 4F36A 4ZCLA 1U1QA 2PA3A 1KC8T 4A8OA 4ZOSA 3HHLD 4RX6A 1CJKA 4DF4A 1R6YA 2FJBB 3AOCA 1D8ZA 3W5ZA 4YS2A 4X4RA 3KUHA 3PX0A 4LBPA 2I2YA 4M95A 3QJJA 1NBEB 4IFVA 5F8IA 4DQIA 2OPPA 4HACA 3ZZYA 3OR1B 1ZYQA 2ADBA 2F5GA 1WC5A 2KXHA 3G87A 4K5RA 4DPTA 3G6ES 1N5TA 2ZOGA 4JB8B 2ZC4A 5GAGU 3SI8A 3M6WA 4QCLA 2MTLA 3PG9A 2WBRA 2UVVA 3PR5B 4B3MF 3QJLA 4A8YA 2BW2A 3M8SA 1M1HA 3FKBA 1S1VB 2MHNA 1FDBA 1JLGA 3DDKA 4ITSA 1JXLA 3UVJB 1B0PA 5KG3A 4QPTA 4QOTA 2V6AA 4AUKA 2HAIA 5I3UB 5J2NA 1TKDA 1IM6A 4Y34A 3OVBA 5LXRA 5E3RA 4WFYA 4ANEA 4TU9A 3DYAA 3FEYB 3SQOP 3NP5A 4KGXB 4ED5A 2IBKA 1QM9A 4ZITA 5J2MB 3MUMP 3DGPB 4EZ6A 4C11B 1WHYA 1Y0HA 3QIDA 4PXBA 2NPIA 3SDEB 4ED3A 1KLNA 3T5KA 1IBKF 1VQNS 1O0PA 2DD8S 3R1HA 4YY3J 1DLOB 3U1NA 1UEUA 2WOMB 5A2QY 1J5EF 2R7VA 4ZVSB 4NLQA 2BOAA 3TX0A 1HWKA 4Z2XA 4N5SA 3U7JA 3OQ2A 3KG0A 4KH1B 1U1OA 1Q8LA 3GFZA 1OQ3A 2DR5A 2FY1A 3HK2A 2G9OA 2R42A 3ZZPA 1V9OA 2CNOB 2LQBA 4AT1B 3DNCA 2Q43A 2J9DA 3PR4A 2B9YA 2G13A 3FCHA 4AQYJ 1JJ4A 3K5NA 4FF2A 2VB6A 4AQYF 1FTCA 1RHJB 1Y5IB 4K7QA 4F3QA 4KTQA 2RJZA 4NLGA 2CQ4A 2ZE2A 2YKMA 3FK4A 2CDQA 2DH7A 4B3OB 3B4MA 3DOKA 3ONQA 3W9HA 2D3OR 1RISA 3CW2C 1NPPA 5KFUA 1DHMA 3W2WB 3V6DB 2FJXA 3I0RA 1X60A 4ZK7M 2NR0A 2CNLB 4DL7A 1NSPA 4YFUA 2HMIB 4C8LA 2QN6B 3UNGC 4K4TA 1SH3A 2VG6A 1NKCA 1S9FA 1H7WA 2A18A 3NBPB 4TYBA 3KG1A 3OR2A 4RW8A 4X62J 1W2IA 1R6VA 2YQ3A 3C19A 4X4SA 4DFJA 1QDUB 4OZ5A 1FJGJ 3Q8SB 3PKYA 2QFIA 3M8WA 1IKYB 1F9FA 2PEHA 3OXGA 4OYMA 3MM8A 1HFEL 1TMMA 2Z8QA 4MIAA 3QAUA 4CO0A 4Z7CA 2OPSB 5LSRA 3VAHA 2B4VA 4X64J 4IRCA 1LXJA 4DLGA 3DFEA 4OHYA 3WIVA 3M2RA 2NYIA 4WK1A 4OI6A 5IV4A 4AL6A 5GMDA 4Q8FA 1N33F 3Q23A 4OZ3A 1G6BA 3C2PA 4LSLA 4WP8A 1NSAA 2GCFA 2H51B 1RAJA 2DGUA 2ZDPA 1VFJA 3KWMA 1FXDA 1NPKA 4K5SA 4B02A 3H90A 3QT6A 4MKAA 1YVFA 3HZGA 1MG7A 2C2OB 1FXLA 1RTJA 2M0GB 2BM1A 3VAFA 3SMZA 5KFRA 2J7UA 2YPYA 2JFDA 1R31A 2FPHX 2RKIA 5AJ3J 2B8PA 3P5TL 4I6WA 4EYIB 5H9EJ 3V5RA 3VQTA 5E3CA 2RMLA 1IN0A 2A3JA 3BDEA 4GKJF 2A6MA 1PJ7A 4X66F 2EKNA 4OJHA 3DM2A 3NAHA 1IBMJ 1RKJA 4DZDA 1YRTA 1DZ5A 1KP6A 1NK0A 2AEMA 2K7KA 3DRRA 3NGTA 5BR8F 4PUOA 3HVTA 1YBAA 2O5DA 5F8NA 4CNZA 1HNVA 2J0SD 4OFZA 1FNXH 1TKTB 1S0NA 4NX9A 3QIPA 4O3NA 4AYBD 2WSFC 2WW8A 1F6TA 3E51A 5KAKA 2CG4A 3UWTA 4WKYA 2VA3A 3K7RA 5L9NA 3KLFA 1RT6B 4B9MA 3RJMB 2GGPB 3MOZA 1VHIA 4ZIVA 3KLEB 3MWBA 4PWWA 3GILA 3M8QA 5F8HA 2LDYA 2IAJB 3HHLA 1DBDA 3L7PA 1AROP 2YNGB 1HR0F 1UW4A 2J9DE 3J7Z5 1HNZJ 4JBCA 2C3UA 3FVYA 4ETZA 2NZCA 1VBZA 2MZTA 4PRFA 3RU0A 2HIYA 5C42A 2CPIA 4ECVA 2XI2A 2KRRA 4U8VA 2DB1A 3CCLS 4YQWA 1UVLA 2HHHJ 3KUGA 2OO4A 3F41A 1VQ4S 3KDNA 2RU3A 3IAM9 4XTTA 4ZVOB 3UPFA 3RBDA 2J6TA 1OJ4A 1N33J 3EM1A 5J1EA 1Q8IA 3CSKA 3PTWA 4HL9A 1KHVA 4RNFA 4K2JA 4NZ0A 4LFCJ 1P6TA 4CLSA 2C3MA 2XO7A 1XNQJ 2G4BA 5EHHA 3OTOF 3DU5A 2QL9B 2MKIA 2GVZB 3LP0A 2QEXS 1PCAA 5ETSA 2A1BA 3RW7A 2XS7A 2XY7A 2CAJA 2V68A 3J81U 4V1Ak 3TAQA 2XG8A 1DQ9A 3N5FA 3UCZP 2JC1A 3AB2B 3G8TA 5B0GA 1S1TA 4DPUA 1NJWA 2F8HA 4IFYA 4J9VA 5GAGI 2VQEJ 3HP6A 1Z2LA 1HW9A 1A7GE 1FEEA 5HN0A 3KDOA 2K8GA 3DDIA 4PEOA 3K17A 1OPZA 2GZOA 2CPZA 5AT1B 3WQPA 1SQEA 3OVAA 4OHXA 1KD1T 4RJVA 3M05A 4P6QA 2BJ1A 2VJVA 1WC4A 1S9GA 4FDFA 1HBUA 1QSSA 4DX6A 4DQRA 4OL8A 2B6AB 2Y9HA 3C16B 1HMVB 2Z56B 3AT1B 3KHLA 1RJJA 2VPWB 2HVDA 1J2VA 1Q7YT 2RRAA 2OPQB 3I5CA 1Q5VA 5IM0B 3TUPA 5HANA 3GPAA 3H5UA 4KGZB 5E7OB 3IS9B 4A48A 2E9RX 2P2CB 4DOZA 1YX2A 3MCOA 1M1GA 5KFOA 3CJKA 3BB5A 5KFBA 1IKXB 2B4UA 2Z0GA 3QLHB 2OPPB 2G2YA 1H98A 4OIXA 2AEJA 2LDIA 3DRXA 4LREA 1Q0NA 1LW0B 5DG8A 4IR9A 4ZVEA 4NXMF 3L7UA 2WSCC 3FNNA 2FQQB 4ZVPB 4DZ6A 1P9QC 2JEFA 2UUBJ 2RF2A 3LW5C 2PN6A 4FYDA 4RO0A 5L1JA 1JLBA 1CEZA 2CFXA 2R7WA 1VC0A 1NK8A 3Q83A 3FSXA 2ASDA 1RT5A 1GMUA 4ZPTR 3W7BA 2V8DA 1ZM9A 1RHKB 2OELA 1VQSA 3LAMA 2MEWA 5DJBA 3HPOA 1M5HA 3IBWA 4DV3F 4K50A 1NHVA 5B0EA 4CWBA 4NEYA 5DDOC 3WC2A 3M8YA 3MPYA 4IO1A 2BJ7A 2FUG9 4DBQA 5KFQA 4X64F 2R7XA 2QL7B 4X2BA 4V19J 3CEDA 4ZMMA 5AXNA 2GVDB 2KZZA 3ISNC 2YKNB 3LOUA 1N0UA 5J1EB 2GMLA 5IT0A 4ECXA 1DFDA 5K8PA 3KK1B 1S1WA 4OYOA 5HJYA 4DHVA 3QZ7A 3MPWA 2FJEB 4NRTA 3TR5A 2O3DA 4PWDA 2CRLA 3MEGB 2YWWA 5HMXA 3THVA 2RKIB 3TVYA 4N77A 5CAAA 3A3PB 2BM0A 4HVZA 3CCUS 3I4PA 1OS5A 1RTIA 3MXHP 2KRBA 1TUGB 1S76D 3ENVA 3LWLA 1AT1B 3VVTA 3KLGA 2V69A 2ZHAA 1FKAF 4K4YA 3PW4A 4ZPVR 2QO3A 4CYUB 4PWUA 5K5MA 3V6HA 4JI1J 2IC3B 3I32A 4LF8J 3DLEB 4ZCKA 4Q2LA 5D77A 4DSJA 2Q66A 4OYAA 1FNMA 1HBNA 1NHUA 1BQXA 2B56A 1LW2A 2XZTB 2UZAA 1IBLF 2CQ0A 2XBPA 3K89A 5E33A 3MR5A 3CC4S 1S0OA 1N32J 4WP3A 4ED7A 1SJ1A 1N54B 3DI6B 1FKPB 2E1RA 3UDCA 3KK3B 2ZH8A 2WK4A 2W1BA 4JI7J 4QYRA 1FO1A 2JVOA 2WCXA 2AYEA 1H7XA 1JB0C 5C25B 1NSQA 3D0IE 4DR7J 1U6ZA 1JLCA 4DEZA 1HW8A 2HWHA 4LRDA 1L3SA 2DO4A 1F2GA 1DAXA 1TL5A 3MMBB 1HBOB 1H6KX 3CUNA 3FGVA 1HHSA 4KQZA 4BLGA 1JQGA 1JLEB 3EVMA 3LGNA 4ECUA 3CE8A 4PPZA 3UW1A 1HL6A 4OJ3A 1HI1A 4IQMA 3SBMA 1NK5A 1NJXA 1LKZA 3IRXB 1NK7A 3AFGA 4OZNA 4CT8A 1ZETA 4O3RA 2Y8WA 4QZVB 5HVHA 1FFWB 4M5LA 2BKNA 4PQUA 1G4CA 5I3QA 3R5AA 4P10A 1C4CA 2VOPA 2LQJA 3NWRA 3OR1A 4P7TA 4XDCA 1NO8A 4Y28C 5HJXA 3SSQA 1YJ9S 3VGUA 4DPXA 2CQ2A 4P74A 4WXOA 4YOEA 2OSRA 1GAOA 1YK9A 7FDRA 1R8PA 2IMOA 4LRCA 5KFYA 2KFNA 2GNKA 2GHPA 3F0NA 2UV8G 4CTAB 2OTJS 1NH8A 4CNYA 1U48A 2W9CB 1QUVA 1EIYB 5CH7B 3IRWP 1ACMB 2H4YB 4F4YA 4RKUC 5JUMA 3VALA 2B43A 2RH3A 2EFOA 4EBEA 3FQLA 1UEVA 2VPXB 3B4DA 1QY7A 4I7FB 3LP2A 2MKHA 2RS8A 1FRJA 1S6OA 2UUTA 3WIUA 2ZD1A 2ZZTA 3M6XA 3FEZA 4FS1A 4WIIA 3TAMB 2EFNA 3VHQA 4HHUA 3SQGA 4M5DB 1WELA 4X4VA 1Q8KA 3UDEA 3TI0A 3TP2A 1FRMA 1D1UA 1UMJA 3EDRB 4DR7F 3FQKA 2UXBF 1RT6A 4F0HA 2ZH2A 1AYEA 2NS1B 1VRQC 1YDLA 4M63A 1PO6A 1TL1B 3GYNA 4C3MA 4NCBA 4OYXA 5D0EA 2V0NA 4PKDB 3W63A 2R2SA 4KHPF 3BKFA 2AJ1A 1IBMF 4J91A 2QX0A 3QGPA 3CCZA 4PUOB 2HHXA 1XNRJ 2HFZA 2ROPA 2MKKA 1SIWB 1G7CB 4O44B 3JYTB 3N5BA 1HPZA 1VBKA 2YXLA 4JUZA 4PG8A 3JQMA 5BYRA 5DQIA 2CUYA 1JIHA 2RQMA 2X7IA 2FHJA 1H38A 2N3LA 1Y3JA 1VBXA 3BDPA 3R2DJ 2VG7B 2D69A 4CLTA 1Y10A 1RHQB 4RUHA 3CC7S 4UTGA 5KFLA 4NYZA 3DRSB 2LXFA 2HURA 2L9DA 3GMGA 4R0EA 4R5PA 2JHEA 1VI7A 4HI2A 4DV6J 1HR0J 2XSJA 4WFXA 1KVKA 2Z2MA 2IJNA 1MU2A 2FD2A 2LEPA 1T8EA 1AZSB 2XTJP 5HK4A 9RUBA 1YJNS 4DSFA 4CO4A 5H1SV 2AX0A 3GCWP 5F8GA 2R2TA 4O4GB 3DOKB 3JAMY 4AXIA 3BH6B 3CD0A 3B78A 1UAWA 4DLEA 1WG4A 2CPFA 3HHEA 3KNAA 1KOHA 3R5DA 1NEEA 4PYDA 5KFFA 1OO0B 2KB2A 2ZUGA 3KK2B 2CG8A 4B3SF 1TVRB 1XK8A 2LKZA 4MK7A 5ETMA 3TEGA 3PYFA 5CD4H 3PV8A 1TU0B 3ENQA 2LA6A 4DR3F 2IDLA 4KJIA 2D74B 2POKA 3I6PA 1JMTA 5IV3A 4YP3A 1T02A 4JYAJ 3SFUA 1UZDA 4J5OA 4IRKA 1VQ8S 3J80U 3UCGA 2EPIA 2VOOA 1S1UA 1FFGB 3D28A 5F8MA 4ID5B 2B0GA 1RKIA 1YJRA 2HZAA 1F9EB 2DEIA 4DSIA 2KT3A 4LSZB 4ZVRB 3MUVP 2Q6BA 4P2MA 4TLQA 4Y2IA 3NG8A 1WJ9A 3GYXB 3C14B 4AD6A 2UVRA 3DYAB 4NXNJ 4DUYJ 3CWJA 1RTZA 3W8PA 3CB4A 1D3WA 2XSJB 3MR3A 5F8LA 4PG6A 2YQ1A 4NCAA 3N28A 2KJWA 1R0AA 5IM0A 1NKBA 4MTPA 2HW3A 4DFPA 2B51A 2Y0BB 4E8UA 1NSKL 1KFSA 1KQKA 4CCHA 2KVQE 1N5YB 1UJ4A 2AZ1A 3W2VA 4RU9A 5DGBA 3OJSA 3NNAA 2KH9A 2QLXA 3TNVA 2CQHA 4G65A 4J9NA 2AYBA 2MZQA 1Q5YA 3OL9A 1IWAA 2RILA 4MIBA 5J1PA 2ZM6F 5HMZA 4Y65A 4L73A 4ZS6A 1H3DA 2E1PA 4LBIA 1FVQA 3DN9A 1BHNA 5DDQC 1VQLS 5KFZA 4EO6A 3GQCA 1U6BA 5L1KA 4IO9Q 2UV8A 3EZUA 2C2RA 1KTQA 1OSCA 4PR6A 1ZM4A 1S1XB 2DT9A 3EGNA 1JLEA 2HWIA 3SSSA 4CO5A 3J7YU 1AFIA 4YB5A 1LWXA 2KI2A 3W9JA 4DPYA 2C22A 2ASJA 4ANDA 1GFWB 1UWAA 5IC6B 1P27B 2F40A 2XI3A 4MK8A 3HSZA 2CJ9A 3GFXA 4NLXA 4C0HA 2GS8A 1VQKS 1GQEA 4LF7J 2C42A 1WF2A 5A0YA 1RT3B 4CM2A 2RQCA 1F60B 2XQCA 5F8JA 4JI3J 2ZBIA 4G1QA 4DX7A 3BGRB 3LH2S 3T9NA 1OWXA 5C42B 5L38A 2UVUA 1VK8A 5DDPC 2R8JA 3BGLA 3ETMA 1RTHA 2R4FA 4QWDA 1RT5B 4RNHA 2R7UA 1MMDA 1A0OB 1HNIB 1GT8A 1GTEA 1SQGA 1DJ0A 3DLGA 5CYJA 2HQDA 1RWMB 5A8RB 3T1HF 2BQUA 2VUGA 1VRTB 3KTQA 3HHDA 1TMJA 2YY3A 2XLKA 1J5EJ 1RDRA 5DRKA 2UXBJ 2IJRA 2AIRB 2CQDA 2LEBA 3ET6B 5F3ZA 3ADAC 1VS3A 1RT7B 3DMJB 2A6OA 3PCOB 1WWHA 1N5QA 2HVZA 5AE3A 4DL0C 3GFYA 3MCMA 2AJ0A 4G1QB 6FD1A 1VMBA 3FFIA 4NWBA 4U7CA 1VQMS 2HVHA 4EMDA 3V81B 4NCGB 5DDRC 2EC2A 4LIWA 3P6YC 2W25A 2W7OA 3M9MB 1I51B 1RQ0A 1U8SA 3SIPB 1S6PA 5KFXA 4ZHRB 3N6NA 2XMUA 3CJRA 1SKRA 1VISA 2MZSA 3L4BC 5CYQA 4U7UK 4G3IA 1GK8A 2BKPA 5B0FA 4QQBA 3EPIA 3FBCA 3TQ1A 1W2BR 2E1CA 2J6UA 3QLHA 2ZNZA 4ZP9A 1PYOB 3SCKE 4B3TJ 1X4GA 3HZEA 2QFJA 2J7KA 2E66A 4UOCA 3C6UA 3GCXP 4LRBA 5L46A 4F25A 4GC7A 4NLVA 4PYAA 1T3NA 4JI4F 2DGOA 3JYTA 2F4FA 3T5LA 4M94A 4J37A 2DNNA 4ZVGA 4X4OA 1U45A 4MJKA 3FEXB 3FZBA 1ITPA 1D9AA 1X9WA 2DXFA 4H4MA 1X4AA 2YKAA 3VGSA 4X65F 1N36J 2W2MP 1WKLA 4ZIWA 2OD6A 5F3TA 5EGYA 1EQMA 2KM8C 1AW0A 1BC6A 2W2QP 4KT0C 2HQFA 2FLLA 3RW6A 4KBIA 1J5OA 2KT2A 3MM7A 3V4IA 4UW2A 1KONA 5EWGA 2VBWA 4Y2AA 4K4ZA 4KPYA 4ED4A 4USIA 5I42B 1MROA 4ECYA 5I3PA 4ECQA 3I4HX 2MHEA 4ZVQB 3OW2R 5G4DA 4CLUA 4ES3A 1Q95G 2MPUA 2QLJB 3LUYA 3WX8A 4JI2J 1HWUA 2G2ZA 2QGFB 2HEKA 3IGVA 3M2VB 1ZTWA 2YWKA 3NOCA 4KB7A 2N3OA 1X4HA 2BANA 2VC0A 3D1QA 3ILJA 4ZPDA 3FBBA 3PKMA 1YTYA 4JYAF 1FE4A 4NA3A 2LEAA 2DITA 2IPOB 1BWVA 3TJ9A 2W7PA 2Y1IA 5IT4A 3PFOA 4C2MA 4CIOA 3M9NB 1FRIA 2DXEA 2KJVA 1PJ5A 1UVKA 1IR2A 3K8VA 5SUHA 4ZLNA 1L3UA 4JI1F 3OSPA 2V8VA 5CQGA 1FT8A 2JC0A 3QIPB 2Z2YB 3V81A 2R3VA 3QRRA 3ISZA 2E1AA 5BJRA 1DY3A 4QIEA 2VD3A 2CA9A 1Y3KA 2W9BB 4LFBJ 2XGPA 2WSEC 2R8GA 3BEGB 3TWZA 3G82B 4HTIA 4ATNA 4HACB 2E9TA 3M8ZA 4OMFG 5HBMA 4ED8A 2V2KA 2XLIA 2VG6B 2MJNA 1GMWA 1NK4A 3ICLA 1MN9A 4PG5A 2DHHA 2JOQA 4UOGA 4NA1A 5KFIA 4MFBB 2DGSA 2JDJA 1R0AB 4H4KC 1TK0A 2GO8A 4I4BA 4ZLJA 1FVSA 1RCXB 1UWBB 3I87A 5EUHA 3VCDA 2QLFB 2XNQA 4G6VB 4PCQA 4DN0A 4X84A 5LXYA 4DV0F 3EPGA 3BO4A 3CJKB 3E2EA 1JNZB 1RTIB 3ZC4A 4WZQA 1TL3A 4URQU 3UN3A 1BQNB 1YG0A 2SXLA 5GADI 2IVYA 1S4EA 1UETA 4C48A 1S99A 2G2OA 1CJTA 2XS5A 1VRUA 3NY0A 2QRRA 1CSJA 4C8ZA 2YQ0A 1FDNA 3X1LB 4B08A 4XAKA 4UOHA 1XTZA 1IUJA 2CJYB 1UKUA 2JRSA 4DUTA 5KOWA 1J5OB 1B4SA 3D7SB 4FKXA 2YKNA 3RBEA 1B7YB 5M2PA 4CLWA 4B3MJ 4LF9F 1PKUA 1OY8A 4KO0B 2AD9A 3MM9A 3O44A 2AU0A 3KOAA 3WZ0A 5ETOA 3DOMB 3DOLA 4F04B 4WP9A 4DV1F 3PVXA 2CPJA 2XO6A 2AYGA 2DHXA 4K0KF 4ZPCA 2W9CA 3OTOJ 1XMQJ 1JLAA 5J2QB 4I64A 4QW9A 4WWSA 2RRBA 4R8UB 4B9UA 1CULB 2F3JA 3CDAA 4TY9A 2YPZA 3QFHA 1AA1B 2F9DA 3L95X 2D9OA 2QT7A 4DL6A 2ABYA 3CGIA 2OLWA 3H20A 5CABA 4WFAQ 4DR2F 3KHHA 5G0RA 1M5SA 3CF5Q 2ZDOA 3T3FA 1M5OC 2Z4PA 5B09A 3H0PA 1OYDA 1S79A 2APOA 4DR4F 1SPBP 2BBEA 4YEAA 3SDEA 2RE1A 1RAGB 4PZVA 4RW4A 3CPWR 2KKHA 3LGMA 2R8IA 3GJSB 1REVB 1RU2A 4LSNB 1S6PB 1SJQA 4ZHRA 3AAWB 3GG1A 1NHKL 4B3RJ 2HNZB 1QD1A 4USUA 4OJ1A 2CPXA 2FJVA 1IVZA 5I3UA 2DH8A 2IRUA 4OI1A 4UZCA 3CVKA 3BKTA 3M8QB 4B17A 3JSMB 4LFAJ 1RYRA 1P1TA 1YGYA 3CT9A 3LA0A 4UF4A 3MCNA 1I5OB 3G8QA 1T9YA 3DXSX 4ICLB 3VTIA 4XO0A 1KR4A 2OPSA 1UVNA 4ILRA 5LMNJ 2WOMA 3GG0A 2IHR1 2PO4A 3CIZA 2GIFA 4JI6J 3QT5A 1KN6A 3NWGA 4J9MA 1E6YA 3D3BJ 2L08A 4E2FB 3KJVA 2YNIA 4USJC 1RCOB 3IRXA 3IBFB 4OYBA 5HROA 1RT2A 4LIRA 1SC6A 1X4DA 3LWMA 1PBAA 1RBLA 3EGWB 4LR7A 1C1CA 3L9ZA 1HQ2A 4FKYA 4I0WA 3GIIA 1RK8A 5EWEA 1ZPWX 2DNKA 3BS9A 3CNQP 3POTB 3TAMA 5KFDA 1S1WB 2W4PA 3OUYA 5KG7A 1UVIA 1HLWA 2OMLA 3P5BP 3FRZA 3CCWA 1U1NA 2JX2A 4Y0FA 2BABA 1SV5A 3BZQA 4OV1A 3N4WA 3TA0A 3KMSA 1VQ6S 2EXUA 2H48B 5LSOA 4AL7A 1X4FA 5CXTA 1HHTP 2Q3PA 3W65A 1LWCB 2KXFA 3NRBA 2CPYA 1ZAVA 2XULA 3ETOA 3OL8A 4A8MP 1RT2B 2DBBA 4GC6A 1ZM3A 1UPPA 4J9UE 4N7TA 3EWGA 3PHEA 1VCTA 5GMKa 1HBUB 2AW0A 4BC9A 4L75A 2P9EA 3FSIA 3QSYB 2NUUG 1X9MA 1JLBB 3DLEA 4H4OA 3G4SS 1BMQB 3QWPA 1TV6A 2BJ3A 3I96A 1QTNB 3MM8B 4N8OA 3ZXWA 4ZPBA 3FBFA 3CJ2A 4IDKA 4AXJA 4ILLA 3OFHA 4JV2A 5HL7Q 1RE1B 2HRTA 1WHWA 2G0IA 3DGVA 2PDAA 3AJ1A 3DRPB 2XC9A 3T1HJ 4RW9B 1QAJA 5K8NA 3G6VA 1U7LA 3EYZA 2FVRA 1IBLJ 2EW9A 4OHVA 4LR8A 4YR3A 4ECTA 3M8PA 2XLJA 3MOJB 1N32F 1O5JA 4ZP8A 1KKHA 4ALZA 2QTWA 2RF2B 3MD3A 1WHVA 2KL8A 3FUYA 2BE9B 4EFAC 4DUYF 4A8QA 2LQ8A 2EG2A 1Y5NB 1WHXA 4WFNQ 5ETVA 4J9PA 2AJ4A 2BZ2A 3N01A 2JNJA 1R0CB 3MDFA 3L3CA 3GONA 1YJTA 2AJ2A 4G1IA 2NCKL 3KLVA 4URGA 1WKKA 4U67Q 3RB3A 3LF0A 4F67A 2PIIA 3H4DA 1I94F 3DU6A 1T0TV 2YNIB 4KSEB 2JFKA 2J6SA 1UP1A 3G6XA 2VFSA 2BX6A 3W9IA 1HNZF 1X5OA 4DFMA 3ET6A 2XM3A 3MM5B 1V6HA 4FVMA 2R7OA 2FLOA 3U27A 2XMVA 1S0VA 1TV6B 3EZOA 2V4RA 5JXSA 2PI5A 4KO0A 4F4KA 5E2QA 3BKUA 1S1XA 1RAOA 4JI5F 3NMRA 4Q44A 3UN2A 2NPFA 3W61A 1N5YA 1FJ7A 4JI5J 4NLWA 4IG3A 3SCJE 4I1TA 4O4GA 4LJMA 1MMLA 6FDRA 4HHHA 5J2QA 3HFZB 1JJHA 1LFPA 4OZ0A 2BVZA 1CJTB 4NZ7A 4RU2A 4J90A 2BYCA 5CD4A 3I56S 1NNDA 3MHYA 4P2FA 4IG0B 4NYPA 2BRKA 2HWTA 4DV1J 2AYMA 2CZ4A 2PFDA 4EO8A 2G1DA 3CJ5A 1VQOS 1LWEA 2HNDA 4HI1A 5DG7A 4U7UD 2KG0A 3H5XA 2HS0A 5HLFA 1VQ9S 4JV1A 3HKWA 1S7IA 5AXLA 3PX6A 4N76A 3HCXA 2GW8A 1S1UB 2DNQA 2BE2A 4TY8A 4Y2MA 4ZP7A 4EK2A 3CCMS 5RUBA 2MQLA 1NZAA 3JTOA 5K14B 1S1TB 5KT4A 3RG6A 3FC9A 1CULA 3CD7A 2L9NA 3Q24A 2FHMA 3C15B 2Y0SD 5D0HA 4I6AA 1X4BA 3HSDA 1RAHB 2VQFJ 3SV4A 1SL1A 5GVQA 2RU9A 1D09B 3ILOA 1S57A 4F4XA 4DR6F 3SXLA 1UCNA 4YR2A 2I5JA 1ZA2B 2VFRA 5E0OA 4RW6A 1M0SA 2J9EA 1H0HB 4I56A 4CH0S 4DR1F 3KLFB 1NUEA 5HP1A 2OFHX 2VFUA 4WTYA 1TK5A 1DRZA 3TYTA 4ZVHA 2AP6A 1O6XA 2RQKA 1HNXF 1VRUB 1RACB 3GWCA 4E0DA 2UXCF 2BQRA 2QC3A 3BSNA 1U1MA 2DGVA 1N5VA 1SJ4P 1EP4A 2MKSA 1UFWA 3Q8QB 1FESA 2BE7D 2N4DA 2FC9A 3I9ZA 4K4WA 4B3TF 3NBPA 2ZBRA 2VFVA 2DEJA 1Z1ZA 1HMVA 4NLOA 1ZAXA 2PGCA 1HQUB 2L41A 4KGVB 4Y00A 2KHDA 2NQPA 2GC8A 1R8AA 4CLKA 3CC2S 3DDNA 4Y2CA 5C7PA 1UFKA 4LBHA 1Z2ZA 3UN5A 3BM7A 3W2WA 3OVSA 2AGQA 1CS4A 4LRFA 1NPRA 3KLEA 1BD6A 5LT5A 4J9OA 1KRPA 3NS6A 3PRVA 2V2QA 2D3ZA 1SKUB 2C2EA 1RTDA 1URRA 4ZN1A 1KHWA 4KHRA 4NI2B 3PY8A 1RA7A 2FJDB 4LVOP 2OEKA 3H40A 2NREA 1RYSA 5K20B 2BKOA 2CQ1A 5KG4A 4C0BA 3HJVA 4URSA 3BQ2A 1F9HA 2AZ3A 2FJAB 4C7QA 2AWZA 3LP1B 1B0VA 2HFUA 3N0VA 1AFJA 5M2UA 3BPDA 3W5YA 4FPRA 3R6GB 3MR7A 4YB6A 4ZCIA 2PT0A 5BXIA 4DUZF 1ELOA 4LFCF 3TAPA 2ZH9A 3M2UA 2H5JB 4BBYA 2R9LA 3IXQA 3L7OA 2BJ9A 5C2CA 2RAQA 4RNOA 4O0NA 3GU0A 1KNZA 4X4NA 3H59A 2LU1A 4PQUB 3RR7A 1QAXA 3P45B 2CJAA 1KVJA 2VZ9A 4RR5A 2YX1A 2BJ8A 2NXNA 3C15A 3OD2A 4Q5VA 2YWEA 1ZA1B 1IQTA 2JSXA 4ECZA 4QR2A 4AL5A 3OTBA 2JLEA 4DX8H 5HQ8A 1M5PC 1IR1A 4RW7A 1HWIA 2M70A 1N5SA 3J7AN 2WZ1A 2KFYA 3M6VA 1WG5A 1WC0A 5L1LA 2FVSA 3WBZA 1S72S 3M8RA 4V19X 2GQ2A 3FCVA 2C1EB 4FZVA 4ZVTB 1R8CA 2RRNA 3R8YA 3R7NB 3OTEA 3ZTQA 4MKYA 5LSLA 3M2VA 4B3RF 5H9FK 5KFEA 1DQ8A 2CJBA 3VGTA 1WSVA 5IT9U 1CQMA 3TANA 3EDQB 2AGPA 4M5MA 2OD4A 4DXLA 2I0XA 2NLWA 4LFAF 1PBUA 4CH1A 1ZBTA 2XWXA 3FFIB 1MROB 1X8DA 3VWSA 2ALZA 2A10A 2V4JA 1G3OA 4RNNA 1RT4B 2VICA 2RQ4A 1L3VA 1PILA 1UFLA 3PFEA 3AY0A 4ANCA 3E8OA 2F4VJ 4YUDA 3HXMA 4DL5A 2I38A 3VV2B 4J9QA 3PDNA 5LOQA 3PZPA 1EZZB 1FKOB 2OHDA 4TQSA 1U25A 3BREA 4QR0A 4TLRA 6AT1B 1T7PA 2BANB 4LMZA 3HULA 4DF8A 5H9EK 3AOBA 1NJZA 1F1BB 3H42A 2BACA 3NOGA 4QIGA 1I1GA 1FK9B 2XEXA 3OFEA 3HVAA 3EX7B 1AZSA 1FA0A 5T7LB 2ATLA 4EZ9A 1RWVB 3G9CA 3MEKA 3QZ8A 1IKVB 4LF7F 1WEYA 4B9SA 1BQMB 3D67A 2Z2ZA 4DL3A 1VQ5S 2QZ8A 2GIRA 2C3YA 2MZ1A 1Y11A 5GMEA 2LP4A 3MZIA 2DNHA 1YJWS 3C6TB 2VG7A 2RUSA 2X3DA 2DHSA 3FZ2A 4C97A 3M2UB 3PRBA 1EARA 2K3KA 4EEYA 3PX4A 1TAUA 3KNGA 1NJIT 2UUWA 2RSQA 2VASA 2XYGB 3ZNJ1 1FRKA 5IZHA 1JLQB 2B9EA 1HPZB 1N56A 4OYWA 3QMQA 3F56A 5J2MA 4KV8A 2ZHBA 2F1FA 4A8XA 2QMUB 1FWLA 1IXKA 3AB4B 5D0RA 1VC5A 2OPRB 3CJQA 3D9BA 5FDLB 4OYIA 4HR2A 2Y8YA 3SZ2A 3HSGA 4LQ9A 3K5LA 3OL6A 4BWMA 2HQCA 4DV7J 1T05B 2BJEA 1MWQA 3JTNA 3C14A 5DG9A 2WVEA 3ZFVA 3C8YA 1KBRA 3BO2A 1RWNB 1X5TA 3TUIC 1H2VZ 1W26A 2QYGA 3FSYA 3LP2B 3QAEA 2G0JA 2L9WA 4WE1B 5AE2A 2XS2A 2M3DA 3BBFA 1KQGB 2M9KA 4CLYA 2W7AA 4HH1A 3TZWA 3OJUA 1EQ0A 1IKVA 2DNYA 3E3XA 1Q78A 2IJFA 1F3FA 2VU5A 2QMXA 3BPSP 3IS9A 3IWLA 2Y3YA 4TNOA 4NPOA 4OX8A 4P73A 3LTOA 3MMCB 5ETRA 5FDLA 3UFCX 2NXEA 1REVA 3R5JB 1OPIA 2QE5A 3NCQA 1T9UA 4HLBA 4LF6J 4YDXA 4YHHJ 4QR1A 1QE1A 2PA8D 2DKOB 3MECA 1SL0A 2LYVA 3J7ZT 1TVRA 3HKZD 3AHPA 4F02A 2ACMA 3PJ9A 3PNIA 2V8PA 1LWFB 2V9KA 5B0BA 3FMWA 3NS5A 1SL2A 3NCPA 4RBVA 3DKDA 4YB1P 3R6LB 1R43A 2LVWA 5DS7A 4UQTA 4FXDA 2YBVA 2EG1A 2FZKB 3LQVA 4ZA1A 5EX3A 2DNMA 4FXWA 1IJEB 1Q82T 2HVEA 2IRYA 3AH6A 1VLYA 1JKHB 1M5VC 3MMCA 3KLHB 4I2QB 2RVJA 2MSTA 2VFTA 3U1MA 2HNZA 2ZVIA 2AX1A 2RDIA 2O1PA 2JEJA 2EBGA 2P6TA 4OZ2A 5ADZA 5B0DA 2DR9A 1JK9B 3PIPQ 3M1VA 4LF5J 3D54A 2C2ZB 4FXVA 1N8RT 3NEKA 4CT9A 4KR0B 2YNGA 4M5GA 1VQYA 3IFEA 1IWGA 4MK9A 3X3UA 5T41A 4NCGA 2RDJA 2XMJA 4AE5A 4F8RA 4I2QA 3TW0A 1UTAA 2FJWA 3A1YG 1HYSB 2VBXA 1TUWA 2VDIA 4IG3B 3ENAA 1KEKA 3UO0A 3G8SA 1U0HA 3QGIA 3OXFA 2V94A 4TQRA 3WHIA 3CCSS 5KT6A 1PAEX 2KDOA 4HDGA 3VAIA 4U8YA 2DR8A 1L5UA 2EFPA 3MF5A 4O44A 2WVFA 3G71S 1IM4A 2HHTA 1FX2A 2W01A 2HBZB 1U1RA 2DNGA 2DRDA 1X5SA 2HBRB 1CBKA 2I8EA 1TTHB 5D15A 4ZPWR 1RGVA 1PYTA 4BS2A 1WDTA 4B9TA 5IXUA 4GKKF 4YDDB 4ECWA 3GZ7A 4OJGA 8AT1B 1TL3B 3OSNA 1C0UA 1RSCA 1DQAA 1MLAA 2HAFA 4DQSA 1I94J 3VR1A 2QG9B 2BMBA 3IC1A 3JTPA 3UR3C 1RWXB 2OJ3A 3EGZA 1S5ZA 3GYGA 2IFXA 1VBYA 4OLOA 3C6UB 4JI8F 1V3SA 3O6QA 3BN4A 1HA1A 2MY7A 2IAJA 3HHLB 2AF6A 2B5JB 4L3NA 3S6EA 3SCIE 2ZJPQ 1SKSA 2UXDJ 2HSEB 1FDDA 2BA9A 2PMWA 3OT9A 7AT1B 2H3EB 3Q0AA 1YWXA 3ITHB 2Z30B 2HHUA 1YZ6A 4ZJOA 1EKRA 5FLXY 1OYEA 3F44A 4OLPA 3MEEB 1BXNA 5KFHA 5MAOA 2JEIA 1VJQA 1B0TA 3CCTA 1B7FA 1RBAA 4GVLA 4HH0A 3CCES 1SC4B 2OEMA 3H2VE 5FJ4A 4OX7A 1Q81T 2DYAA 5KFAA 1R7IA 5IC4B 4J9RA 1S48A 1FX4A 1XJWB 2D1CA 2KHCA 5KG2A 3DLKA 2FC8A 5C5JA 1QAIA 2DNZA 2I9SA 2K7JA 2V8GA 3HFVA 4DJBA 4Z37A 3QRPA 4C8YA 4CRJA 1TFYA 2JWNA 3H4BA 2FLPA 3BSAA 2K1RB 3RUBL 2AT1B 1WACA 3TO8A 1VLOA 1X5PA 5IT9Y 4B9LA 2ALYB 4ES2A 3TJAA 2UVWA 4PXEA 5E3QA 1UA1A 1TL1A 2VA2A 3IM8A 2RB7A 2PMHA 1RU1A 3K8WA 2HLTA 2MQMA 1EX8A 1XWLA 3A4TA 2KO1A 2BEFA 2ZOMA 2X3GA 3DM2B 3LANA 1WTFA 3KFWX 5A0YB 1K73T 3PW2A 4IQXA 3DLJA 4DR6J 2QLBB 2FB0A 1HBOA 3MD1A 2YNFA 2B6AA 3UCUP 1LWEB 1PGZA 1PIEA 4U95A 2DO0A 2UU9F 1UVMA 1TZ0A 2OMOA 3QFWA 3W1YC 1KFDA 4LT6A 3G82A 2AEFA 2NXUA 1WI6A 2ZNYA 3H5SA 5KT5A 1D9DA 2P8IA 3R9LA 2HGNA 4OQJA 1QAYA 1X4CA 1XEZA 4DSKA 3K57A 2VH7A 3NGRA 7FD1A 3VAJA 1QTMA 2B7CB 4MYTA 4YHHF 1X9SA 2Z57B 2LCWA 4GO5X 4ZLLA 4WCEQ 1NKEA 3SQGB 3ZZRA 4PWDB 2DCUB 1TK8A 2HFVA 1JX4A 1R3NA 2K3IA 3W2VB 2IRXA 4DU7A 3KHRA 1U1LA 1BQNA 2RUGA 3U1LA 1U24A 2M88A 5ETTA 4MIWA 3H5YA 5KFMA 3DRSA 3Q2SC 2FZGB 3PW7A 1N4LA 2MXYA 4GO7X 5L39A 3SCLE 1WNEA 4ZVUB 1GX5A 2M4MA 2CQCA 2OSQA 3K2YA 1WF0A 2OIHA 3OPKA 5A8KA 1YJ7A 2IA0A 3PRDA 2ZWOA 1HBNB 2ILZA 4CZCA 1HI0P 4F0MA 2ZE2B 5DETA 2VF3A 1CJKB 2GJFA 4OX9J 5KFPA 5EX0A 2GAHC 1U6FA 5A8RA 3P96A 4USWA 1NB7A 4IFYB 4ELUA 4DQQA 2N7CA 5I4MA 1RWOB 1YHQS 3KG4A 1FRXA 2FDNA 1VR6A 5BYQA 5B0AA 3D5MA 5F0UA 3AQOA 4LF2A 5HROB 4F4ZA 2MB0B 3MM7B 3V4IB 3M30B 2YH0A 3D0GE 2VQEF 1BE4A 1BGXT 4CP5A 3D1HA 4BWJA 1FEHA 1SIZA 1WG1A 1HNVB 5HSPA 2ADCA 5AXMA 4DV2J 2R8KA 3OLAA 1VK3A 1JNRB 1Q16B 2IC3A 4DSLA 1RHUB 2VKZG 4YB7A 1C1BB 5LJ5Y 4RUAA 1FI4A 2DIUA 3OHAA 4I6YA 2WTFA 5HVFA 2MLYA 2VJUA 1SV5B 3BF4A 2E5GA 4NASA 2IMWP 4E98A 3O1LA 4HYKA 2VG5B 1QE1B 2CQBA 3G86A 3O8WA 4QJVA 3AD9C 4TKTA 5J1NA 3V4MA 1IKXA 4IH5A 1HIYA 1RBOB 3I9V9 3EZ5A 4DR5J 3RB4A 4KHPJ 4F2RA 1C1CB 2LQ5A 4DFKA 4UOFA 5DM6Q 4GKKJ 4PXDA 1H74A 3ISND 3EVWA 4G1PA 4I2PB 3SYZA 2F4VF 5D78A 1DTTA 3ZTRA 4L3KA 5K9FA 1AB8A 1CC8A 1RAEB 2YTCA 5D0GA 2HYIB 4NXMJ 2FLNA 2EKYA 4CDIA 4FF1A 1NB2A 5AXKA 4O3SA 3RAMA 3RRGA 2CZ9A 4IDKB 4F50A 1HHQA 4ID5A 2MLXA 5GAEU 2E5LF 2ZH1A 2KN4A 2ILYA 1FKOA 4CO3A 1PAUB 1UL3A 2J9CA 2XMWA 2E9ZA 2EFGA 3FMBA 2UXDF 4RWXA 2RD5C 1LW0A 2IDEA 2QL5B 5HBMB 3F73A 2DGTA 2UP1A 1S6QB 3EXCX 4USMA 5KFNA 1GNKA 3D3CJ 2M8DB 3T41A 4EYHB 1O51A 4X65J 3NKYA 5ETLA 4DMZA 3HVTB 2V67A 1LNQA 1TQLA 3IGNA 2BQ3A 4QU6A 1RWUA 3CJ4A 3BSCA 1NZ8A 2XY6A 1RHMB 4W98A 3VVUA 5KG1A 2HIQA 3W3SA 1LXNA 1JJCB 2FGOA 4RLEA 3T5HA 1R0BG 3M1VB 1OMSA 1SUQA 3OTDA 1ZM2A 2EBEA 3HSJA 3QNWB 3T5JA 3EGVA 2MZRA 5CHCB 3DCAA 3Q8RB 2XCAA 2HFOA 3IM9A 3M8PB 3AA9A 4NLTA 4DR2J 3EICA 1SXLA 3OXLA 4NE9C 5M2RA 2HQIA 4ZLPA 2YH1A 3CMQA 4QBUA 1U2RA 5KG5A 2HLUA 1MNEA 1Q53A 5IS2A 2LFVA 5AJ3F 1TKTA 5L9XA 3OUYB 3R2CJ 1JJ2R 3M9OB 2K1RA 4CLZA 3DOMA 3DOLB 1XC9A 3ILIA 5D4NA 1TL4A 3Q86A 4IYQA 5HP1B 3GIMA 3UQSA 3C6TA 3C66A 3K5OA 2ROEA 5HO4A 2C2DA 3HFKA 8RUCA 4Y2KA 4L72B 1U2FA 4F2SA 1LEOA 4X66J 5D6GA 5DO2A 2YKQA 2X1FA 1T9TA 3AA8A 1MU2B 3ZZOA 2HFNA 4P2XA 2KM8B 1S7HA 1V3RA 2CQPA 2W8LA 2KTQA 2XMKA 3GFHA 3K59A 2V63A 2ZBQA 3NGUA 1HQEA 3BH7B 5T7LA 2AV5A 3QQCD 4ICLA 2PC6A 3V6KA 4WU2A 4D3HA 4A8SA 1WC6A 3WDOA 2CWKA 3W64A 3M7VA 4DWIA 1LK7A 2BXJA 4M1KA 4WYLA 3QYYA 4KKOA 4LF6F 1VDHA 3JAMU 3JQJA 5CCMA 1NRKA 3FRYA 4J9LA 5AE1A 2AQ4A 5IQQA 3TZYA 3ELHA 2JEGA 3HO1A 5D8HB 3OV7A 2NYHA 4M5NA 4L6V3 1W7WA 2FHKA 1JLFB 3D6MB 1RT4A 3Q8UA 4KV8B 1HQEB 2QSWA 3T19A 3BQ0A 4FP9A 2XYHB 1R8HA 3ZTOA 4UZBA 4EBDA 1EKSA 3HT3A 5LJ3Y 2AHOB 1FNOA 5B7WA 5JJBA 1QSYA 1KSPA 4IH6A 1UA0A 4LF9J 1WOPA 2HQGA 2E5HA 1PC4A 4LF4F 1C2PA 3MMJA 5JMNA 4UUWA 1HWLA 2DRBA 4MKVA 3BQ1A 4FYWB 1N6QA 4USHA 1GXTA 3QT8A 2ZC3A 1RAIB 4W4MA 1UJ5A 2ZD1B 5EWFA 2I1RA 2CPDA 1CJUA 1HQUA 1F2HA 3MMAB 3MM9B 3QGHA 3AXKA 2Q79A 2ZH3A 5KT2A 3RAQA 4DG1A 2O01C 3ULHA 2OFGX 3H25A 3AXMA 4KFBA 3ZTSA 3E01A 3JQKA 2N4CA 1T11A 1ZAWA 1FDAA 1B64A 1CS4B 4PPDA 2V2VA 1HD1A 2MY8A 4USTA 2EWHA 3DHXA 4HHJA 3TVZA 2BR0A 2CJKA 5IFMA 1H2TZ 1T05A 3C3LA 2HHQA 3A8IA 1C0TA 2DHGA 3H8YA 3D6TB 2W4DA 1JLCB 4CLPA 2VODA 1S10A 1RTJB 2VQFF 2VV5A 2HK2A 3MEDB 1UEKA 4CLFA 3V6DA 1Q86T 4RUBA 1CJUB 3D1OA 3RBZA 2RHQB 2XZWA 2WAQD 3LP0B 3CCQS 3T6BA 1U09A 2YNFB 5CA5A 4WF9Q 3K58A 4M5IA 1PSDA 2X1AA 1A6LA 4ERDA 2HPUA 1TKZA 5T14A 2F65A 2GJIA 4IFVB 1KTVA 2W4CA 5HATA 1TR0A 3UD5A 1WI8A 4KRWA 3CIMA 1NH7A 2HMIA 2KVIA 2KZMA 3CDEA 3GJQB 1T9VA 4DI6A 2V5HG 1LV5A 1WDDA 1VYAA 4YN3B 2E5LJ 4K59A 1GTHA 4ZPAA 1X4EA 3TQEA 4M5KA 1WC3A 3A8EA 2ZWPA 1SQFA 2G1HA 1WD6A 2FHJD 2HNDB 3GB0A 3CD5A 3MAHA 3BBCA 4OI2A 1T03B 4K4UA 2E7XA 1L3TA 1Y5LB 3B6BA 1DURA 2PE8A 1S59A 1OQ6A 4A4JA 2GX8A 2W9AA 2XMTA 3EVOA 5E3PA 4MKBA 3GE9A 1GEHA 2HGLA 3I0RB 3NLCA 4A46A 5HMWA 5GAHI 2WVDA 4X4TA 3JSRA 3S1TA 2VONA 4LSLB 3RZAA 4C9DA 2OAUA 3CJSA 1RI7A 1N52B 1VOMA 2E5JA 1AUDA 1ROFA 2FZCB 5A8WA 3DLKB 4UUXA 2YKPA 4N56A 3MR2A 4DV5F 1YRUA 4IG0A 3CMES 2I5JB 4ELVA 3QATA 1K0TA 2V4JB 1OY6A 2ACYA 1DLOA 1VQ7S 1NDPA 3MURP 1XR7A 2CQGA 3P3DA 4H4MB 2IVFB 2UUAF 1RTHB 1D9FA 4NLRA 2J8SA 3HJFA 4P75A 2H5IB 1NAQA 2Y1RI 3AD8C 3S01A 3UNYA 2Y1JA 2KYZA 4J7CA 4FYVB 1UZHA 4PG7A 4DR4J 2B8QA 2O66A 2V34A 2EEYA 2HBQB 1VGYA 5K14A 3OTCA 4DU8A 1XMOF 2WB1D 1HNWJ 4K4SA 4Z7YA 4X4UA 3Q2TC 1XMOJ 1HNWF 4L74A 2ZZNA 2HG4A 3B82A 2B5JA 3T1YJ 3W5XA 1HBMB 3KK1A 3V6JA 2DR7A 3O2IA 2V9WA 4QU7A 4F4WA 4NOHA 9ATCB 4UQGA 2OKQA 2YKMB 2MLZA 5KG0A 2EK6A 2R8HA 1W25A 1BQMA 2FHOB 2XY5A 3P49B 4FBTA 1FJEB 3WC0A 1GX6A 1F5CA 3KUEA 2E1MC 4GMKA 4QIFA 4TY8B 4JI0F 4WTOB 2F7VA 4FF3A 1K44A 2C3PA 3MM6B 5C24A 2GHVC 4RNMA 3NMAA 1TL7B 3FBEA 1XBWA 1S9GB 1YSJA 1N34F 1KVIA 1S49A 2MYFA 1TELA 2MDAA 3NCRA 4ZJLA 4TU7A 4ED1A 3PM9A 4WKRA 4UY8T 3QRQA 1YBUA 3BGOP 3M4XA 1K9MT 4OI0A 1SC3B 2I6WA 1CJVA 2HS4A 1A9NB 4A8KA 4KPCA 2OPRA 1FXRA 1H73A 5DZ7A 1FWPA 3HHLC 4ED2A 1E6YB 3KJVB 3NNHA 3VF0B 2CPHA 2QA1A 2DNOA 4RBUA 4EU0A 4C8OA 2B3TB 4F7VA 2CJQA 5HQLA 5HVGA 4U6PA 2MGZB 2DNRA 4LUBA 3G2XA 5U47A 1KWMA 4OZJA 2CXEA 2HS3A 2HNYB 2OUGA 3I0SB 3ILLA 5IQ6A 4R25A 4O0IA 2DGWA 4BC7A 3JB9k 1ZZNA 1XR6A 3Q89A 1JWWA 3QGGA 3MMBA 5ETKA 4P7VA 1YLXA 4HTJA 4LF4J 4EUVA 2A0FB 4CI0B 2AMCB 3KMQA 4M5DA 3IG1A 3MPDA 4WJBA 3GLJA 2DNPA 2XGQA 4WPAA 1LWCA 2ROGA 3CJ3A 3MEGA 3E01B 2F8EX 4P71A 3I55S 2EFQA 1WF1A 2BOPA 4K0KJ 4PG4A 3PYEA 2PFFB 3T9ZA 2XZDB 1XN9A 1YITS 3THPA 1APSA 2J7WA 4KYZA 3TOQA 2C3OA 2AJFE 2WONB 4C4WA 4O4RA 2VPZB 4Q7AA 5KG6A 1JLQA 3HMJG 2LU2A 2FIUA 1MW7A 4CYUA 1V5IB 2AKWB 2ZFHA 4JOUA 4N47A 4AFFA 2QSFA 3THTA 4J9KA 3H2UB 3RB6A 3OLBA 4P2SA 1CLFA 5F9NA 1RA6A 2HGMA 3Q8PB 3UR0A 1YJVA 1JLAB 4OYZA 1IKWA 2BDPA 2E7WA 4FNIA 4DV7F 3J81Y 3I5AA 1VIOA 4MH8A 3IWNC 2GMHA 3GV7B 3OR2B 3LO3A 1UW9A 3PACA 1B3TA 2DTJA 1WOSA 1R8BA 3HD1A 1BY9A 4DN9A 2QA2A 2H9ZA 3GSIA 3CCVS 4NLSA 3BR9A 4PAAA 2E7VA 4WFZA 2J76E 2FVCA 2MQ8A 2HFSA 3AD7C 2ZH6A 4ELTA 5E5NA 1LOUA 3RYLA 1HNXJ 2KG1A 4IKAA 1U2CA 2ZBCA 2U2FA 3S8SA 4I69A 4F3MA 2GGPA 1C4AA 2UUCJ 1I3OB 4BHQA 3TARA 2NUHA 4R8UA 1S6UA 2J5AA 4EI2A 2W24A 3BJYA 4RW9A 3GJTB 3JXOA 1WC1A 3MR6A 5CZXA 4JI4J 3QWUA 4DV6F 2NZ4A 1EP4B 3ZZZA 1JXVA 5A76A 2V2ZA 3RRKA 5GAHU 5D4LA 2IY5B 1TUVA 2K2PA 4O3OA 5JVHQ 1VC6A 5F9LA 1N36F 1Q79A 4MFBA 4NMLA 3DRRB 2VBZA 2YWFA 2J8AA 5GAEI 2MZJA 4K4XA 4NLYA 1D8YA 2ASLA 2OI2A 1OSDA 3CULA 3Q22A 2DCLA 2VHGA 3LP1A 3NXZA 2CDRB 3QBCA 5KFJA 1FRLA 4C3KA 1TKXB 2FVPA 4GRSA 3JSMA 1U0HB 4B3SJ 1PC5A 3R5GA 1RT3A 3ENWA 4K2XA 1AUSL 4NI2A 5DZ6A 4ZN3A 2KU7A 4RBTA 2DK2A 1R89A 2L3MA 2QJ3A 2WVBA 3GTYX 5A8WB 4X4PA 1FRHA 3MMAA 3HI9A 2YX4A 3QJPA 4NRUA 3PEJA 1LQ9A 3KJFB 3C46A 1KQFB 3VZHA 2MQQA 4WBFA 1P1LA 3RR8A 1HARA 2JJ4D 4ED0A 3UD4P 3GIKA 3M2RB 4ECSA 4C8KA 4HKQA 4CO2A 1V5VA 2CPEA 2H5EA 3N79A 2IBOA 4QIVA 2N7YA 3TUZC 1MN7A 4ZCMA 1S6QA 5KFVA 5CCLA 4QWAA 4ZVFA 1AXQA 4EGLA 1NDCA 2KYXA 2WBMA 3R5CA 1RADB 2CNKB 2LMIA 4ENOA 1N6QB 5F0WA 5G0RB 1REGX 3R7SB 2DJWA 1M90T 4JI7F 2ASYA 1BWEA 3DLHA 1Y7PA 4OV6A 1K1SA 2ZBPA 4DX5A 1WORA 5KFCA 5KT7A 1SCJB 1WEZA 2XSFA 1X7VA 2ZZMA 5KTQA 3MFIA 2HK3A 3CDWA 2EFVA 4QWEA 3K0JA 3TA2A 4EWTA 3DLGB 3TUJC 2LA4A 2ZH4A 2ZHOA 4KKOB 4IR1A 1QVFR 3HHNB 1GH8A 3BSOA 2FTRA 3D66A 2CADA 2QIFA 3LPYA 4TVAB 3TX8A 2CYYA 1EJ7L 3PIOQ 2YNHB 4A47A 1CVJA 2CVIA 2MKCA 2DXDA 5HI7A 5LL6d 3RB0A 1DTTB 2FGCA 3FCWA 1FK9A 2FYXA 2D41A 2GA7A 5IWAF 4DV0J 4O23A 3CCRS 1X0FA 1T03A 1RT1A 2RT3A 3DLLQ 5KFKA 2P9CA 4OZLA 5IWAJ 1PG5B
chains in the Genus database with same CATH topology
3POTA 3VQSA 3BR8A 1ZH5A 3IG1B 3IA0A 4CTAA 3GR1A 2KFZA 2BJDA 2IM2A 2HHHF 2CQIA 1QLNA 3OBIA 5CYQB 3MAQA 3KKFA 2R7SA 3VZIA 1FJGF 1FE0A 2HNYA 5DLFA 2XCPA 3HLUA 3HHKA 3OHBA 5SZTA 3TA1A 1XERA 5I42A 3CD6S 1U26A 3M30A 3PXGa 2MQPA 1JLFA 1RP5A 1K8AT 3HX9A 1SJRA 2B4OA 4WFBQ 2D9PA 4RWWA 4N76A 4DL4A 4Y3CA 4C3LA 1O8BA 2KXNB 3J7YI 4KGMA 1U4BA 2GIQA 2LXIA 2ZJQQ 5J2NB 1YRXA 2IYIA 4DV2F 2LLZA 2YWHA 4KHMA 5DGAA 3GR0A 2LQ9A 3UDLA 4I7FA 4HDHA 1K0VA 4QIWD 2B9XA 5KFWA 3DHWC 4I2PA 1YQHA 3ITHA 4LF8F 1UWBA 3KLIA 1N0VC 1VHFA 2OPQA 5L1IA 2OH2A 2R7TA 1SH0A 4YMEA 1S97A 3KYLA 2VBYA 2QYCA 2QA4G 1SB6A 3ZZ0A 2HHVA 1NU4A 3SV3A 2D3UA 1C0UB 3M32B 2RIJA 3M6UA 3NAIA 3I0SA 3PJWA 3MCSA 3PJXA 2F8MA 5DM7Q 2JLFA 3JSYA 1Q4RA 3BGUA 2E29A 1ZZFA 2GQCA 1FHTA 1KS2A 2XHWA 2Q6CA 2HHWA 2W8KA 2PD1A 2OTLS 2QLWA 2GO9A 3CJ0A 2O67A 2BE2B 1CC7A 2L48A 3IR7B 4TU8A 1S9EB 2R2RA 4DPOA 1YIJS 3DLBA 1Z4UA 3HVWA 3KLGB 2E44A 4W90B 2WONA 1FJCA 1T3OA 3MM6A 5C24B 1Q1KA 2HZCA 3RRHA 2BRLA 2U1AA 5C25A 2V4QA 3GSDA 5J2PA 3PW5A 2DGQA 1QVGR 3J7A1 1U47A 1EETA 5B08A 4KIAA 2IA6A 2AJQA 4O3PA 5H9FJ 1JKHA 3LAKA 2IM1A 3IAS9 5CZVA 1K1QA 4ED6A 4CH7A 1U1KA 1SKWA 4WYWA 3G96A 1R27B 4BDPA 4CQ1A 2A2CA 4A8WA 4XPCA 3PW0A 4ZDNA 2CQ3A 2EI5A 4QW8A 2DPJA 5DQHA 1G1XA 2WB4A 1ZOTA 3R5BA 2DPIA 1VRTA 2J0WA 4OX6A 4KC5A 3DGPA 4RW8B 1RT7A 3DMJA 4HT7A 2AGOA 1NK9A 1SJFA 3AJ2A 2NSCA 1IKYA 5E3AA 1QJHA 1IQZA 3T6JA 5D4OA 5CYMA 2HHSA 4F3OA 2IM3A 1FTRA 4F26A 5E41A 2PMZD 4DV4F 2QMWA 3R1LA 3X1LB 1UJ6A 2IYGA 4OHZA 4N8NA 3RTVA 2QA4S 3MECB 3HM9A 3VAMA 5KFSA 4IOCQ 4OZ1A 1X0PA 3UI3A 2BV3A 3KHGA 3HDSA 5DQGA 3WX4A 4ETXA 1MWZA 2XMMA 4H4KA 3CXCR 1RT1B 3B8HA 3I5BA 4DSEA 5EDWA 1KLMB 1CQNA 1L3KA 2JVRA 2JZ5A 3D2WA 4ECRA 2ZH7A 1HI8A 1LW2B 1HD0A 4IUFA 4RW4B 1ZPVA 2IM0A 2HRYA 2RNEA 2RS2A 4M8LA 1OIAA 4I67A 1BLUA 1S9EA 3MPVA 4Y6IA 2R2UA 4ID8A 4JV0A 1SJ3P 3MTKA 3J80Y 1Y4ZB 4Q2MA 5KFTA 2MSSA 3MM5A 2R7QA 2GMJA 4C11A 4QWBA 2P5VA 1F5AA 5A8KB 2MKJA 4LF5F 3BGRA 3CDUA 1KLMA 2M7SA 4XIUA 3MFHA 1EETB 3IR6B 5HMYA 4OHWA 1S4FA 2GQQA 2HVIA 1GXUA 4NL5A 1XNQF 2FVQA 1Y9OA 1NK6A 2Z2LA 1SUQB 2DH9A 1JLGB 1T94A 3NGKA 1NJYA 4JI3F 3H2LA 3L09A 2YWGA 2ZH5A 4HT5A 2EK1A 2VL1A 5K8MA 5KT3A 3EUNA 5A6WA 4C98A 2M2BA 3CDBA 1M1KT 4RUCA 1SBRA 1IR0A 4NLUA 3ZZUA 4KAIA 4XK8C 2COLA 4LVNP 4X4QA 1UVJA 3TRGA 4B3OA 4FBUA 5K8OA 2MQNA 4WZMA 3SEOA 3RAXA 5EN1A 1FF2A 4XDDA 3CO9A 2BUNA 1E6VB 3IR5B 4BCAA 4LQ3A 4I68A 3T1YF 2ERRA 2W9BA 3FDSA 3ZZTA 3VAGA 1IJFB 3D0HE 1IKWB 4FF4A 1TKXA 3FJ2A 3DC2A 3M32A 3U02A 1LWFA 3GV5B 2GHWA 3DXBA 1LK5A 4D3GA 4DS4A 1VQPS 3N6MA 4NXNF 3SFGA 1WTBA 4LFBF 5F41A 3GIJA 1DTQB 2X1BA 3I31A 1QSLA 4Q43A 2B9WA 4IH7A 5BYSA 3KLIB 1Q7LB 2KT5A 1TP7A 2XWYA 1FD2A 4RW7B 1S77D 3H98A 1E6VA 4KFBB 3S7RA 5ITHA 4DL2A 3QO9B 1HYSA 3BGFA 2EC0A 4UY85 3EXYA 3AQPA 5A6PA 5JVGQ 3QPIA 4OI3A 2IVMA 2QV6A 2CIMA 4HEA9 1Q8BA 4Q8EA 3NNCA 2PI4A 2PSZA 4DQPA 4Q0BA 2E5IA 4U9RA 2MJUA 3OFGA 1DTQA 1F0XA 1FCAA 3R3TA 5KFGA 5B0CA 3O3LA 3PEHA 1MWYA 4DG1B 2C28A 4A8FA 4TYAA 4FVCA 2ZVSA 3UE2A 3K5PA 4DS5A 2ZKTA 4B9NA 2XB2D 3CCJS 5KOXA 5L8RC 2N82B 4NYOA 3HF5A 2CVEA 3N9UC 4OX9F 1GXLA 4QPXA 2MQOA 1P8GA 2OP5A 1NJXA 4V19J 4MAKA 3NGDA 2X1GA 4B9VA 1F5BA 1SH2A 1YJUA 2YVSA 1U49A 4DDFA 1XMQF 3MI7X 2DGXA 4FN5A 4PXCA 1D0EA 4JI2F 5HLFB 4R0JA 5LMUF 4PQAA 2XNRA 3K5MA 4K4VA 2HHPA 4RZRA 3MEEA 4NZ6A 4LSNA 3GV8B 2R7RA 2A2DA 3TVKA 1FERA 2YX7A 3BN7A 4ZP6A 1FKPA 3US5A 3KK3A 1C0TB 2GJ2A 4C0OC 4KJIA 1S0MA 2WHOA 3G6YA 4YY3F 4Q0BB 4ILMA 2HQ3A 2GFFA 4J9SA 3NL0A 4KGKA 3PO5A 4WE1A 3JSBA 2V8HA 1SI9A 2B4PA 1XMBA 4RW6B 2JH3A 1N48A 4YR0A 4TN2A 4WK3A 5CYMB 3SSRA 3DI6A 1CG2A 1TFWA 2M52A 1LFWA 1N88A 2Q1LA 2ZITA 1MMNA 5THWA 5MLCV 1T95A 1VIXA 3UD3P 2F9JA 5DLGA 1HWJA 3KK2A 3N6LA 2DVIA 2VKRA 2WRMA 2JL9A 4Q45A 3CTRA 1URNA 3IWXA 1KQSR 1YI2S 3R27A 3CMAS 2UUBF 1DARA 2DIVA 3LALA 4H4OB 2LECA 2LXUA 1VJWA 2G0CA 2GV1A 4ZKAA 1ZTTA 1MSWD 4QWCA 4IRDA 2ZKUA 4X62F 2DRAA 2DNLA 4IOBA 3V2UC 4C8NA 4CO1A 4TXSA 5FD1A 4IOAQ 1FD8A 2CKWA 3HVRA 5D3GA 4N41A 2DISA 4O3QA 2J0QD 2CZVC 2VC1A 4WU3A 2VPYB 3PO4A 2J0XA 1JXEA 3IO1A 3O5TB 1QUPA 2YKOA 1KOOA 4QYZJ 4NLPA 3MTJA 1C1BA 1TKZB 2P9GA 2ZJRQ 1V3ZA 1ULRA 3MGJA 5FIIA 4C8MA 1HNIA 3OL7A 2D7SA 4WXWA 2MGZA 4FS2A 4FNHA 4H54A 4NA2A 4EBCA 1T8EA 3DRPA 2X51A 2ZOFA 4ES1A 1RTDB 1I6JA 4MMOA 3DRYA 5GADU 1U1PA 5J2PB 2FJXA 5D4PA 3MEDA 3IN5A 1XR5A 2NSBA 3BO3A 4DR5F 3V6DB 2G4BA 4XPEA 2MMYA 3OFFA 2HRUA 2VG5A 1H2UX 1S1VA 2P6SA 1XNRF 3QO9A 1TAQA 4KE5A 5D3GB 1Y00A 4MYUA 2EVZA 1WEXA 3VAKA 2DHAA 4R5PB 2UUCF 3T1AA 4OI4A 5LMNF 2M8HA 2YNHA 3I82A 2M5YA 1M5KC 1G2EA 1CPZA 4W92B 4JI6F 1HBMA 2B7BB 4NLDA 3MUTP 1U1QA 4ZCLA 2PA3A 4A8OA 4ZOSA 3HHLD 4RX6A 4DF4A 1R6YA 2FJBB 4X4RA 1D8ZA 3PX0A 2I2YA 3QJJA 4M95A 4IFVA 5F8IA 4DQIA 2OPPA 3ZZYA 3OR1B 1ZYQA 2ADBA 4K5RA 2KXHA 3G6ES 1N5TA 2ZOGA 2ZC4A 5GAGU 3SI8A 3M6WA 4QCLA