2MSTA

Musashi1 rbd2, nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
b'KIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (MUSASHI1)
molecule tags Rna binding protein
source organism Mus musculus
publication title Structure, backbone dynamics and interactions with RNA of the C-terminal RNA-binding domain of a mouse neural RNA-binding protein, Musashi1.
pubmed doi rcsb
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mstA00
5LSLA 1K8AT 4W92B 2CPXA 2MQQA 1WG5A 2DGQA 4EGLA 3B4DA 3Q2TC 3US5A 2ERRA 3K0JA 1YJWS 2DO0A 1U1MA 5IFMA 1X5OA 1U1PA 1UAWA 4BS2A 2M4MA 2JRSA 2HZCA 2OJ3A 2MZQA 3VF0B 1H2UX 1WHWA 3JB9k 2RT3A 5GAHU 3H2UB 2M2BA 1P1TA 2CQ2A 1FNXH 2CQCA 2M70A 4UQTA 3CCUS 3PIOQ 2MSTA 1VC6A 3CD6S 1Q81T 2M8HA 3G8SA 4LMZA 1K73T 2MJNA 2K8GA 4YUDA 3PIPQ 2LMIA 5CYJA 3OW2R 3S8SA 2EK1A 1VC5A 2MY7A 3VAJA 3VAIA 4CQ1A 2KI2A 2XNQA 2NLWA 1HD0A 2F9JA 3TP2A 1WHYA 3CC2S 4RU2A 2E5HA 1OO0B 1PO6A 1WF1A 2KM8B 1WEYA 3CCMS 1M5VC 1M90T 1NU4A 4WCEQ 1H6KX 1K9MT 1DRZA 2DH9A 3CCVS 1UP1A 2MPUA 2DNZA 4U67Q 1WF2A 1N88A 2HYIB 3U1LA 2DGXA 3V4MA 3BEGB 2YWKA 2QA4S 5DDPC 2PE8A 2E5GA 2M8DB 2VOOA 3CXCR 5ITHA 2E5JA 1HL6A 1WEZA 2HGMA 2KM8C 3NMRA 2DH8A 2XB2D 2MKIA 2RQCA 2DITA 1DZ5A 3CCSS 2MB0B 4TLQA 2M7SA 5DDQC 3Q2SC 2MXYA 2KRRA 1VQ6S 5HO4A 2BZ2A 2DHSA 2LXUA 1KD1T 1WHXA 3R27A 5IQQA 5EN1A 3I55S 2DNGA 3CCES 2MZRA 1JJHA 3CCJS 4FXVA 4V19X 2X1BA 2CQBA 3EX7B 2HGLA 3CMAS 1F9FA 3VAHA 3BO2A 1YHQS 2MQPA 2N7CA 2DIUA 2XS2A 1NO8A 3FEYB 2M9KA 2CPDA 2RVJA 2KXNB 1KOHA 3HI9A 1P27B 2MZTA 3BO4A 2GO9A 1N8RT 4CH0S 2MMYA 2DNQA 1XN9A 2MZ1A 1VQ7S 1WHVA 2OSQA 3FEXB 1Q86T 2KU7A 2U2FA 5DM6Q 3H2VE 2RS2A 5D78A 1FT8A 2XS5A 1VQOS 2CQGA 2Q79A 1CVJA 2XSFA 3S7RA 2MJUA 1M5KC 3TO8A 2LQ5A 3SMZA 3VAFA 2CPYA 1WG1A 2ADCA 1SJ3P 1FJEB 5CXTA 2MSSA 2DISA 3BO3A 1X4CA 2MKSA 3G71S 5CA5A 1U1QA 2OSRA 3NS6A 3P3DA 4WFBQ 2K3KA 5GAGU 3S01A 3CF5Q 2OTLS 3THTA 3R1LA 3ULHA 3LPYA 1X4HA 1YJ9S 3P5TL 3ZZYA 1VQ8S 2N82B 2CQDA 2DNRA 2A3JA 1URNA 4FXWA 4IO9Q 1O0PA 1OPIA 1A7GE 4WF9Q 1SJ4P 2NZ4A 4C4WA 2E44A 3MUTP 2SXLA 3MUMP 5LXRA 1HD1A 1YIJS 3MXHP 3SDEB 1U6FA 1FXLA 1U1KA 2DB1A 4P6QA 3CCLS 1VQLS 3HHNB 2MHNA 2MZJA 2FY1A 2KN4A 1H2VZ 1VBXA 2F3JA 2N3OA 1WEXA 2J0SD 2AYBA 1FJ7A 3N9UC 1YTYA 2L41A 2DNMA 1U1LA 4UY8T 1W2BR 3L3CA 1WELA 3UD3P 2CQ0A 1RK8A 2VONA 1U6BA 1U1OA 1A9NB 2YKAA 2OTJS 5DM7Q 1YI2S 2CQ1A 3R1HA 1JJ4A 2KH9A 5LXYA 2JVRA 2KYXA 1RKJA 4IUFA 1FHTA 4Z2XA 2F9DA 1X4EA 1BY9A 2KG0A 3J7ZT 3U1MA 3NNAA 1X4FA 3UWTA 3IRWP 2LA4A 1WI8A 2MZSA 1B7FA 1S79A 2UP1A 5LJ5Y 1SJFA 2LXIA 4J5OA 2DNOA 2KXHA 2QFJA 1VQNS 1VQKS 1X5SA 3UD4P 2CQ4A 4Y0FA 4M5DB 2KG1A 2LKZA 4WIIA 4QPTA 4WKRA 3CMES 2MQLA 1VBYA 3NS5A 3MI7X 2HGNA 3EGNA 2RU3A 1WWHA 2X1AA 2WBRA 2B0GA 5LJ3Y 3J7YU 3MURP 3VALA 4ERDA 2MKHA 3P49B 2RUGA 2X1FA 1SXLA 2EK6A 4YB1P 1VC0A 2DNLA 5IM0B 2ADBA 2CQ3A 3RW6A 2KFYA 1UFWA 2GHPA 3NNHA 2DGWA 2LEAA 3G8TA 1X5TA 2RQ4A 4PKDB 4QU7A 1UW4A 1R8HA 3UCGA 1QVFR 3G6ES 1KOOA 3VAMA 2J8AA 4WFAQ 2JVOA 3LQVA 2CPJA 2DGTA 2VODA 1H2TZ 1N52B 2DNPA 1QM9A 3CUNA 1R8PA 4CH1A 2MQNA 3CCRS 3CTRA 1SJRA 4LIRA 5HL7Q 5D77A 3MD3A 4W90B 2DHXA 1WF0A 4Y00A 2DHGA 4F26A 4LJMA 1U1RA 5IM0A 2J76E 2RRAA 3TYTA 3G9CA 2CPFA 2XNRA 3CC7S 1WG4A 2MKKA 1WTBA 3IWNC 1X4BA 1DHMA 1SJQA 1X4AA 4PR6A 2X1GA 2DNYA 2KRBA 1ZZNA 4IOAQ 2DGUA 2M52A 1L3KA 2OIHA 2YH0A 1DBDA 2RRBA 1U1NA 2G1DA 5MLCV 2FHOB 2FPHX 1ZZFA 1Q7YT 2HVZA 2AYMA 1D8ZA 3G96A 2DH7A 1U2FA 3RW7A 3UCZP 2KHCA 5GVQA 4F25A 2I38A 1VQ5S 2DIVA 2DGOA 5BJRA 5FJ4A 1FJCA 1X4GA 2AYGA 2DK2A 3P6YC 5DDRC 3D2WA 1PGZA 4ED5A 1M5OC 2LCWA 1X4DA 5GADU 3DLLQ 2U1AA 3VAKA 2DHAA 2DNKA 4TU7A 3ZZZA 5DDOC 2YH1A 2EVZA 3MDFA 1KC8T 3BS9A 2L08A 2LA6A 2MKJA 2N3LA 1G2EA 2MQMA 4QU6A 3MUVP 4CIOA 2O3DA 3CC4S 1ZH5A 2KVIA 2MGZA 2LECA 1OIAA 2G0CA 3THPA 4ZKAA 5H1SV 5LSOA 4YOEA 1M5PC 5GAEU 2XS7A 3MD1A 1AUDA 2L9WA 2MQOA 2MKCA 2RS8A 2MGZB 2CPHA 2PEHA 1YITS 5JVGQ 2LYVA 2D9PA 1JJ2R 1VQ9S 1Q82T 3SDEA 2VOPA 3CPWR 3UE2A 1YWXA 4F02A 1IQTA 1QVGR 4TU9A 4C7QA 2I2YA 2AD9A 1S72S 2DGSA 5DETA 3UCUP 2CQPA 1VQ4S 1VQPS 2JX2A 2KT5A 5GMKa 4A8XA 4OZ0A 2CJKA 3I56S 2YTCA 2D3OR 1X5PA 2KXFA 3VAGA 2MYFA 3NNCA 2E5IA 1M1KT 2MY8A 3SXLA 2DNNA 3G4SS 2AYEA 1JMTA 1VQMS 2CQIA 2DNHA 3CCQS 2CPZA 4WFNQ 2ZJQQ 3EGZA 4PRFA 2QEXS 1FO1A 2ZJPQ 5JVHQ 1N54B 2BOPA 2DO4A 2V94A 2FC9A 2CQHA 2CPIA 2G4BA 2M0GB 4C0OC 2D9OA 1NJIT 1OWXA 1WI6A 4OZ1A 1X0FA 2DGVA 2CPEA 2ZJRQ 2JWNA 4TU8A 2J0QD 2RNEA 2FC8A 1YJNS 3CULA 2LEBA 4QQBA 3B4MA 3S6EA 1KQSR 1HA1A 2M88A 1VBZA 3DXBA 3MOJB 4IOCQ 1D9AA
chains in the Genus database with same CATH superfamily
2XMTA 3GP9A 3KNGA 3HD1A 4Z7CA 1NKCA 1TAUA 2V8HA 2UXDJ 2CPXA 4DEZA 3CD5A 1R6YA 2BDPA 1NB2A 2Z0GA 2MQQA 1T9YA 2DGQA 2F8EX 4LVOP 1IXKA 4Q7AA 2BM1A 3DRYA 4UW2A 3RBZA 2Y1JA 2HIQA 3HF5A 5D3GB 3OL8A 2ERRA 2IHR1 1WC6A 3DU6A 3BGUA 1YJWS 3K0JA 4TY9A 3QIDA 1Q5VA 2GX8A 4DF4A 2LU2A 5E3PA 1I1GA 3O6QA 1Q8LA 1NH8A 4QZVB 3KOAA 5FDLA 3I6PA 5A6WA 1VK8A 4MH8A 4GVLA 3VF0B 3KHHA 2W8KA 1WHWA 1XR6A 3M2RB 2P6SA 3MM8A 4B02A 2XCAA 4DFPA 4UY85 2AJQA 3DLEB 4ETXA 2M2BA 4ZVQB 1HNXF 2BA9A 4NLQA 1U2RA 1NDKA 2C2NA 1VC6A 4N47A 2BEFA 4OYAA 3W2WA 1K44A 3G8SA 1K73T 4USIA 4QR0A 1MW7A 2AEFA 1KKHA 3DLEA 4DR5J 1RBAA 3IR6B 4YUDA 4DR6F 1JLGB 2GV1A 2LMIA 2PT0A 3HD2A 1LKZA 4LQ9A 4IR9A 3S8SA 2J6TA 4DR4J 4EZ9A 3CJ2A 3V6HA 3HFZB 1I3OB 1J5EF 2MY7A 4O3PA 4JI3J 5L1JA 3P5BP 1U47A 1TKTB 1ZA2B 2Y9HA 4V19J 1C0TA 2RMLA 1HWJA 1RHJB 3M8WA 3FBFA 3HVAA 1QSSA 1HD0A 4NEZA 2F9JA 4DR7J 2B56A 3DOKA 3DDIA 5CYMA 3CC2S 3CJ5A 4PXCA 1TKTA 3HK2A 1HNWJ 1G1XA 3T9NA 2B4UA 2VC0A 2WVEA 1UPPA 1HW8A 2BJEA 2PA8D 1WEYA 4IYQA 4LF2A 3CCMS 1M5VC 4AQYF 1NU4A 3NS7B 3W2WB 4J9PA 4J37A 2YWHA 2W7OA 3R8YA 3SCJE 3KHLA 1NK0A 1NEEA 2GC8A 4DV4F 1EZZB 1URRA 3ADAC 2DH9A 2HRYA 3TEHB 4DN0A 3L4BC 1RAAB 1RWVB 3JTOA 1K0VA 3QGPA 4X66J 4A46A 3VVUA 3CD0A 3C14A 3V81B 3G87A 2V4RA 5DQGA 1WUUA 3BEGB 2KKHA 4RW8A 2GZOA 4UOFA 1S76D 3QJPA 3OUYA 4MK9A 1BQNA 4JBCA 1FRHA 1FNMA 3BPSP 2DXEA 3PHEA 3Q83A 1UMJA 4WJBA 3R7SB 1PIEA 4U7UK 1LK7A 4OI1A 4I2QB 2GW8A 5LSRA 1WC3A 5IC6B 2NPIA 2OD4A 3BH6B 1TK0A 4MJKA 5L8RC 1EP4B 1UFKA 1HL6A 1UVKA 1C4AA 4L6V3 4UOGA 2KYZA 4X4NA 3FBBA 4XAKA 3HHLA 3MMBA 1TL7B 4C3LA 1JNRB 1DZ5A 1R0AB 1RSCA 2LQJA 4PAAA 5DDQC 7AT1B 1NKEA 2CAJA 1FRXA 2QA2A 4ZP7A 3TZYA 3LP0B 5BR8F 1VDHA 4DLGA 2FYXA 3ZTQA 5IT4A 2XMAA 1VQ6S 2BE9B 2RIJA 1QAIA 2KHDA 1WHXA 1DURA 2V69A 3BR9A 2YWEA 4ECYA 1REGX 2HQFA 2DNGA 1NZ8A 2GMJA 1LEOA 2Y8WA 4P73A 4OV1A 4QIVA 4Y3CA 2JL9A 3KWMA 4DS4A 1UPMB 1DTQB 4DCOB 1F60B 4AL6A 4KPCA 1XNRF 5KFEA 1YJVA 3SQGA 2F7VA 2V0NA 3GJRB 5DRKA 2V4QA 2RDJA 2MQPA 3MMCB 2N7CA 3H5UA 2QLBB 1HBMA 3MPUB 2JNJA 3B6BA 4X4UA 1IKYA 2KXNB 1KOHA 3A8JA 3NBPB 4DSKA 2QGFB 3PX4A 4Z7YA 4LF4J 2AEMA 3Q89A 2LQBA 3LGMA 4OJ3A 1N8RT 4NX9A 2MMYA 1RAOA 3T1AA 5M2UA 4MKYA 2XI3A 2ZH5A 2Z2LA 1Q8IA 4PG5A 4I69A 3UN5A 3GIRA 4A48A 4LBPA 1RWWB 4O4GA 3MCOA 3AOCA 2UV8G 4UOCA 4IFVB 3RW6A 2R2RA 3RB3A 2W4DA 3TVYA 2L9NA 4A8OA 1OJ4A 1IM4A 4LF6F 3KK2B 1HNVB 4YHHJ 2CQGA 3VGUA 3KDOA 1CVJA 1YVFA 1FKPA 2IVMA 2IVYA 3SQGB 1I94J 2HHQA 1GMUA 3BYRA 1LXNA 3VAFA 2CPYA 5H9FJ 4FS2A 2AQ4A 3R6GB 1WG1A 1IKWA 1P8GA 2UVUA 4LF5F 5AXMA 1R8AA 4DMZA 1RT5A 2ADCA 2FLNA 4G3IA 4PG8A 1RTDA 4IRCA 4AYBD 2XZDB 3GSDA 1FKPB 2MSSA 3KJVA 4ECRA 1WOPA 3OL6A 1OY8A 4NZ7A 5A8WB 3M8SA 3GV7B 3BR8A 2YQ1A 4ZS6A 4WPAA 5CA5A 4RUBA 5KG3A 4NXMJ 4B3RF 1RT6B 1WDDA 2GQ2A 2OSRA 3A3OB 3EICA 1YZ7A 2K3KA 3BN7A 3M32A 4CLWA 5L39A 2OTLS 2FJBB 4BDPA 4FYVB 3LPYA 3WDOA 4IDKA 4KT0C 3IBFB 3ZZYA 3AT1B 1SV5B 4JI1J 2VA2A 1PG5B 4FBUA 1E6VA 5KFUA 4H4KA 1RABB 3CT9A 5KFIA 1RAJA 2VC1A 2EFOA 3LPEA 5AXLA 3W2VB 3T1YF 3PJWA 2NZ4A 3HJFA 1S6OA 3DXSX 2VD3A 3KUGA 4KH0B 1JLEB 2Z4PA 2Q3PA 1U49A 1IKWB 5HVHA 3DNCA 1B0PA 5E3RA 2WTFA 1FRLA 2H4WB 2BKNA 3TAQA 2R3VA 3H0PA 3UDVA 1U6FA 1FXLA 2DB1A 1U0HA 4DPWA 4CLZA 4DU8A 3W1YC 3HHNB 4CH7A 2NXCA 1IBCB 1N6QB 2KN4A 2QV6A 1KS2A 2P5VA 1ICEB 3CWJA 2Z8QA 1WNEA 1LFWA 1VQSA 1VBXA 1KWMA 1FTRA 3GYXB 2IRUA 2I1RA 2E7VA 2K3IA 5DZ6A 1WEXA 4DOZA 2XSJA 5E2QA 1KQKA 1VISA 1E6VB 3N9UC 3UVJB 1CJKA 2VG6B 2UUAF 4MFBB 2IVFB 3IC1A 1W2BR 4LRBA 2PC6A 3PFOA 2VFUA 2QA4S 4PYDA 3DRRB 1FJGF 4X2BA 4EBDA 4P7VA 1REVB 1RISA 1S48A 1SQFA 2QTWA 2VA3A 2CQ1A 1JJ4A 4GMKA 1FRIA 2KH9A 2ZH4A 4ED4A 4ECQA 5LXYA 2BRLA 3NGRA 2GJFA 2CA9A 3EJMA 5A76A 4I2PA 2KO1A 1BY9A 1TL3A 2BXJA 2IFXA 2ZWPA 3MEDB 4U7CA 3QO9B 5A8RB 3U1MA 1X9SA 1MN7A 4KQZA 4M5HA 3UWTA 2MZSA 4NI2B 3T6BA 1KQFB 4F4YA 1B7FA 3Q0AA 3PW4A 2ZZMA 3L9ZA 4WP9A 1SJFA 1CPZA 4IQMA 2DNOA 2KXHA 5ADZA 5A2QY 2DRAA 2PDAA 3RB0A 2YQ3A 3EVOA 3OTEA 2R8GA 1FTCA 2LKZA 2C3UA 3CGIA 4WIIA 2FVSA 5LM7E 2W24A 2HHPA 1L5UA 3LTOA 3MAAA 2W8LA 4M8LA 2H1YA 1RCXB 3EXCX 3KYLA 1OSCA 4IG0B 4ZK7M 2HGNA 2VBWA 3AJ2A 2P2CB 2WBRA 2B0GA 2LXFA 2D3ZA 4YR3A 5EDWA 1WC5A 3TVZA 4Q5VA 2Y3YA 4MAKA 2EK6A 4X4TA 2AHOB 5J1EB 2PMHA 3CJTA 4RW6A 3SFUA 3GIKA 4WU2A 5IM0B 4DFJA 4WZMA 2WVCA 1L3TA 3PO4A 1WTFA 5C24A 1UFWA 3DHXA 3TUIC 3QQCD 3U7JA 4RUCA 1Z2LA 4ATNA 3HVWA 2R7SA 1K1QA 1Y5NB 2Q6BA 4GC7A 3M9MB 1X5TA 1S9GA 2HPUA 2RQ4A 2POKA 3A8IA 4PKDB 2UUBJ 2WSFC 3R2DJ 4J9QA 1R8HA 4A8YA 4WFYA 2CJYB 5J2NA 1U4BA 1IBKF 3QGIA 3G6ES 2K1RA 2J8AA 4KKOA 4WFAQ 1M5HA 1SQEA 2JVOA 1Z2ZA 3O5TB 5IWAF 4ZVUB 3M2RA 2CPJA 2DD8S 2H4YB 4DV7J 4AUKA 2ZE2A 1C1CA 4ECWA 1JX4A 1TKXB 4DSEA 2HS3A 1N52B 2DNPA 5EHHA 4U8YA 2F1FA 4GO5X 2KFZA 4Q44A 2K2PA 1CQMA 2XMJA 1SC6A 1ZAWA 4DCJB 3VGVA 3UR3C 1N33J 5CH7B 2DHGA 4ANEA 2WZ1A 1DY3A 5ETPA 1LWEA 1RWUA 2I5JA 4ES1A 4IRKA 3RR8A 3Q24A 4F0MA 4DWIA 2XNRA 2GA7A 3CSKA 3KUEA 1UL3A 2KT2A 1LW2A 2AJ4A 2E1RA 4LF1A 2UU9J 1Q4RA 1TVRA 2V67A 1HBOA 4OYBA 4X62J 2QE5A 3H5XA 2HZVA 3CJ0A 2VV5A 5J2NB 1NDCA 3NGTA 2RF2A 1AROP 1ZPWX 2X1GA 4DPUA 3MPVA 1YJ7A 4ECVA 2UU9F 3R2CJ 3IBCB 3AJ1A 3M8QB 5DG9A 2KDOA 4PQUB 4OIXA 1UVJA 3LP2A 2M52A 2F4VF 3OQ2A 4IKAA 4ZVFA 3LP0A 3M8PA 2G1DA 1GEHA 4NYPA 3WIUA 5A6PA 1XQIA 4DQIA 5B0EA 1RHUB 3KLGB 2FPHX 3R3TA 2PI4A 2HVDA 1LWEB 2P9EA 4CYUA 2PFFB 4ES3A 2WSEC 4R5PA 3MOZA 1DJ0A 2B8PA 3G8QA 1RWNB 2RDDA 4PCQA 4G6VB 3G96A 3UCZP 2PMZD 2HEKA 2DEIA 2KHCA 2P9GA 3QYYA 5ETSA 4F25A 1AFJA 1K0TA 1HQUB 2YY3A 1RZMA 1YJTA 2YKQA 3TUZC 3V4IB 1Y3JA 1IBKJ 2CRLA 4C9DA 3BBCA 3G2XA 2DIVA 2EWHA 3UDEA 2AZ3A 2BABA 3QLHA 4G1IA 2HQIA 4ZPTR 2OMOA 5D4OA 5BJRA 2YNHB 5DLFA 2QC3A 3NGDA 1C1BA 5L38A 1HNZJ 2H5JB 4ED5A 1RXOB 3N01A 3RAMA 3J81j 1MN9A 5AJ3J 1HPZA 2VUGA 1X4DA 3R6LB 3UO0A 4DJBA 1UW9A 2BJDA 3OBIA 3PJXA 4IH7A 3DLLQ 1RT3A 4ZHRB 1RYRA 3ZZZA 8AT1B 5EWFA 1TTHB 3F56A 1ZAXA 1KC8T 2W2PP 5KOWA 2LA6A 3MMAA 2P6TA 3I0SB 2B6AA 4AE5A 1D1UA 2PMWA 1CS4B 4ED2A 3RGIA 3CC4S 1ZH5A 1PAUB 2CZ9A 3PYEA 4N8NA 2MGZA 3HULA 4GKKF 4F67A 2G0CA 4IFYA 4FF1A 2VIHA 2GGPA 2XG8A 4ZP9A 1T02A 2HFZA 3V5RA 1QSLA 4PYAA 3RYLA 1JB0C 1RWOB 4BC9A 4MK7A 1AUDA 1C0UA 2L9WA 3GR0A 2MQOA 1B3TA 1RTHA 4RW4B 4ZLNA 3HO1A 1FDAA 5LMNF 1JJ2R 4JYAF 2FHMA 3M32B 4M63A 3KUHA 3TJ8A 2BX6A 2V2ZA 4WE1B 1CJUB 1X9MA 1Q82T 1C0UB 1Q16B 3JQMA 1ZPVA 1R0CB 4ENOA 1Q0NA 2YNFA 3CNQP 1NSQA 1FKOB 4OQJA 4C7QA 2XQCA 1EIYB 4H4MB 1DLOA 1PJ7A 1NUEA 5DETA 2EXUA 3DCAA 4C8OA 1RTDB 3RRHA 3H59A 2W9CB 1RT2B 3FMBA 1VQPS 5D4PA 1WKJA 3GZ7A 4WIQA 3IGVA 4GKJF 2ALYB 2VU5A 1WACA 2PFDA 4BC7A 1A6LA 4WU3A 5KFWA 4ICLB 1UVMA 1Q8KA 4DQSA 3NNCA 3IM9A 2E5IA 3BZQA 3HSDA 5E3CA 4X4PA 4CTAA 1LFPA 4FKXA 1RACB 3QWPA 1MU2B 1M1KT 2MY8A 3SXLA 1KNZA 3BKTA 1GK8A 2QL9B 1WKKA 5IT9U 5J2PA 2NYIA 5MAOA 1P9YA 1S1UB 2C2ZB 2OFHX 5C2GA 4UZBA 3FCHA 3JQKA 1ZBTA 2IRYA 1S9EA 2ZJQQ 2VHGA 3SI8A 4OHXA 4PRFA 2R8JA 3NMRA 1FFSB 1RADB 1GAOA 2HAIA 2W7AA 2QO3A 4OFZA 1TAQA 2DO4A 4B3MF 4FN5A 2OEJA 3EDQB 5F3TA 4KPYA 1WSRA 4NZ6A 4Y2MA 2FDNA 3RBXA 3HMJG 2CJ9A 1KLMA 1KP6A 4FP9A 4J9SA 2XM3A 4ICLA 5KFCA 4DBQA 4QOTA 1KHWA 1DQAA 4ZJOA 1RTJA 1U8SA 2CPEA 2ZJRQ 1JLEA 3A8KA 2FJDB 2OPPB 1HNIB 1CEZA 3EPGA 4R0JA 1HQEB 3LAMA 3CJKB 2XCPA 4CLKA 3C6TB 3TQ1A 1B64A 1CJTA 1ZETA 1MMLA 2ZM6F 2JDJA 1I5OB 4L72B 4HTIA 1X0PA 4O3NA 1N36J 1RT4A 2QIFA 3NEKA 1ROFA 1LOUA 4IOCQ 1D9AA 1N36F 2R9LA 1FI4A 1ZOTA 2EW9A 4P75A 5LSLA 1HYSA 2ZM6J 2V68A 3I87A 4DZDA 1WD6A 5FIIA 4I6WA 3OLBA 2F8MA 3OTOJ 3JSMB 4C8LA 5AXKA 3TEGA 1OSDA 2QRRA 3DYAA 4B08A 4K4WA 1UVLA 2B3TB 2WBMA 4KRWA 5J2QA 4MIBA 4B3SJ 2ZBQA 1NRKA 3M9OB 2CJQA 4A8KA 2DRBA 2JZ5A 2DTJA 2IAJB 2XWYA 4PABA 5B0FA 3MAQA 3M05A 4DV1F 5AJ3F 5KFVA 3QRPA 4C8KA 3FCVA 1UAWA 3GYGA 1WC1A 2EPIA 2M4MA 2IIHA 2BQUA 1RHRB 3AAWB 2V2VA 2R2SA 1H2UX 3R7BB 4J90A 4FVCA 1V6HA 1SKWA 1YBAA 4B3OB 4JB8B 3C15A 1JLGA 3H2UB 1P1TA 3VZIA 1QAYA 2CQ2A 3AOBA 1IN0A 2M70A 3EUNA 3EXYA 3T1HJ 4JV5J 1VRUB 2HNZA 2JLFA 1Q81T 1B0TA 2M8HA 3MAAB 1AA1B 3CD6S 3NGSA 4LMZA 1FJGJ 2E1MC 2GQCA 4X4SA 2FJVA 2YWFA 1X8DA 2MJNA 4ZPDA 1VHIA 1D9DA 3GFHA 1S1TA 3NY0A 1NK4A 2UUAJ 3UPFA 5GAEI 2WAQD 3FQLA 4L3NA 5L1IA 1VC5A 2VZ9A 3C14B 5CYMB 4XO0A 3V81A 4ZOSA 1HFEL 2R4FA 3FMWA 3NAIA 2RKIA 4KYZA 1TKXA 4RZRA 2LVWA 2XNQA 4ZVHA 2WCXA 2F5GA 1B4SA 4OI0A 3HHLC 3P4UB 4F3MA 1SIWB 4NLSA 1N0UA 4C0HA 4YMEA 3RTVA 3RBEA 4NA1A 2W9BA 2ASLA 2E5HA 2XYPB 3PHTA 2F65A 2A6MA 3LP2B 4M95A 2BJ1A 1F1BB 1CJVB 1PO6A 1D09B 1UVIA 1WF1A 4RBVA 3GFZA 4NYOA 1M90T 4WCEQ 4KV8A 1XJWB 1H6KX 1VI7A 3ZO7A 2RB7A 4U8VA 2RE1A 5F0WA 1K9MT 1IJFB 4P72A 2CKWA 5D0GA 3VQTA 2KT3A 4DI6A 2KZZA 1G4CA 2QMXA 5K20B 1LW0B 4WYWA 4KJIA 2CJBA 2DNZA 4OI4A 4OLOA 1WF2A 3A3PB 1N88A 2AU0A 3TA0A 3JXOA 4USWA 3U1LA 2DGXA 3D6HB 3P96A 3U02A 1NK5A 4FF4A 2HBQB 2AGOA 3V4IA 3QGHA 3U27A 5K5MA 1NKBA 3GIMA 4XDCA 2PE8A 2K1RB 4HACB 4ZCLA 1MMDA 3W5XA 3ZNJ1 2E5GA 3I5BA 3O1LA 3JAMU 5ETRA 4X66F 2PGCA 2MLYA 2EBEA 1RAEB 2X7IA 2E5JA 2CG8A 5KFNA 3ELHA 2HGMA 1Y3KA 4K4ZA 3EM1A 2ZHAA 1EKSA 3EVMA 2IM3A 4DV4J 2HS0A 4U96A 4E98A 1RT3B 1GTHA 2DJWA 3T5HA 2XB2D 3CCTA 2P8IA 1NM2A 1NLKL 3FKBA 4MYTA 5EX3A 2RJZA 3RG6A 4AFFA 3KMQA 4RL1A 1XTZA 2MXYA 1VYAA 3UDCA 4DPYA 1KD1T 3JTPA 3R27A 4KE5A 2JC1A 3GMGA 4U6PA 4YDDB 2Z30B 3KG4A 4GRSA 3KG1A 1YJUA 2ZOGA 4OX8A 3SSQA 4DR2F 4ILMA 1LWCB 5L46A 3CJQA 3JTNA 5DO2A 4RNNA 2QMWA 3FUYA 4RWXA 2HGLA 5HK4A 1VHFA 3ZZPA 4A4JA 2C2RA 4HACA 2OI2A 4QYRA 4LRDA 3D67A 4NL5A 1WC0A 1NDLA 2A10A 3FSXA 1MLAA 3AHPA 1HBNB 1PJ5A 2ZDOA 3O44A 4I2QA 2ZNZA 4QIFA 2FJAB 5F8HA 2B4VA 4OYIA 2XS2A 2EG1A 2GVZB 3HX9A 1PYSB 2ZITA 2M9KA 3DOLA 1T94A 2W1BA 2BKPA 2ASJA 2RVJA 4OZLA 4YFUA 1RDRA 5E0OA 4N41A 1CULA 4MTPA 2B7CB 1JLQB 2MZTA 3BO4A 2J0XA 3PEJA 4TY8A 1O6XA 4DPOA 2DY1A 2YWWA 2Z57B 1MROA 4ES2A 3J81Y 1HNVA 3C66A 5CABA 2ZH6A 1L3SA 1FFWB 2MZ1A 2BM0A 2HQCA 4M5MA 1WHVA 5CCMA 2OSQA 2PA3A 4X64F 1YRTA 4YP3A 5DQHA 5DM6Q 3M9NB 2AGPA 3GTYX 3MM9B 2UVWA 4ZP8A 4CO5A 3RR7A 4LQ3A 2DKOB 3K8VA 3PJ9A 5IZHA 2XSFA 1VQYA 2VH7A 5KG6A 1JLFA 2YKMB 2XULA 3HDSA 4QW8A 1M5KC 1N5TA 4OX9F 2BBEA 1F5BA 2DRDA 1XERA 1OY9A 2GIRA 2B7BB 4ITSA 4WFZA 5B7WA 1HLWA 4EEYA 2WW4A 3OFGA 4OZ2A 5F0UA 3C6UB 3W63A 1TUVA 2IMOA 3PDNA 1BHNA 1CBKA 1Y5IB 1YKWA 2UZAA 4LR9A 5HBMB 4DFKA 2IA0A 4RBTA 3Q8PB 5KG5A 2XHWA 2CFXA 3K5PA 2DR9A 4NCBA 1X4CA 3OTDA 2CUYA 3FZ2A 1Z1ZA 4OX6A 5HANA 5HQMA 1Y5LB 4KO0B 4Q43A 3QT6A 3IAM9 3NS6A 4B9VA 3GJSB 3PG9A 4F2RA 4HLBA 4DL5A 1FA0A 2DHHA 3NRBA 2OPQB 2HBRB 2VPWB 4X84A 3CF5Q 3R1LA 1PC4A 3DDKA 2FHKA 4HH0A 1RT1B 2XSJB 4TYBA 3S1TA 3HXMA 1BLUA 2N82B 3G6VA 1T03A 2IYGA 1TZ0A 3MM9A 4QWEA 2ZUGA 4FXWA 4K4XA 4IO9Q 1BXNA 5AE3A 3HSZA 2F4FA 4BWMA 2CDRB 3E01B 5K8OA 1O0PA 3N5BA 4QYZJ 2AV5A 3PEHA 2DYAA 1SJ4P 4HDHA 1RTJB 2ZBRA 2GMLA 4WXOA 1UCNA 1PYOB 2E44A 2A18A 4Z37A 3NKYA 4ED8A 1KFDA 4EZ6A 3ISNC 1VRTB 2R7TA 1ZTWA 2SXLA 2NQPA 4JV0A 4YR0A 3GONA 4QWDA 2HIYA 2ACYA 4LSNB 2A0FB 5LXRA 1LXJA 1HNWF 4DUYF 4ELVA 9RUBA 1HI1A 2UXCF 5BYQA 1HD1A 3MXHP 1NHUA 3CCWA 4HHJA 4ZN3A 1VQLS 5ETTA 2Y0BB 2J9EA 3DOMA 2B43A 1UEVA 5C25B 3BGRA 5BYSA 2FY1A 5HATA 1KLMB 1HYSB 3TA2A 4JI2F 4X4OA 1H2VZ 1RA7A 1Q79A 3OXLA 2HLUA 4PUOA 2AEJA 2RRNA 3ILIA 2E5LF 1FJ7A 4FVMA 3K89A 1T9UA 2RUSA 5K14A 2OPSB 2ZNYA 2L41A 2J6SA 3JS9A 2V50A 4H4OA 1ZAVA 4DR5F 4DR6J 3L3CA 2M5YA 1WELA 4B9MA 1V3ZA 1JWWA 2CQ0A 3KHGA 1RK8A 3DM2A 4YN3B 2VONA 3ZZ0A 1N5YA 4HR2A 2YNGA 1RTIB 3PY8A 4JI0J 2HHUA 3HVRA 1NCLA 1SJ1A 2YBVA 2H54B 3QT7A 3OFFA 1A9NB 2W4PA 2YKAA 1RAHB 4DG1A 4RUHA 3R1HA 1YI2S 2OTJS 1IR1A 1KR4A 1MWZA 1VCTA 2IBOA 1J2VA 3QFHA 3WIVA 4L3KA 2JVRA 6AT1B 1RKIA 2NXJA 2GCFA 3M6WA 4IUFA 2IYIA 4Z2XA 1FHTA 1NBEB 2W2QP 2KG0A 4PXDA 1TL4A 3J7ZT 4RUAA 3IRWP 2O5DA 1AYEA 4WBFA 1F2HA 5GADI 1T8EA 2R8HA 1GQEA 1WI8A 1IQTA 2I8EA 3FFIB 1FWLA 1S79A 2UP1A 5K8MA 1GXLA 1RBLA 3ENWA 4MYUA 4DU7A 3GQCA 3VVTA 4J9NA 1VQKS 3OV7A 4MMOA 2OPSA 5K14B 2E7WA 4Y2IA 2C1EB 1MNEA 5CHCB 4B9SA 3HHKA 1PBAA 2EFPA 2VPXB 3G82A 4ZVGA 1YGYA 1S1XA 2HZAA 1J5OB 2O01C 4G1QA 5KT2A 2KG1A 1EKRA 3D6TB 3VGSA 5B0DA 2HHHF 3CMES 2MQLA 4DLEA 2B9YA 1KTQA 2OELA 2AWZA 2XMVA 3SCIE 1W25A 1K47A 3MI7X 2C3PA 1B7YB 4WTOB 3PKYA 1NHVA 1S1VB 5THWA 1FK9A 3IRXA 1LQ9A 3DRSB 2X1AA 3IG1A 3M4XA 1TK8A 2X3DA 4ZLLA 5ETLA 1UZHA 2UUTA 1HR0F 3J7YU 2VFVA 3RRKA 3VALA 1HWKA 4ERDA 2MKHA 4HDGA 2RUGA 3P49B 2NCKL 3LGNA 4YB1P 3HP6A 1LWXA 3MCNA 1VC0A 1UEUA 2DNLA 3CDEA 4DXLA 1LWFA 4UT4A 3HT3A 2CQ3A 4NLXA 2RSQA 2V8GA 4DF8A 4L75A 2FTRA 4L74A 3I32A 4CP5A 2KJVA 3DOKB 2W7PA 1SL1A 2XO7A 2DGWA 1UJ6A 2YNIA 3BREA 2ZD1B 3DGPB 3N5FA 2W2NP 1YRUA 3IGNA 4P74A 4WXWA 5HSPA 4PG4A 5E33A 4F0HA 4ZCKA 1FESA 5L9XA 4K4SA 4G1QB 1RWKB 2YKPA 3UCGA 1BQXA 2RF2B 4PXEA 1KDNA 2J9CA 3VAMA 2BR0A 1TQLA 2WONB 2B8QA 3L09A 3M30B 5E3AA 2EFQA 3LQVA 3T19A 2HHXA 3C46A 1S6PB 5EUHA 2DGTA 3D0GE 2W9AA 4NCGB 2VODA 3MF5A 2UVRA 3CUNA 3Q8QB 4NXMF 2GFFA 4CH1A 4B3RJ 1ZM3A 2CZ4A 2YKNA 3CTRA 4Y2KA 1RAIB 1U26A 1NZAA 3D68A 3ISZA 1TL7A 1IBLF 5D77A 3AD7C 3MD3A 4I64A 3VR1A 4W90B 2O67A 2JH3A 4USTA 3PV8A 1TVRB 2FZCB 5HMWA 3KLIA 1ZYQA 1BQNB 1RA6A 4ED6A 3A12A 3T41A 1VS3A 3G9CA 3ENAA 1JK9B 1MMNA 3KLVA 3QT8A 3DGVA 2F63A 3CC7S 2YVSA 5DS7A 1RHKB 2LFVA 4O3QA 4S0MA 1KVKA 5GMDA 1R0BG 1WTBA 1U8WA 4EK2A 2GIQA 2B5JA 2ZDPA 3QGGA 3CO9A 4JV1A 1JLBA 2RILA 3GSIA 2Q1LA 3QLHB 3OTCA 2YX4A 3C16B 3E8OA 1RHQB 3DLGB 4OZ5A 4F7VA 4DR7F 3EWGA 2W9BB 1XR5A 3CJSA 3W64A 1V3RA 3KLGA 2XY7A 2H5IB 2BQRA 3I5CA 3OUYB 1NJZA 3KNAA 1GTEA 1L3KA 3CVKA 2G9OA 4ZLJA 1DAXA 2OIHA 1BWEA 1DBDA 2E1PA 4I7FA 1XMOF 4JI3F 5T14A 4LF4F 3BKFA 3MM7B 4P2SA 3B8HA 4OX7A 2WVBA 1NK6A 2FHOB 4QWCA 3PW5A 3J7YI 3SFGA 2VFRA 5J1PA 5KFJA 3OJSA 1VK3A 2C2DA 1Q7YT 2FY8A 1R31A 3H90A 1SPBP 5AE2A 4N56A 1LW0A 4DL3A 2DH7A 2GVDA 3VGTA 3IWXA 1HKAA 2DXDA 4CO2A 1HMVA 1ZTTA 3K57A 4DV6F 1U02A 3OR1B 1RUSA 1TR0A 1WOOA 1TK5A 4F8RA 2B5JB 3MTKA 4RX6A 2FVRA 3K5NA 1B70B 2DGOA 3GLJA 3MTJA 2BJ9A 1X4GA 2AYGA 4J9UE 2C2KB 4LVNP 3P6YC 4TY8B 2CNLB 2MKYA 3LWMA 2HHWA 2A6OA 2O66A 3ZFVA 4ZDNA 1R8CA 1FF2A 3D1QA 3NGKA 5HP1B 1TMJA 5D4LA 5GADU 3WBZA 1SH0A 2HHVA 2DNKA 2HFVA 2CXEA 2NS1B 2QLXA 2YH1A 4OL8A 2H51B 3MDFA 2JEIA 2ZH3A 1E6YB 3D0HE 1S57A 3ZXWA 3W9IA 1G2EA 1IWGA 4ZJLA 3KK3B 2ZVSA 4DX7A 2LU1A 1KVJA 3H4BA 3DI6A 2Q6CA 5KFFA 4TYAA 4CLTA 1RU1A 2KZMA 4TKTA 1UTAA 1SC3B 2YPZA 2APOA 5LSOA 2CZVC 5JMNA 3R9LA 2JC0A 2BUNA 2V5HG 3I31A 3O8WA 3Q8YA 1T05A 4JI7F 4K0KJ 4EBCA 4QPXA 3HPOA 4NZ0A 1F2GA 1KSPA 2ZOMA 4X4RA 2VB6A 1QTNB 4KH1B 4PPZA 2IRXA 3OL9A 2OKQA 1DLOB 4IFYB 4CLLA 2EKYA 3POTB 1N4LA 4B9UA 3BBBA 4C6AA 3SV3A 1JLAB 1KLNA 3PW0A 3MECB 1X31C 4P71A 1S1UA 3SDEA 1EAYC 2RAQA 2QA1A 4RW7B 4BLGA 1YWXA 4IDKB 3CPWR 5D4NA 3RRGA 2WB1D 3AJDA 1U09A 4DUTA 4M5LA 4JI8J 4NRTA 4K5RA 5L9NA 2DGSA 3PACA 2ZBIA 2AF6A 3FRYA 1S72S 3KK3A 3LP1A 3R97A 3NCRA 4ELUA 2JX2A 3GCXP 4WP8A 3KK1A 5GMKa 3HZEA 1N33F 2G2ZA 4H4MA 4A8XA 4DV3F 1H7XA 2MEWA 3EZUA 4EU0A 2YTCA 3I56S 2ZKTA 2KXFA 4QW9A 1TU0B 5JJBA 4CDIA 1SH3A 2XO6A 2Q43A 4DDFA 1D3WA 4K4TA 2QL7B 3OD2A 1N5VA 5F8MA 1Y0HA 3L7OA 4ZPCA 4E0DA 1FD2A 3R5BA 1RBOB 4IOBA 3G4SS 1JMTA 4Q45A 3AB4B 1P1LA 2DPIA 2JSXA 5I3QA 3CCQS 1KTVA 4Q2LA 4P7TA 3G6YA 2CPZA 3EZOA 1XMBA 1Q7LB 2VDHA 4WFNQ 2RHQB 3MM5A 1F6TA 1RT6A 3TJ9A 5F8GA 4DL7A 3KTQA 4JI4J 3EGZA 1V5VA 1FO1A 3FNNA 4OYXA 3DRXA 4CO3A 2ZJPQ 1N54B 2BJ3A 3KKFA 3QAUA 2BOPA 1VFJA 4LSZB 3DRRA 1EB0A 3BQ0A 2AMCB 2WOMA 4KR0B 2CQHA 4AT1B 2CPIA 2M0GB 1HQEA 4NXNF 2J6UA 2IDEA 2D9OA 2XZTB 3G82B 2ZC4A 4DG1B 3E01A 4RLEA 3PW7A 3I0RB 3I9ZA 1W2IA 3PCOB 3IO1A 2QZ8A 2J9DE 3TX8A 1X0FA 3C3LA 1QLNA 5KG1A 2FC8A 4X65F 3N4WA 1YJNS 1IR0A 3GE9A 3QO9A 5A8RA 3RUBL 4CT9A 3CULA 4K0KF 4JI7J 3S6EA 4F2SA 3UR0A 1U7LA 2DR8A 1RCOB 2HBZB 2M88A 3HCXA 2XMMA 3GV8B 1T0TV 3K5OA 3MOJB 2IA6A 2RQMA 4KHMA 4FXDA 3QRQA 1GT8A 3CJKA 1K8AT 2NZCA 5JXSA 1R27B 5CQGA 3W7BA 4CLPA 4QCLA 1WG5A 3KLEB 4X65J 4EGLA 1JKHA 1KONA 1YX2A 3B4DA 4ER8A 3Q2TC 2HWTA 4OZNA 3A8EA 3CD7A 3TA1A 4RNFA 3MGJA 4TLRA 1U1MA 5BXIA 3WC2A 5IFMA 1H72C 1U1PA 1U48A 1Q8BA 1T9XA 3BYPA 3GFYA 1GMWA 4BS2A 3EYZA 1H74A 4A47A 2JRSA 3OXGA 4USVA 1RTIA 2GAHC 3WC0A 2E66A 2NSBA 3QATA 2VQFF 3PVXA 4X64J 1XBWA 3TARA 1NH7A 3AQPA 2I0XA 3AXKA 4M5JA 4PXBA 3JB9k 3T5JA 1S10A 1KHVA 4J7CA 5GAHU 4NCGA 1N32F 3Q22A 2W2OP 1CJVA 3NAHA 2JLGA 1GH8A 2A2DA 3CCUS 3RB6A 2B9WA 3PIOQ 2MSTA 4CWBA 4TQRA 2OO4A 2E9ZA 3MEDA 4LREA 3EZ5A 4U7UD 1R89A 3NG8A 2V8DA 2K8GA 4KAIA 3KLIB 4XPEA 4OJ1A 3PIPQ 3TZZA 5CYJA 3OW2R 5G0RA 1RP5A 2V9KA 2EK1A 5FLXU 2WVFA 2EFVA 2R2UA 4DQRA 3M2UB 3LO3A 2H9ZA 1WOSA 3ILJA 1CLFA 1RAGB 1ACMB 1S97A 1TUWA 1X7VA 3CJ4A 3ZZRA 2XC9A 5C24B 4DR2J 3TQEA 2LP4A 4NRUA 1HHTP 4Y65A 2GJIA 2PEBA 3BSNA 1WHYA 1M1GA 3CB4A 3G6XA 4LFAF 1QAXA 2QA4G 4RU2A 2FGCA 4PQUA 1S1VA 2B51A 4IH6A 4MIWA 3GJTB 1SH2A 4J91A 4Y2AA 4FKYA 3K5MA 4I6YA 2ZH1A 4CCHA 5A2QU 1LNQA 5E5NA 3DLHA 1GX6A 2F40A 5HROA 1DRZA 1NAQA 3CCVS 1R0AA 3Q8SB 1UP1A 4TNOA 4KHPJ 1FRKA 3TRGA 2C2MB 1F9HA 2ALZA 4C48A 2MPUA 1AZSA 2GVDB 3C16A 1IBLJ 2HYIB 4M5KA 1OYEA 2QL5B 3AFGA 3V4MA 2AX1A 5ETOA 3VZHA 4A8WA 1C0TB 2N7YA 4WP3A 1RTZA 2AKWB 1AUSL 2I5JB 5KAKA 4A8SA 4N7TA 3CDBA 5DDPC 5ETVA 2HFUA 3HJVA 3PR5B 3K58A 2FQQB 2M3DA 3HHLB 2P9CA 2WONA 2L48A 4DV5J 2ZVIA 3UW1A 1N5QA 3CCLS 3D9BA 1LW2B 3H40A 2M8DB 3MMCA 1H38A 4RW8B 2VOOA 3RJMB 3I4HX 3CXCR 4NA3A 4YB7A 5T7LB 2JFKA 1WEZA 3DOLB 4IH5A 2K7KA 3PM9A 2DR7A 1S12A 5KG0A 1G3OA 1QDUB 3BGLA 2BQ3A 1XNQF 1M5SA 3PYDA 7FD1A 5L1LA 4OYMA 3AY0A 3D5MA 3NMAA 2XMUA 2MKIA 3CIZA 3CCSS 2MB0B 1YLXA 4TLQA 3DRPB 3GILA 4WZQA 2M7SA 1S49A 1N0VC 1P6TA 3ISND 4EFAC 3Q2SC 5AT1B 1S9FA 2B6AB 2QYGA 4USJC 1NPKA 3BV8A 5IT0A 4IQXA 3NOGA 4NLWA 1YK9A 1GMVA 3NWRA 5KFTA 1F0XA 3UFCX 5IQQA 2OEKA 1HI8A 3I55S 2VQEJ 2CIMA 3CCES 5LMUJ 2R42A 3GWCA 2MZRA 1S7HA 3CCJS 4FXVA 1HBMB 2X1BA 4TN2A 1S0NA 5B0GA 2CQBA 5A0YB 3EX7B 1GFWB 4FPIA 4HHUA 4R5PB 5CD4H 3Q8RB 4KGKA 1AT1B 1F9FA 1S6QB 1UZDA 2NSCA 3SSSA 5CAAA 3VAHA 3BO2A 3M8QA 2ZKUA 4NLTA 2BANA 4I4BA 2C2OB 4DPXA 2ZEJA 1E6YA 1H0HB 3OR1A 3ZZTA 4QYZK 3C6UA 2NUUG 1SIZA 4QWAA 3BSCA 3RAQA 2ASYA 1RYSA 2CPDA 4KTQA 3M8PB 1HHSA 5J2QB 2IY5B 3MR5A 5SUHA 4DR1J 1UWBB 3DI6B 4UOHA 1P27B 1RT7B 4KBIA 5L1KA 2GO9A 1XMOJ 3SQOP 1RB0A 5D0RA 3SCKE 4I0WA 5HVGA 1AW0A 4N8OA 1IQZA 2DNQA 2WVDA 3ZTRA 4K8RA 1XN9A 2QSWA 3NBPA 4EO8A 1EX8A 2R2TA 5SZTA 2ZHBA 1VQ7S 2OPRA 2W01A 3FEXB 5B0AA 1RT1A 2KU7A 3WX4A 5HI7A 3J80Y 2U2FA 4NLVA 1T03B 1HQUA 3H2VE 2RS2A 1F9EB 5D78A 1CC8A 1FT8A 2XS5A 1VQOS 3IP0A 3QJJA 3I0SA 1YJRA 2BRKA 2H5EA 2VG5B 3CIMA 2VG7A 3L7UA 4NMLA 3TO8A 1V5IB 1S1WB 2OD6A 4B3SF 4CTAB 3V2UC 2OHDA 4I67A 2VASA 4G65A 3EDRB 4MIAA 1HBUA 3GCWP 2XMKA 1VIOA 4NLPA 3T3FA 1FJEB 2VG5A 2DISA 1VIXA 1SC1B 2V8PA 3WQPA 3BO3A 2YWGA 2KFNA 2CWXA 2MKSA 4NLGA 4NPOA 3UNGC 4ED1A 1U1QA 3VV2B 1TUGB 2PI5A 1FKAF 4DUZF 3D1OA 1F3VA 3IMQJ 1FEEA 5KT7A 5GAGU 4ILRA 3THTA 3K5LA 5GAGI 3BJYA 4RW7A 4DFMA 4KFBB 5F9LA 1X4HA 1FXDA 4LF7F 3PTWA 3PX0A 1FKOA 2CQDA 2A3JA 2GS8A 5HJYA 3FSIA 4CI0B 1QJHA 3K8WA 3QPIA 4PPDA 2EBGA 4LSNA 5CD4A 2ATLA 4P52A 6FD1A 2W9CA 2PD1A 1FDDA 4ZN1A 2E29A 3KK1B 3TI0A 2QYCA 1Q53A 3MMJA 3MUTP 1R6VA 3ONQA 5E41A 1QAJA 5HJXA 2J7UA 1RAFB 2YX7A 1C4CA 3GJQB 5KOXA 5KFQA 3SDEB 2N4DA 2YQ0A 1U1KA 4P6QA 2UV8A 1OPZA 2YPYA 1WSVA 2XMWA 3ITHA 2UUWA 3VCDA 3JAMY 3MHYA 1DQ8A 4HH1A 2VG6A 3QRRA 4H4OB 4X4QA 5LL6d 2OLWA 3AOAA 4JI6J 4NI2A 3ILLA 3D66A 2HQGA 3FCWA 1QTMA 4K7QA 2F3JA 2N3OA 2J0SD 3DC2A 2JJ4D 2AYBA 4EUVA 1N5YB 3SBMA 2OPPA 2HNYA 2ZBPA 4N77A 1N34J 5HN0A 2DNMA 5CYQB 3GIJA 2IAJA 1JJCB 1BWVA 4UY8T 1AB8A 1SUQA 1V3SA 1XWLA 3UD3P 2GHWA 2FLLA 3TOQA 4JV5F 4OX9J 2HNYB 2ATCB 1TL3B 4FNIA 1CJKB 1GXTA 2H48B 3MM8B 4OI2A 3W5ZA 4USMA 3NLCA 3R5CA 5DGBA 1SCJB 2OAUA 4CNZA 3FBEA 3FK4A 4GVBB 5KFRA 2IBKA 4ZJQA 3IFEA 1TKZA 4LIWA 5KFOA 2B9XA 2PN6A 2KYXA 2QN6B 1RKJA 4I56A 1VRUA 4MKVA 4DX8H 4AL7A 1X4EA 5D0EA 3RZAA 3NOCA 5KT3A 4X4VA 2JOQA 3HKZD 5C42A 4ECXA 3NNAA 1X4FA 2G13A 4MT1A 3PW2A 3H20A 2LA4A 5B09A 4JUZA 3L7PA 3TZWA 4O3SA 3MPDA 2GMHA 4JI0F 2OH2A 4PUOB 4J5OA 4A8QA 2CADA 1X5SA 3UVJA 1XMQF 5IT9Y 4ECZA 2HRTA 5IS2A 2H3EB 1YDLA 1UJ5A 1SKSA 2BKOA 5IOLA 2VPZB 1JKHB 3MZIA 2HHHJ 5IC4B 2XBPA 4QPTA 4USKA 1S0OA 4KGVB 1ELOA 3M8RA 5H9EJ 1NHKL 3CO0P 1VBYA 1NSAA 3NS5A 2L3MA 4U9RA 3D3BJ 3QBCA 4O23A 2E1CA 2I9SA 5EGYA 4JI2J 3OTBA 3EGNA 1WWHA 2FLPA 5G0RB 3R7NB 4ZIWA 4RNOA 3GG1A 5FDLB 4D3HA 2ZZNA 2B4OA 4IG3B 4NYZA 4XDDA 4Y28C 1Y00A 2X1FA 1SXLA 3BH7B 2ASDA 4DUYJ 2UXCJ 4ZVRB 4DL0C 2NR0A 3JSMA 2V9WA 2ADBA 1PKUA 2HWHA 1BMQB 3CW2C 4J9MA 3DHWC 1CC7A 4LBIA 1Q1KA 4ZIVA 3MR2A 5HAOA 4EBEA 1GNKA 1KBRA 1B0VA 4NLOA 1HNZF 3NNHA 3G8TA 2CNNB 4URGA 4YDXA 1ZM2A 1FCAA 1I6JA 3OSPA 3QAEA 4OYPA 1KVIA 1AXQA 1UW4A 2RU9A 3MCMA 4I68A 2V63A 3WX8A 3QT5A 1S4FA 1QVFR 4JI5J 2UUCJ 1KOOA 1F5AA 2WK4A 3OR2B 4DQQA 2HHSA 2IJNA 2RDIA 3D7SB 4B17A 5HROB 3K17A 1VGYA 3TX0A 1H7WA 1RLCL 4ZCMA 2RKIB 3C15B 3HHEA 2B4PA 1QM9A 2NXNA 5I42A 3CCRS 2MLZA 2V4JA 1MWQA 3GR1A 2PSZA 2LQ9A 4IG3A 1FXRA 4LIRA 4LF9J 2DHXA 2Y1LB 1S6PA 1WF0A 3LALA 2HS4A 4F26A 4EYIB 3V6DB 4NEYA 2RH3A 3KLFA 1U1RA 5IM0A 1VR6A 1YQHA 2J76E 3CJ8A 5KFYA 5I42B 2RRAA 1RLDA 3N28A 4KGZB 4GKJJ 1JLBB 2YKNB 2CPFA 3H4DA 1Q78A 2R8KA 3G86A 2JLEA 3SSRA 3FSYA 3IR7B 3GIIA 1WG4A 3AH6A 4BBYA 1A0OB 4RW9B 3THVA 5ETMA 5H9EK 5B0BA 5D15A 2LDYA 5A0YA 1SJQA 1Z4UA 4PR6A 2BJ8A 4FYYB 2ZOFA 4I7FB 2NXEA 5IV4A 4DX5A 1WJ9A 1NSPA 3VWSA 3PX6A 1RWXB 4ED0A 4I1TA 2W2MP 3OSNA 4IOAQ 1IBMJ 2DGUA 3PRVA 3FDSA 3LOUA 4JYAJ 2GVZA 2R7WA 3MEEA 5LMNJ 4HVZA 2E9RX 2V8VA 5KFZA 2DT9A 3X1LB 1SL0A 2IM2A 2D1CA 2RRBA 3N6NA 4ZHRA 1MG7A 3HFKA 3JYTA 2HVHA 5F8NA 3MR7A 3AA9A 4LRAA 2FZKB 1MROB 3SZ2A 3MEEB 3MMAB 2HVZA 2ZH2A 4DV7F 2K7JA 3KHRA 1D8ZA 4OLPA 4Q8FA 2CVIA 4HYKA 4RU9A 1U25A 1U2FA 4HI2A 4TVAB 3RW7A 5GVQA 4DR3J 1HI0P 2C42A 2BANB 2V2QA 4JI5F 1S4EA 3W5YA 3N6MA 3IXQA 1VQ5S 1HPZB 1N56A 5CZXA 5K8PA 5F8JA 1HIYA 1JXVA 3BB5A 3FVYA 4M5GA 5FJ4A 3PRBA 3PO5A 4P2FA 5DG7A 4YY3F 3P45B 1R3NA 3D1HA 4DX6A 1FJCA 4QIWD 1X9WA 2FZGB 4ZVOB 2KVQE 3ZTSA 2G1HA 4IR1A 2ZZTA 2G2YA 2HSEB 5B0CA 4KHRA 2BE2B 4ZVPB 4PWUA 4AXIA 3VAKA 2DHAA 3QWUA 4TU7A 5FD1A 3JYTB 2YNFB 5DDOC 4LRCA 1C1BB 2EVZA 2XHCA 4KGMA 5E3QA 4ZITA 3BS9A 2L08A 5KFKA 2MKJA 2N3LA 3GFXA 3OTOF 4CYUB 2FB0A 3PYFA 2MQMA 1IKYB 5I3PA 4QU6A 3TJAA 4WYLA 2KJWA 4LT6A 3A3NB 3FQKA 3MR6A 2A1BA 4ZPBA 2KVIA 3A13A 1FRJA 4DR3F 1S1WA 4DSLA 4YR2A 1TV6B 2HLTA 1HW9A 2Z2MA 4OHVA 4ZKAA 4FYWB 1L3VA 4CO0A 4YOEA 4MK8A 5GAEU 2D7SA 2EC0A 4FS1A 3TR5A 1XMQJ 4KC5A 4R0EA 1T9TA 2MKCA 2MGZB 1U2CA 1UFLA 2CPHA 2DCLA 2PEHA 1SB6A 3OHAA 1YITS 3E2EA 4HT5A 2AJ0A 2LYVA 3EGWB 3HHLD 3HSGA 3LA0A 4WKYA 3I4PA 2VDIA 2GO8A 4DQPA 3TUPA 1FERA 4K59A 3W60A 2VJUA 3UQSA 2ZH7A 4F4KA 4ECTA 1H3DA 1RT7A 2HNDA 1SV5A 3T9ZA 4F02A 2AD9A 1FVSA 2KB2A 3MM5B 1S99A 3VHQA 3UCUP 3HFVA 4BHQA 1TFWA 4PG7A 4C2MA 5EX0A 3M6VA 3W2VA 3CEDA 2C2EA 1VQ4S 5F3ZA 4NLYA 2KT5A 5GMEA 4XIUA 4A8MP 4XTTA 4DL2A 3TAPA 2HNDB 3I96A 4IFVA 3MFIA 1O5JA 2CJKA 3M1VB 4OZ0A 4C97A 1X5PA 1Y9OA 3QNWB 3QZ7A 1KN6A 3VAGA 2MYFA 1UETA 4Y6IA 4LF9F 5HLFA 1OQ6A 3ITHB 3J81U 2HG4A 3CMQA 1RWPB 4GO7X 2FVQA 3POTA 3BGRB 3R5JB 2DNNA 1CJTB 1G6BA 1H98A 2XYGB 1FWPA 3MWBA 1PAEX 3O2IA 2DNHA 4WTYA 3IM8A 1CG2A 3M2VB 4J9LA 4P9SA 4Q2MA 3T1HF 2HRUA 1FWKA 3CDWA 4ILLA 5RUBA 3TZXA 5JVHQ 1VMBA 2CJAA 1KEKA 4YQWA 2D3UA 2MDAA 3M2VA 5IXUA 1RWMB 4F50A 1U24A 2G4BA 4M5NA 5C25A 1GMWD 3T1YJ 4DV1J 4DPTA 1NJIT 3OFEA 3I5AA 1VLOA 4K5SA 1JQGA 1OWXA 2AT1B 1FNOA 4LUBA 1TKDA 2D41A 1IKVA 4OZ1A 4FYXB 4RO0A 2AZ1A 2DGVA 2QT7A 1CQNA 2OEMA 1EETB 3SEOA 1D9FA 2JWNA 4TQSA 4JI1F 2VFSA 4CLSA 4TU8A 3VTIA 2J0QD 3QIPA 2D3O1 1TFYA 3H42A 1FRMA 2LEBA 4KGXB 2I6WA 1TL5A 3N6LA 2D69A 3NWGA 4QQBA 4AD6A 1KQSR 2E1AA 1HA1A 1W26A 1RQ0A 1ZM4A 3DM2B 2K06A 3DXBA 2J8SA 3RU0A 1NSKL 5KFDA 3KLHB 3C6TA 4PWWA 4DN9A 1BE4A 4W92B 3CE8A 3IWLA 1K1SA 4GVBA 1NK8A 4A8FA 3ETOA 3CJRA 3M6UA 2GIFA 1W7WA 2MQ8A 4LF5J 1R8BA 4K2XA 3I9V9 3FEZA 3US5A 4O0IA 4ZMMA 4I2PB 1Y4ZB 1SC4B 3B82A 1VOMA 2DO0A 2MLXA 3IS9A 1IM6A 3H8YA 4ZPAA 4ALZA 5K9FA 1I94F 1R43A 2BV3A 4B9TA 3W9HA 4B3OA 1PYTA 2CYYA 2FUG9 4C4WA 3KLEA 1X5OA 3I0RA 2HVIA 5KG4A 2R8IA 3ET6B 4G1PA 4C8YA 2HZCA 4YY3J 5J1NA 2MZQA 3MM6A 4CM2A 2R7RA 4DL6A 3B78A 1S77D 4C8MA 4CZCA 1JXEA 3BGOP 2RT3A 4ETZA 4N5SA 4DS5A 1C1CB 2HQDA 4NE9C 2HWIA 3LH2S 3DN9A 2CQCA 3PRDA 4UQTA 4BWJA 4F3QA 5DQIA 4ANDA 4C3KA 1FNXH 4DSJA 4ZVEA 4F36A 2BVZA 4KV8B 2JEJA 2E9TA 3PFEA 2J0WA 3M2UA 1QUVA 2CDQA 4XK8C 3EGVA 3FRZA 4DR1F 3T5LA 3ILOA 4DHVA 5LOQA 4O3OA 4RR5A 1HQ2A 3T6JA 3IG1B 5B08A 4UUWA 3DLKA 4E8UA 1CSJA 3OR2A 3E3XA 5CCLA 4EYHB 4URQU 3VAJA 3VAIA 4CQ1A 2FVCA 3OFHA 2ZE2B 3PYGA 3X3UA 4AL5A 2FHJA 2KI2A 2NLWA 3N79A 3O3LA 1YSJA 5AE1A 2X51A 3OJUA 3TP2A 4C8NA 2BE7D 2YXLA 3GYNA 1U45A 4UTGA 1N48A 1V9OA 1M0SA 4P2XA 2AX0A 1XK8A 2DEJA 4J9VA 1OO0B 3D0IE 4OI6A 4KB7A 2DBBA 3DDNA 1BD6A 2XTJP 4PQAA 5HMYA 2KM8B 1T3NA 3OVBA 2FIUA 2HNZB 4NA2A 5F9NA 1BQMB 2JHEA 3LF0A 1IWAA 1RGVA 3BQ2A 1VBKA 4RW6B 3B54A 2V34A 1F3FA 1PSDA 3FGVA 4OYOA 2YX1A 1SQGA 4NWBA 2ABYA 3DLJA 4U67Q 2XY5A 3QJLA 1S6UA 4DV5F 2YWKA 2BMBA 3SCLE 1LWCA 3R5GA 4ZCIA 3KLFB 1IVZA 1PC5A 3DMJB 4PWDA 2O1PA 2VF3A 5IV3A 3K59A 3MFHA 5D6GA 1OS5A 1EHWA 4HEA9 4GKKJ 3AB2B 1SL2A 3AA8A 1FFGB 2W4CA 3D3CJ 2BW2A 4Y34A 1UJ4A 1NPRA 5ITHA 3FC9A 3W62A 1QE1B 4C3MA 2KM8C 1OYDA 2DH8A 4QJVA 1YG0A 3AD8C 3DKDA 3NP5A 3BDPA 3W9JA 1JLCA 1QUPA 2RQCA 2DITA 3LW5C 4YB5A 4BCAA 2D74B 4ID5A 2G0JA 2W25A 5T7LA 4ECSA 4LF6J 2CNKB 2HMIB 4C11A 2KRRA 4ZVSB 5HO4A 3RBDA 2BZ2A 2DHSA 2LXUA 3KXDA 5GAHI 4WK3A 4F4XA 2Z2ZA 3MMBB 4ED3A 1T95A 5EN1A 1BC6A 1PBUA 1Q95G 3J7A1 3ZTPA 4UF4A 5DZ7A 5KFXA 3EE3A 1JJHA 3D6FB 4RBUA 2GGPB 4Q8EA 4V19X 3TVKA 3KK2A 2FJXA 2BYCA 1DTTA 5DLGA 5A8KA 3VQSA 3OHBA 3CMAS 2ZWOA 1UA0A 2IJRA 2DPJA 4DSIA 2YKMA 1QY7A 3WZ0A 2FJWA 1YHQS 4OV6A 3MEKA 2VBYA 4ZPWR 4DR4F 2DIUA 3D28A 1NO8A 3FEYB 4MKBA 3ICLA 1DTQA 2EC2A 1YBTA 3MECA 4OYWA 2ROGA 2IDLA 2C3MA 2QX0A 2HFNA 3HI9A 4Y2CA 2YNHA 4YEAA 4FF3A 2C3OA 3BPDA 1AFIA 1G7CB 3MCSA 4CH0S 2JEFA 4ID5B 2F4VJ 3NGUA 2FGOA 4W98A 3LP1B 4KIAA 5HP1A 1IBMF 5LMUF 4R25A 2VQEF 4F04B 3OT9A 1Q86T 2RQKA 2VQFJ 1HMVB 3TNVA 4OMFG 2HW3A 3TUJC 2ZHOA 5BR8J 1BGXT 4X62F 4M5IA 1B99A 2Q79A 3F44A 4J9KA 3S7RA 2MJUA 3BDEA 5FLXY 5HLFB 5KFLA 1FD8A 2LQ5A 2WHOA 3MEGB 4LR8A 3SMZA 4OHWA 3HVTA 3UDLA 5ETKA 3V6JA 3SV4A 1SJ3P 4HKQA 2JEGA 3QFWA 3QSIA 2IPOB 1TP7A 3W8PA 2XGQA 5CXTA 1JLFB 1CULB 2VL1A 5HVFA 1DQ9A 1N34F 1JNZB 2HVEA 4XPCA 3PZPA 1IKXB 3G71S 3T5KA 1APSA 4HI1A 3TAMA 3RAXA 2GJ2A 4NCAA 2CVEA 3P3DA 2X3GA 4WFBQ 1F5CA 2QLFB 3BGFA 4RJVA 2CG4A 5U47A 3S01A 4LFCF 3ULHA 8ATCB 5IWAJ 2VJVA 2OPRB 1OMSA 2WW8A 5A8WA 4O4GB 1YJ9S 3P5TL 1VQ8S 3AODA 1Y11A 2BW7A 2DNRA 2XYHB 4FZVA 3TAMB 2UUCF 1URNA 2XEXA 2AJ1A 1KRPA 2UUBF 1PCAA 1T05B 4F0KA 1OPIA 1A7GE 5AXNA 5DGAA 4WF9Q 4QIGA 3ENVA 4IO1A 3FJ2A 5KT4A 3BQ1A 4AQYJ 3HVTB 4FDFA 2GHVC 3DOMB 4OJHA 3MUMP 5K8NA 3P8BB 4DSFA 3C2PA 1WDTA 5HQLA 3DU5A 4EMDA 1YIJS 1CJUA 2VBZA 3QMQA 1RT4B 4RPFA 3EPIA 4F4WA 2E7XA 3I82A 4RWWA 4LF7J 2FHJD 2MHNA 4KO0A 4L73A 5F8LA 1S5ZA 2MZJA 3TWZA 3D54A 3SYZA 4MFBA 4E2FB 2ZH9A 4HTJA 4DUZJ 2ZC3A 1ZS6A 3LANA 2WB4A 1WC4A 3FBCA 5KT5A 1VLYA 5LT5A 1REVA 5EWEA 1UKUA 3GB0A 2IM1A 4MKAA 2AP6A 5KFBA 3FZBA 2J5AA 1YTYA 3C8YA 1U1LA 4V1Ak 4B3MJ 4TXSA 3KMSA 2ZUAA 2G2OA 2AW0A 3PKMA 2HK2A 3J7Z5 3LWLA 2EKNA 4FYDA 3ZZUA 4ED7A 2G0IA 2GQQA 2WOMB 3NCPA 4ID8A 2R7QA 4PG6A 5I3UA 1U1OA 1U6BA 2IC3B 4C8ZA 5KFPA 1RU2A 4F3OA 3CDAA 2VICA 2HFOA 5DM7Q 3Q8VA 3CDUA 4IG0A 4YHHF 3RB4A 4Q0BA 3DRSA 1U6ZA 3FFIA 1IKVB 3UI3A 3DYAB 2ZH8A 4USHA 1XC9A 3J7AN 1U0HB 3M8ZA 2DCUB 2F9DA 1NK9A 1SKUB 1FX4A 3MPYA 2XLKA 2IC3A 3E51A 3KDNA 3IS9B 3K7RA 2Z2YB 1YBUA 1U0SA 4D3GA 2AGQA 1OQ3A 4ZA1A 5KFAA 1FE0A 2WRMA 3A1YG 3DLKB 2DR5A 5LJ5Y 2LXIA 2QFIA 1EARA 3IBWA 3UNYA 2QFJA 3OL7A 4N76A 3PNIA 1VQNS 2ZD1A 3AD9C 3UD4P 2CQ4A 4Y0FA 2UXBF 3JSYA 2LLZA 1UA1A 1H73A 1NNDA 1Y10A 5KT6A 3F73A 3UD5A 4M94A 4M5DB 1ZM9A 4UZCA 4QR2A 5F41A 1EETA 4CRJA 1HHQA 3L95X 4JP8A 2ZFHA 1FDBA 4WKRA 4OHZA 2ZBCA 1ITPA 5I4MA 3H5YA 4LFBF 3W8GA 1XIQA 1XNRJ 4JI6F 4RNMA 2QG9B 1VRQC 1LWFB 4KY3A 2RU3A 2C28A 1S1TB 2VKZG 7FDRA 5DJBA 4HT7A 3JSRA 2V4JB 2DY9A 2AIRB 5LJ3Y 3UN3A 2R7UA 1C2PA 3NCQA 5T41A 4WWSA 3MURP 4UUXA 3HT0A 3DGPA 2V6AA 3C19A 2XGPA 3KLHA 2FD2A 4O3RA 2HKEA 1FK9B 2HFSA 2NYHA 2ROPA 3IRXB 4O4RA 1UWAA 3F41A 1HWIA 3LAKA 5KFGA 2GHPA 5KFMA 2KFYA 3OXFA 5D3GA 4KKOB 1N5SA 2LEAA 4ZP6A 3JQJA 3Q86A 2QJ3A 1ULRA 2VBXA 3ZNUA 2OUGA 1NXIA 5J1EA 4RW9A 3IA0A 1TELA 4ELTA 1J5OA 4K4VA 4UQGA 4QU7A 4FNHA 4M5DA 4M1KA 3R5DA 4P2MA 3ET6A 4C0BA 4B9LA 4JI4F 4L76A 2MHEA 3HKWA 4B3TJ 2L9DA 1RHMB 4LF8F 4ECUA 2YNIB 1KFSA 1MSWD 1BUXA 4R8UB 3BSAA 2CWKA 1BQMA 1IJEB 4YS2A 1SKRA 2RHSB 2Z58B 2HAFA 3V6DA 2RD5C 4USUA 1H2TZ 3OPKA 3GV5B 9ATCB 1R8PA 2C3YA 3H2LA 2MQNA 3K2YA 1AZSB 1T9WA 3M30A 1SJRA 4LRFA 1S59A 3BBFA 4R8UA 5HL7Q 1T11A 3OVAA 5KFHA 2IM0A 3W3SA 2WSCC 4Y00A 4CNYA 4NLRA 1SVDA 3LUYA 4LJMA 1DFDA 4O0NA 5KFSA 2R7VA 2OJ3A 5H9FK 3DMJA 3LGHA 4DV2F 4PWDB 4DV3J 3DFEA 3TYTA 4NLUA 2XLJA 5ETNA 2F8HA 3MPWA 5HMZA 5EWGA 4NLDA 1JIHA 2MTLA 4J9OA 2OFGX 1S9GB 3W66A 2C22A 2MKKA 1YRXA 1FEHA 1YZ6A 3AXMA 3WHIA 2YKOA 2VKRA 3CJ3A 3N0VA 5BYRA 1X4BA 8RUCA 3TANA 3IWNC 1DHMA 5JUMA 1NMEB 1X4AA 4JI8F 4AXJA 3HM9A 1MWYA 2DNYA 2KRBA 4NMXA 1I51B 3ZTOA 1ZZNA 1NB7A 3R5AA 1XEZA 4K50A 2NREA 1FDNA 2EEYA 1HWUA 2GAGC 2J7WA 3M7VA 3DRPA 2HBYB 4ZLPA 2Y1RI 4O44A 2ROEA 3J80U 1P9QC 2YH0A 3NXZA 1LV5A 1U1NA 2NUHA 3H5SA 4J9RA 1UWBA 5J2MB 1VJQA 4DV0J 1QD1A 1J5EJ 2HHTA 5MLCV 4C98A 3SIPB 3NL0A 1ZZFA 5DG8A 1EP4A 3CCZA 3GG0A 1TL1B 3BF4A 3Q8UA 4LSLB 3Q23A 1NK7A 2AYMA 5A8KB 2CJXB 4GC6A 2Z56B 1NPPA 5IQ6A 1D8YA 3EVWA 1S6QA 3BKUA 4FPRA 5D0HA 2XLIA 4LF8J 1JLCB 3D6MB 4OI3A 4CO1A 6FDRA 5M2PA 1L3UA 1HBOB 3MR3A 2I38A 2EFGA 4LSLA 4C11B 5ETQA 1HARA 3KG0A 2FVPA 4ANCA 2VG7B 4RKUC 5M2RA 4CLFA 3DLGA 1XR7A 1JXLA 1EQMA 2DK2A 2QMUB 4KSEB 4RW4A 5DDRC 3D2WA 1PGZA 4OHYA 1WORA 3M6XA 2PO4A 1M5OC 2B9EA 2LCWA 4FBTA 4DZ6A 4O44B 1JLAA 1R7IA 1QE1A 4QIEA 1Y7PA 5HBMA 4I6AA 2U1AA 1GXUA 4ZPVR 5KG2A 5J2MA 3MM7A 3DLBA 1XNQJ 1IUJA 1WKLA 1HBNA 1SBRA 4QWBA 1SI9A 2XZWA 2H65B 3H25A 1TL1A 4DV6J 2IJFA 2OGUA 2HMIA 1T9VA 3UN2A 2BE2A 1RT2A 3MUVP 2HURA 2FLOA 2O3DA 3HLUA 4PEOA 2XWXA 3KJNB 3TW0A 4CIOA 2XY6A 2LECA 1RI7A 1OIAA 4ZVTB 1RTHB 2Y1IA 3H7HB 3F0NA 3M1VA 3BM7A 3THPA 2BACA 4NASA 5H1SV 4OZJA 1HBUB 3BSOA 4F4ZA 4OZ3A 1Q5YA 1DTTB 4DL4A 1M5PC 2NXUA 3U1NA 2UVVA 2UXBJ 3KJFB 4WE1A 2XS7A 3MD1A 1HWLA 3OLAA 4DV0F 4CLUA 1EJ7L 1LK5A 2RS8A 5HMXA 2HQ3A 4JOUA 2KTQA 1IKXA 2J9DA 1KQGB 4H54A 4W4MA 1MU2A 5KG7A 2D9PA 5JVGQ 2AJ2A 2PIIA 2AJFE 3V6KA 1VQ9S 2DVIA 4PZVA 4KHPF 2OMLA 2OPQA 3GPAA 4U95A 1NJXA 1TMMA 5J2PB 2BOAA 3IN5A 3QSYB 4NXNJ 2VOPA 3W61A 1RE1B 3ETMA 3UE2A 2Y0SD 2CNOB 1JLQA 5E7OB 2EG2A 5CZVA 3MEGA 4TU9A 1QVGR 2I2YA 1D0EA 2ILZA 2LDIA 4NOHA 4LR7A 1FE4A 3QZ8A 1N6QA 5D8HB 1RT5B 1UEKA 1UVNA 2CQPA 4OYZA 3IR5B 1PJ6A 1CS4A 2LQ8A 2QLWA 1J27A 4LFAJ 2A2CA 5G4DA 1VRTA 2JFDA 4CM0A 1TV6A 2ACMA 1IR2A 2LEPA 4DV2J 2D3OR 1ZA1B 4K2JA 2DXFA 2EI5A 4DCPB 3PR4A 4K4YA 1O8BA 1SUQB 1T7PA 3PXGa 1PILA 2BJ7A 3ENQA 2HK3A 4H4KC 2YNGB 4HL9A 2E5LJ 1S0VA 1GX5A 2Y8YA 1S9EB 3KJQB 4K4UA 2KL8A 5C7PA 4QBUA 2EFNA 1OY6A 2AYEA 3GU0A 2Q66A 1VQMS 2CQIA 3OVSA 4LBHA 3D4JA 2FJEB 1FVQA 1M1HA 2J7KA 1TKZB 4P10A 3EMTA 1RJJA 3KJVB 4FF2A 1S7IA 2QLJB 3ZC4A 5KTQA 4B3TF 5C2CA 4JV2A 4EI2A 3M8YA 4QR1A 1NDPA 1HNXJ 1FX2A 2QEXS 4B9NA 1N32J 5F8IA 1O51A 2OP5A 2ILYA 3IAS9 2V94A 1S0MA 4KFBA 3BN4A 3H98A 2XI2A 4YB6A 2FC9A 4CO4A 4CLYA 1X60A 1HNIA 2N4CA 4C0OC 1NJYA 2COLA 2QSFA 4URSA 4CT8A 2DR6A 4HHHA 4OJGA 4WK1A 4Q0BB 5C5JA 1S1XB 2R7OA 1WI6A 3HHDA 3JSBA 3KFWX 1VJWA 4F4AA 5HQ8A 1NJWA 3AQOA 1HR0J 4RNHA 1T3OA 3W65A 2RNEA 2VFTA 2VPYB 3A4TA 3MM6B 3ZZOA 4EWTA 2IMWP 5C42B 4EO6A 5CYQA 2R7XA 2NPFA 1EQ0A 4IRDA 3B4MA 2GNKA 4LFCJ 2UXDF 3HZGA 1DARA 4LFBJ 2V2KA 1VBZA 3MAHA 3HSJA 4WFXA 1QSYA 5I3UB 3QIPB
chains in the Genus database with same CATH topology
2XMTA 1NKCA 3KNGA 1TAUA 2V8HA 2CPXA 4DEZA 3CD5A 1R6YA 2BDPA 2Z0GA 2MQQA 4Q7AA 2DGQA 2F8EX 4LVOP 1IXKA 4UW2A 2BM1A 3DRYA 2Y1JA 2HIQA 3HF5A 5D3GB 3OL8A 2ERRA 2IHR1 1YJWS 3DU6A 3BGUA 3K0JA 4TY9A 3QIDA 2GX8A 4DF4A 2LU2A 5E3PA 1I1GA 3O6QA 1Q8LA 1NH8A 4QZVB 3KOAA 5FDLA 3I6PA 5A6WA 1VK8A 4MH8A 3VF0B 3KHHA 2W8KA 1WHWA 1XR6A 3M2RB 2P6SA 3MM8A 4B02A 2XCAA 4DFPA 4UY85 2AJQA 3DLEB 4ETXA 2M2BA 1HNXF 2BA9A 4NLQA 1U2RA 1VC6A 4N47A 3W2WA 3G8SA 1K73T 4USIA 4QR0A 1MW7A 3DLEA 4DR6F 3IR6B 4YUDA 1JLGB 2GV1A 2LMIA 2PT0A 4LQ9A 1LKZA 4IR9A 3S8SA 2J6TA 4EZ9A 3CJ2A 3V6HA 1J5EF 2MY7A 4O3PA 5L1JA 1U47A 1TKTB 1C0TA 2RMLA 1HWJA 3HVAA 1QSSA 1HD0A 2F9JA 2B56A 3DOKA 5CYMA 3CC2S 3CJ5A 4PXCA 1TKTA 3HK2A 1G1XA 3T9NA 2B4UA 2VC0A 1HW8A 2BJEA 2PA8D 1WEYA 4IYQA 3CCMS 1M5VC 4AQYF 1NU4A 3W2WB 4J9PA 4J37A 2YWHA 2W7OA 3SCJE 1NK0A 1NEEA 2GC8A 4DV4F 1URRA 2DH9A 2HRYA 4DN0A 3JTOA 1K0VA 3QGPA 4A46A 3CD0A 3V81B 2V4RA 5DQGA 3BEGB 2KKHA 4RW8A 1S76D 3QJPA 3OUYA 4MK9A 1BQNA 4JBCA 1FRHA 1FNMA 3PHEA 1UMJA 4WJBA 4U7UK 1LK7A 4OI1A 4I2QB 2GW8A 5LSRA 2NPIA 2OD4A 1TK0A 4MJKA 5L8RC 1EP4B 1HL6A 1UVKA 1C4AA 4L6V3 2KYZA 4X4NA 4XAKA 3HHLA 3MMBA 4C3LA 1JNRB 1DZ5A 1R0AB 2LQJA 5DDQC 1NKEA 5BR8F 1FRXA 2QA2A 4ZP7A 4DLGA 3LP0B 5IT4A 1VQ6S 1QAIA 2RIJA 2KHDA 1WHXA 1DURA 4ECYA 3BR9A 2YWEA 2DNGA 2GMJA 4QIVA 4OV1A 4Y3CA 2JL9A 3KWMA 4DS4A 1DTQB 4AL6A 1F60B 1XNRF 5KFEA 1YJVA 3SQGA 2F7VA 2V0NA 5DRKA 2V4QA 2RDJA 2MQPA 3MMCB 2N7CA 3H5UA 1HBMA 4X4UA 1IKYA 2KXNB 1KOHA 3NBPB 4DSKA 3PX4A 4OJ3A 2LQBA 3LGMA 1N8RT 4NX9A 2MMYA 3T1AA 5M2UA 4MKYA 2XI3A 2ZH5A 2Z2LA 1Q8IA 4PG5A 4I69A 4A48A 4O4GA 4UOCA 2UV8G 4IFVB 2R2RA 3RB3A 2W4DA 3TVYA 2L9NA 4A8OA 4LF6F 1IM4A 3KK2B 1HNVB 2CQGA 1CVJA 1YVFA 1FKPA 2IVMA 2IVYA 3SQGB 2HHQA 1LXNA 3VAFA 2CPYA 5H9FJ 4FS2A 2AQ4A 1WG1A 1IKWA 1P8GA 2UVUA 4LF5F 5AXMA 1R8AA 4DMZA 1RT5A 2ADCA 2FLNA 4G3IA 4PG8A 1RTDA 4IRCA 4AYBD 3GSDA 1FKPB 2MSSA 3KJVA 4ECRA 3OL6A 3M8SA 4NZ7A 5A8WB 3GV7B 3BR8A 4ZS6A 5CA5A 5KG3A 4B3RF 1RT6B 2GQ2A 2OSRA 2K3KA 3M32A 3BN7A 2OTLS 5L39A 4BDPA 2FJBB 3LPYA 3WDOA 4IDKA 4KT0C 3ZZYA 1SV5B 2VA2A 4FBUA 1E6VA 5KFUA 4H4KA 3CT9A 5KFIA 1RAJA 2VC1A 2EFOA 5AXLA 3W2VB 3T1YF 3PJWA 2NZ4A 3HJFA 1S6OA 3DXSX 2VD3A 1JLEB 2Z4PA 2Q3PA 1U49A 1IKWB 3DNCA 1B0PA 5E3RA 2WTFA 1FRLA 3TAQA 1U6FA 1FXLA 2DB1A 3HHNB 4CH7A 1N6QB 2KN4A 2QV6A 1KS2A 2P5VA 3CWJA 2Z8QA 1WNEA 1LFWA 1VQSA 1VBXA 1FTRA 3GYXB 2IRUA 2I1RA 2K3IA 4DOZA 1WEXA 2XSJA 5E2QA 1KQKA 1E6VB 3N9UC 2UUAF 2VG6B 4MFBB 2IVFB 3IC1A 1W2BR 2PC6A 3PFOA 2VFUA 1FJGF 3DRRB 4X2BA 4EBDA 4P7VA 1REVB 1RISA 1S48A 2VA3A 2CQ1A 1JJ4A 4GMKA 1FRIA 2KH9A 2ZH4A 4ECQA 5LXYA 2BRLA 4I2PA 2KO1A 1BY9A 1TL3A 2BXJA 2IFXA 4U7CA 3MEDB 1X9SA 3QO9B 5A8RB 3U1MA 4KQZA 3UWTA 2MZSA 1B7FA 3T6BA 1KQFB 4F4YA 3Q0AA 3PW4A 2ZZMA 1SJFA 1CPZA 4IQMA 2DNOA 2KXHA 5ADZA 5A2QY 2DRAA 2PDAA 3RB0A 2YQ3A 3OTEA 2R8GA 1FTCA 2LKZA 2C3UA 3CGIA 4WIIA 2FVSA 2W24A 2HHPA 1L5UA 2W8LA 4M8LA 3KYLA 3EXCX 1OSCA 4IG0B 4ZK7M 2HGNA 2VBWA 3AJ2A 2WBRA 2B0GA 2LXFA 2D3ZA 4YR3A 5EDWA 3TVZA 4Q5VA 4MAKA 2EK6A 4X4TA 5J1EB 2PMHA 4RW6A 3SFUA 3GIKA 4WZMA 4WU2A 5IM0B 4DFJA 1L3TA 3PO4A 3RW6A 1WTFA 5C24A 1UFWA 3DHXA 3TUIC 3U7JA 4RUCA 1Z2LA 4ATNA 3HVWA 2R7SA 1K1QA 1Y5NB 2Q6BA 4GC7A 3M9MB 1X5TA 1S9GA 2HPUA 2RQ4A 2POKA 4PKDB 2WSFC 4J9QA 1R8HA 4A8YA 4WFYA 5J2NA 1IBKF 1U4BA 3QGIA 3G6ES 2K1RA 2J8AA 4KKOA 4WFAQ 1M5HA 1SQEA 2JVOA 1Z2ZA 3O5TB 5IWAF 3M2RA 2CPJA 2DD8S 4AUKA 2ZE2A 1C1CA 4ECWA 1JX4A 1TKXB 4DSEA 2HS3A 1N52B 2DNPA 5EHHA 2F1FA 4GO5X 2KFZA 4Q44A 2K2PA 1CQMA 2XMJA 1SC6A 1ZAWA 3UR3C 5CH7B 2DHGA 1LWEA 1RWUA 2I5JA 4ES1A 4IRKA 3RR8A 3Q24A 4DWIA 2XNRA 2GA7A 3CSKA 1UL3A 2KT2A 1LW2A 2AJ4A 2E1RA 1Q4RA 1TVRA 1HBOA 2QE5A 3H5XA 3CJ0A 2VV5A 5J2NB 2RF2A 1AROP 1ZPWX 2X1GA 4ECVA 3MPVA 2UU9F 3AJ1A 3M8QB 5DG9A 2KDOA 4PQUB 4OIXA 1UVJA 3LP2A 2M52A 2F4VF 3OQ2A 4IKAA 4ZVFA 3LP0A 3M8PA 2G1DA 4NYPA 4DQIA 5B0EA 3KLGB 2FPHX 3R3TA 2PI4A 1LWEB 2P9EA 2PFFB 4ES3A 2WSEC 4R5PA 3MOZA 1DJ0A 3G8QA 4PCQA 3G96A 4G6VB 3UCZP 2PMZD 2KHCA 2P9GA 4F25A 1K0TA 3QYYA 1AFJA 1HQUB 2YY3A 3TUZC 1YJTA 2YKQA 3V4IB 1Y3JA 2CRLA 4C9DA 2DIVA 2EWHA 2BABA 3QLHA 4G1IA 2HQIA 4ZPTR 2OMOA 5D4OA 5BJRA 2YNHB 5DLFA 3NGDA 1C1BA 5L38A 4ED5A 3N01A 3RAMA 1HPZA 2VUGA 1X4DA 4DJBA 2BJDA 3OBIA 3PJXA 4IH7A 3DLLQ 1RT3A 4ZHRB 1RYRA 3ZZZA 5EWFA 3F56A 1ZAXA 1KC8T 5KOWA 2LA6A 3MMAA 2P6TA 3I0SB 2B6AA 4AE5A 1D1UA 4ED2A 3CC4S 1ZH5A 4N8NA 2MGZA 4GKKF 4F67A 2G0CA 4IFYA 4FF1A 2GGPA 2XG8A 4ZP9A 1T02A 2HFZA 3V5RA 1QSLA 3RYLA 1JB0C 4BC9A 4MK7A 1AUDA 1C0UA 2L9WA 3GR0A 2MQOA 1RTHA 4RW4B 3HO1A 1FDAA 5LMNF 1JJ2R 4JYAF 2FHMA 3M32B 4M63A 1Q82T 4WE1B 1X9MA 1C0UB 1Q16B 2R7TA 1ZPVA 2YNFA 1FKOB 4OQJA 4C7QA 4H4MB 1DLOA 5DETA 3DCAA 4C8OA 1RTDB 3RRHA 3H59A 2W9CB 1RT2B 3FMBA 1VQPS 5D4PA 3GZ7A 3IGVA 4GKJF 1WACA 4BC7A 1A6LA 4WU3A 5KFWA 4ICLB 1UVMA 4DQSA