2MSTA

Musashi1 rbd2, nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
b'KIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (MUSASHI1)
publication title Structure, backbone dynamics and interactions with RNA of the C-terminal RNA-binding domain of a mouse neural RNA-binding protein, Musashi1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mstA00
2DHSA 2RU3A 1H2TZ 1U6FA 2HZCA 3BO3A 3BO2A 1VQMS 5ITHA 1VC6A 2MZQA 3VF0B 1WF0A 2ZJRQ 1OPIA 1D9AA 2MQQA 2HYIB 3EGZA 2M8HA 2HGLA 2BOPA 2M70A 3CCVS 4IO9Q 1UP1A 3OW2R 1KC8T 1O0PA 2FC8A 3B4MA 3TO8A 2D3OR 3IRWP 2CPDA 4UQTA 3R1HA 2F9JA 4WCEQ 2FHOB 2SXLA 3BEGB 3NMRA 2CQ0A 1WHVA 2MSTA 4YUDA 1JMTA 1KD1T 2JVRA 2CQ1A 4C0OC 3MUVP 2KN4A 4OZ0A 3NNCA 2LXIA 4WFNQ 2I38A 2RS8A 2AYMA 1HL6A 2L08A 2KH9A 1U1KA 2U1AA 2FY1A 5IQQA 1VQ5S 2DGUA 1U1OA 2MY7A 3S8SA 2MKIA 1A9NB 1X5TA 1VQLS 2ADCA 1AUDA 3NS6A 1VQPS 2DGQA 3CD6S 1JJ2R 2QEXS 3CULA 4WFBQ 1SJQA 3CCRS 1U1NA 1M90T 1WEYA 3CMAS 1NO8A 2MKHA 2MJUA 2JVOA 2K8GA 4FXWA 1U1PA 3MOJB 1FJCA 1RK8A 3ZZZA 1JJ4A 3SXLA 3S7RA 2DNHA 1X4FA 2M8DB 1VQNS 2L41A 3CCQS 3VALA 3P6YC 2EK1A 4LMZA 1OO0B 2OSQA 3CXCR 3EX7B 1UW4A 2PE8A 5GVQA 2LXUA 2MSSA 4V19X 2LYVA 2KRBA 2KXFA 2F9DA 2RQ4A 5HL7Q 1QVGR 2DHAA 1YI2S 4RU2A 2V94A 1PO6A 1VBXA 3CCUS 2GO9A 1SJ3P 3HHNB 4P6QA 1M5VC 1X0FA 4PKDB 2VODA 4CQ1A 1SXLA 2MPUA 2LEAA 1N52B 2RRBA 1VQ6S 1YJWS 4FXVA 3U1LA 2HVZA 3MUMP 2G1DA 3TP2A 1Q81T 4OZ1A 2DNRA 2LEBA 4ERDA 2VOPA 2PEHA 5JVHQ 2LA4A 5BJRA 1BY9A 2MY8A 2VOOA 5D78A 1UFWA 2DIVA 3UCGA 3G96A 2DO4A 2XS2A 4UY8T 3CCLS 1Q7YT 2YWKA 2DGVA 4C7QA 2CJKA 2DHXA 1DBDA 5CA5A 4C4WA 5LXYA 3CTRA 4IUFA 4IOAQ 2CPZA 2J0SD 2KT5A 5GADU 4W92B 2MZRA 2CQCA 1B7FA 1K9MT 2J76E 3P5TL 5EN1A 2G4BA 2DH9A 3PIOQ 1OIAA 5LJ5Y 1KQSR 2L9WA 1M5OC 1FT8A 1KOOA 3VAFA 2MKJA 1KOHA 2JWNA 2EK6A 3THTA 2HGMA 5DDQC 4QU7A 1M5KC 1P1TA 4WFAQ 3JB9k 3VAHA 1WG4A 2Q79A 5JVGQ 1X5OA 2DGTA 4F02A 2U2FA 2MQNA 1FHTA 1WF1A 3G9CA 3CF5Q 5CYJA 2MZJA 2KI2A 3D2WA 3R1LA 2KG1A 1VC5A 3BS9A 1VQOS 2WBRA 2XSFA 5DM6Q 2X1GA 3TYTA 4Z2XA 1YJ9S 1DRZA 1NU4A 1G2EA 3HI9A 2MHNA 3IWNC 2B0GA 2FC9A 3SDEB 1X4GA 2MQPA 2DB1A 2ADBA 2KRRA 2DNGA 1M1KT 1U2FA 2XS7A 1FNXH 3NS5A 1HD0A 1F9FA 1P27B 2N82B 2GHPA 1X4BA 3U1MA 2YKAA 5MLCV 2KVIA 2MXYA 1YWXA 2N3LA 2CQ3A 4LJMA 2M9KA 1URNA 3Q2TC 1WF2A 1K73T 2MB0B 3MURP 3S6EA 2E5JA 1WEXA 3B4DA 5GMKa 2AYBA 2KM8C 1YITS 3FEXB 5GAGU 2JX2A 5IM0A 4Y0FA 4TU9A 2MGZB 5DDRC 3S01A 1VC0A 2XB2D 2D9OA 3DXBA 4TLQA 3CPWR 3UE2A 4W90B 2DGOA 1WHWA 2X1BA 2FPHX 4ZKAA 2M0GB 2RQCA 1U1RA 1UAWA 3CMES 1X5SA 1WHYA 4WF9Q 2I2YA 1VQ8S 2VONA 1R8PA 1QVFR 2DNKA 4EGLA 2CQGA 1N8RT 1N54B 5LXRA 3P3DA 2EVZA 1X4AA 2MKSA 3H2VE 4WIIA 2ZJQQ 1YJNS 2RRAA 3RW6A 3NNAA 2MQMA 3R27A 4IOCQ 3UCZP 1WTBA 1ZH5A 2NLWA 2QA4S 2CPYA 3MXHP 1HD1A 1JJHA 4CH0S 3PIPQ 1WEZA 3MI7X 5FJ4A 4QPTA 1H2UX 2D9PA 2MZTA 5D77A 2LMIA 2A3JA 2CPHA 4BS2A 2KFYA 2E44A 2KXHA 3CC4S 2DNZA 1WELA 4ED5A 5DDPC 1M5PC 2RT3A 3J7YU 3THPA 1W2BR 2MQOA 3UCUP 2O3DA 1PGZA 3Q2SC 2AYGA 2KU7A 2DHGA 2YTCA 5LJ3Y 2NZ4A 4M5DB 2KXNB 1VQKS 4YB1P 2DNNA 2E5HA 2DIUA 1Q86T 1A7GE 2ERRA 2CQHA 5LSLA 2K3KA 1L3KA 2DNLA 2MKCA 3V4MA 1DHMA 2CQDA 2DGWA 4QQBA 2N3OA 2CQIA 2MMYA 3SDEA 3CCSS 3G6ES 2F3JA 2MJNA 3DLLQ 1X4CA 1FXLA 3VAIA 1HA1A 1S79A 5GAHU 4CH1A 3UD4P 5DM7Q 2M7SA 3VAGA 2RUGA 1VBZA 2KHCA 2OJ3A 1VBYA 4A8XA 2CPEA 4TU8A 1WG1A 1NJIT 2KYXA 2MZ1A 2LA6A 2E5IA 2LCWA 2CQBA 2OIHA 1X4HA 2OTLS 1K8AT 1U1MA 2CPXA 2MGZA 3LQVA 3G8TA 4QU6A 3SMZA 2XNQA 3MD3A 3EGNA 1WG5A 1WI8A 3CC7S 3N9UC 1WHXA 2DISA 4J5OA 1SJFA 2DITA 2CPJA 1U1LA 1H6KX 4F26A 3K0JA 2OSRA 2N7CA 2DNPA 4TU7A 2MYFA 1XN9A 4PRFA 2M4MA 3G4SS 5IFMA 2DNQA 3CUNA 3US5A 2CQPA 2X1FA 1VQ7S 2DH7A 1U6BA 3LPYA 3RW7A 3CC2S 2MQLA 3MUTP 2M2BA 3VAJA 3MD1A 5GAEU 1X4EA 2HGNA 2CPFA 2OTJS 2XNRA 3I56S 1D8ZA 2M88A 1WWHA 2G0CA 2J0QD 3VAMA 1YHQS 1VQ4S 3BO4A 1CVJA 4Y00A 3NNHA 5CXTA 4PR6A 2E5GA 1YIJS 2CQ2A 1N88A 4U67Q 2DO0A 1QM9A 1YTYA 2DH8A 2JRSA 3MDFA 3UWTA 1S72S 1SJRA 3CCMS 1DZ5A 2LECA 1OWXA 1U1QA 2YH1A 3UD3P 2CPIA 3G8SA 2KG0A 2RVJA 3FEYB 3J7ZT 1FJ7A 2DGXA 3H2UB 5IM0B 5DDOC 3CCES 3I55S 2RS2A 2AD9A 2LQ5A 1FO1A 3P49B 1RKJA 4LIRA 2QFJA 2J8AA 1H2VZ 5LSOA 1FJEB 4YOEA 4CIOA 3VAKA 2YH0A 4F25A 3G71S 2CQ4A 2DNOA 1X4DA 4WKRA 5H1SV 2KM8B 1ZZNA 2DNMA 1X5PA 1SJ4P 1WI6A 2X1AA 2BZ2A 2RNEA 2DNYA 1ZZFA 3L3CA 1IQTA 2DGSA 2MZSA 2LKZA 1Q82T 2AYEA 2MKKA 1VQ9S 2ZJPQ 3ULHA 2UP1A 2M52A 2XS5A 5HO4A 2DK2A 5DETA 3CCJS 1R8HA 3ZZYA
chains in the Genus database with same CATH superfamily
4DXLA 1ACMB 3DYAA 2HK3A 2IVFB 4DR5J 1OPIA 4EI2A 2M70A 2ZBCA 1R0AB 3GSIA 2DR7A 5CABA 2KJVA 2GQ2A 3I4HX 3FCWA 4GO5X 1NK9A 3OV7A 1KD1T 1E6VB 6FD1A 2UUBJ 4TNOA 1X9WA 2RH3A 5THWA 4ECSA 1S1VB 1IKXB 3A8JA 1VQSA 3FSYA 3FZBA 3CJ0A 3RAMA 3HHLD 3FSXA 1JJ2R 3BDEA 1U4BA 1WEYA 2MJUA 2JVOA 4FBUA 3EJMA 2AJQA 3TZYA 3B6BA 4K4YA 1ZA1B 4NLWA 2AEJA 4I2QB 2A0FB 1NDCA 3S7RA 2L41A 2AKWB 1MMLA 2EK1A 2EBEA 4DV6F 2HEKA 3PJ9A 1H38A 1TL3A 4KV8A 4FDFA 2LYVA 1DLOB 3TZZA 2HSEB 1TR0A 1SC3B 1PC5A 2ZWPA 5D4PA 2QMWA 2VC0A 2B4VA 4FXVA 1TFYA 2MLYA 2D41A 3RRHA 3T9NA 3ICLA 2MDAA 4L73A 3SCJE 1XMBA 3IRXB 4L3NA 1JXLA 2F1FA 2J6UA 5JVHQ 3ZTPA 4JUZA 2VOOA 1NKCA 2CNLB 3NCQA 2AGPA 1RAGB 1T3OA 2VD3A 5KFIA 4Q45A 4PPDA 2VB6A 2E7XA 4G1QA 5LMUJ 3Q22A 1RHQB 1FXDA 3AD8C 2GVZA 2KT5A 5F3TA 4ICLA 1BD6A 2HVEA 2UXDJ 5KFRA 1KQGB 2GIFA 2VV5A 2QIFA 3P45B 3K59A 1HQUB 3OXFA 3C8YA 2DGTA 3CF5Q 2D1CA 3I9ZA 2X1GA 3K7RA 1OY6A 2DR8A 2I9SA 3DLBA 4NXNF 4I64A 2MHNA 1GXTA 3O2IA 2QLFB 2KHDA 3SDEB 2X3DA 3TA1A 2BE2A 3TNVA 3CEDA 4FNHA 4M5HA 2N82B 1H7XA 1S1XA 3OT9A 2N3LA 4YQWA 1JLFB 1M1HA 3TZWA 1RA7A 2BOAA 3G8QA 1MMNA 4F8RA 1K44A 2ZDOA 5CCLA 2JSXA 5HLFB 2HZVA 4K4SA 3TUIC 4W90B 2V0NA 3FRYA 4DUZJ 1SPBP 1S9EA 3MCNA 3RB0A 3HP6A 2OFHX 1GMWA 3OD2A 4FF4A 2DPIA 4HACA 3NS7B 3GFZA 2DEIA 2J9CA 3K8WA 1KEKA 2X51A 4UUXA 4WE1A 4DR2F 4ID5B 5K9FA 3MI7X 2OEMA 3DMJA 2RF2A 4P52A 1WACA 3LW5C 2UVRA 2E9TA 4K4TA 5B0AA 3EICA 3DLGB 2L9DA 1KLMB 1C0TA 4C2MA 4LREA 1NZ8A 1DHMA 1IBMJ 2VDIA 1QAIA 1H72C 4LRCA 1FNMA 1RWWB 4CLWA 4I68A 5ETRA 1T03A 5EGYA 2OFGX 4P2SA 5A8KB 2GVZB 4J9LA 2LCWA 2AHOB 2ZHAA 2VFUA 1BQXA 3LP0B 2FZKB 1TUVA 1WI8A 3BJYA 1IBLF 4JI2J 3DRPA 3CT9A 5E41A 2CQPA 4XIUA 2EI5A 3RW7A 1LWEB 3MUTP 4PXDA 3MD1A 2HGNA 2W7OA 1DURA 2VQFF 2J0QD 2VASA 4K4VA 1S1XB 3VGVA 4MIAA 1EAYC 2VFRA 2ASJA 3GIIA 2ROPA 2BEFA 3CIMA 3QJJA 2ZH7A 3BSOA 5FDLB 2NPFA 4DL2A 3CJ2A 2H4YB 1WOPA 4ZVSB 1DY3A 2FJAB 3DLKA 4CLZA 2UVUA 5HQLA 2BZ2A 4GKJJ 3KMSA 3NXZA 4FYVB 3ENQA 2VQEJ 2VBXA 3UW1A 3BGRB 2IPOB 5J1EA 3CJRA 2UUTA 3DRYA 2G13A 3T5LA 3BO3A 3QFHA 2WTFA 3BO2A 2ZJRQ 2PT0A 4HEA9 3PCOB 2RF2B 3KJQB 1NEEA 2POKA 4F2SA 3FZ2A 2UU9J 3TQEA 3RB6A 1HNXJ 1AXQA 3OL7A 2GMLA 2PA8D 3BEGB 4N76A 1SJ1A 1BLUA 1S57A 3OL9A 2YX1A 4TVAB 2LXIA 4N5SA 8ATCB 2VF3A 3LTOA 4DU8A 3KLIB 2ZEJA 3QRPA 3C46A 2ZZNA 3H4BA 4CLSA 5KT5A 3L09A 1T03B 3QMQA 2NYIA 2P8IA 1SCJB 4FXWA 3V6DB 3AFGA 4KC5A 1JJ4A 1UVJA 2YQ1A 4JI0J 3GV8B 2O01C 4MKYA 3DRPB 2F9DA 1NK5A 4QJVA 4K50A 4IYQA 3UDCA 3C14A 4CQ1A 1CPZA 4ZP8A 2HWHA 3M8YA 5ETVA 3CD0A 1T02A 2EW9A 2FHMA 2AX1A 3MWBA 1FKPA 5E7OB 1RWOB 2WHOA 2XO7A 1BY9A 3PW7A 3G82A 5KFWA 3OFGA 3WC0A 3MEGB 4O4GB 4C3KA 1DBDA 5CA5A 3PO5A 3ZZPA 2GNKA 2NQPA 1K9MT 3EE3A 3ITHA 3DHXA 2KO1A 1VISA 2XC9A 3RZAA 1UEUA 1PAEX 1VIXA 1Y10A 1C1CA 1U7LA 3DLKB 5L1IA 1FKOA 2Q79A 3BBFA 2Z2MA 5KT4A 3D2WA 3R1LA 1SC4B 3BS9A 2BKPA 2VUGA 1EP4A 2CWKA 2K7JA 2IMWP 2B0GA 4Q8EA 2CDQA 4Z7CA 3ENWA 1QTNB 1QD1A 2XTJP 3GWCA 1F9EB 4L74A 4ZITA 2IA0A 2IAJA 3ILLA 1PBAA 1NJWA 4P2MA 1D1UA 4KHPF 3RRGA 2HQCA 4TU9A 2ZZTA 1VC0A 2YNIB 3UE2A 3L7OA 1RAEB 2X1BA 1KR4A 5AE1A 5B0DA 1RBAA 2FD2A 1B0TA 2ZH2A 4FKYA 5IZHA 2DNKA 1RT2A 2FJWA 2B7BB 4ED0A 5KFGA 3DDKA 1FWKA 2BM0A 2F4FA 5KFFA 2NLWA 4HH1A 2CAJA 3AQOA 3PIPQ 4QYZJ 1Q0NA 1N4LA 3TUJC 2FZCB 1HW9A 3DOLB 2FB0A 1WELA 4ED5A 1R31A 8RUCA 3J7YU 2G2ZA 2MQOA 2RB7A 5DRKA 1VGYA 2CZ9A 2OD6A 2B9YA 5HJXA 2GHWA 2HRYA 4V1Ak 2YQ0A 1UFLA 2FZGB 1MLAA 2B56A 2K3KA 5H9FJ 2HRUA 2XWXA 1FKPB 4QQBA 3GYGA 2XBPA 3C15A 4P7VA 4DDFA 5B0EA 1QUPA 3W3SA 5DG8A 3BYPA 2B4UA 5KG1A 4GKKJ 2C2DA 1JLCB 2X7IA 1RXOB 1TAQA 1X4HA 4I0WA 4M1KA 2WOMB 4I6YA 4PG6A 2DRAA 3QO9B 5KG7A 2FVQA 5L8RC 1CS4A 1S0OA 2N7CA 1YJ7A 5M2UA 3NAIA 1S6OA 1HNIB 2DXEA 2OD4A 1VFJA 1L5UA 3BR9A 2GIQA 4JB8B 2W9BA 1EB0A 4X4RA 2YNGA 1QAXA 1L3VA 1K47A 2P5VA 1HYSB 3HO1A 4IR9A 2IAJB 2DH8A 1XTZA 5KG5A 1U1QA 2FLLA 4M5MA 3FEYB 4R5PB 1FJ7A 4GC7A 1RLDA 2R7OA 4ZPDA 1VLYA 4MYTA 4RW7A 3SQOP 1UETA 3RR8A 3LO3A 2BQ3A 2ZUGA 3CDAA 4WPAA 1S9GB 1RT2B 3J80U 1VJQA 4X66J 3ZTSA 2R7UA 2IRXA 2R7SA 5FIIA 1JLGB 1CC7A 3OJUA 5HO4A 1CLFA 5DETA 2E1PA 1TL1A 3ZZYA 1FK9B 1GXLA 4J9RA 2KB2A 3DOMA 3OFHA 5HMWA 5I3QA 2XQCA 1S0VA 1KC8T 4CI0B 4UQTA 1P1LA 1NMEB 4WTYA 3TOQA 4HVZA 1N5YA 2F7VA 1LWFB 4ECXA 3E8OA 2EWHA 4AQYJ 2RS8A 1B99A 5HROB 2VZ9A 3P8BB 1RYSA 1LFWA 1REVB 3ILOA 4O23A 4XDCA 1HI8A 5IT0A 2AV5A 2M8DB 2VPZB 1FKAF 4PYAA 5HL7Q 3N28A 1PO6A 4WYLA 5C2CA 1TELA 4D3GA 1TKZB 1W25A 4OLPA 3UD5A 4EZ9A 3A12A 1P6TA 4OI3A 2BJDA 1L3UA 2FLPA 2B7CB 3RUBL 2RHQB 1RT1B 5LXYA 4ZPVR 2LDYA 4DMZA 3D6FB 5L9XA 2V8GA 2DH9A 4MT1A 4RW7B 4X84A 3R2CJ 4OJHA 2RKIA 4NEZA 2LFVA 5B09A 2EK6A 3AD9C 5JXSA 1YG0A 1T9VA 4S0MA 1AUSL 4LR9A 2ALZA 3DU5A 2XSFA 2F8HA 2HS4A 4Z2XA 1YJ9S 5H9EK 3VTIA 1R7IA 2FHJD 1RTIB 1QY7A 3PVXA 3AODA 4EMDA 4ETZA 3QFWA 1S99A 3H0PA 3DOMB 4HT7A 1X4BA 3U1MA 1T05A 3Q2TC 4LJMA 2MQ8A 2VFSA 3W5XA 4DV4J 3M2VA 3BPDA 4AT1B 3FEXB 2XG8A 4U6PA 1N5YB 4X4QA 2DGOA 3HDSA 1RHMB 4O44B 3V6KA 4F04B 4OYZA 2O1PA 5ETTA 1VRTB 5IC6B 1IN0A 4ILLA 3T9ZA 2I1RA 3TANA 3LALA 3NY0A 4IG3B 1ZPVA 2MKSA 5KAKA 4UOCA 3MXHP 1T9YA 1R43A 2LVWA 3K5OA 4QPTA 2LQJA 2E44A 2BBEA 3ILIA 3CC4S 3M8PB 2V4RA 3AA9A 3MR5A 1SIWB 3THPA 3Q2SC 1UZHA 2YTCA 4DPUA 2J0WA 3TZXA 3NWRA 2ZKTA 4OX9F 4IDKA 3LP1B 2YKOA 3G6VA 1D8YA 2MKCA 4PABA 3TA2A 3CCSS 4ZHRA 1FWLA 2QGFB 1HA1A 1QE1B 3HHLA 4HHUA 2JHEA 3SSSA 2OJ3A 1UPMB 4TU8A 4NA2A 4NCAA 3TI0A 2VKZG 1TL7A 3D6TB 3ELHA 3MM7B 3T6JA 4H4MA 3BQ0A 3POTB 5G0RA 3TJ9A 1CQMA 2GX8A 1XQIA 4RNMA 4XO0A 1LWXA 3HHEA 1FDNA 5U47A 4F26A 4B3TJ 3E3XA 1U02A 2DNQA 1VOMA 4KKOB 1U8SA 3Q86A 1PC4A 4J90A 4NRTA 4NWBA 1OQ6A 1IR1A 2OTJS 2XNRA 4H54A 2HLTA 3ONQA 3VAMA 1XJWB 1CVJA 3UNGC 4FVMA 4CLLA 4IRDA 2HNZA 1JIHA 1NAQA 1YTYA 3MAAA 2NREA 2CNKB 2HQDA 1FO1A 5JUMA 3IWXA 4OHYA 1GXUA 4LF5J 3FCVA 2FGCA 4W98A 4UW2A 3V6HA 3H5UA 1WI6A 1NSAA 5HP1A 1QAYA 2B9EA 3L3CA 2LKZA 3BGLA 2MKKA 2WK4A 4C3LA 1NB7A 2FJVA 4K8RA 1S77D 2AW0A 1N48A 3W9JA 2FVSA 1RT5A 3AOBA 3PNIA 2MZQA 3MM5A 3V81B 5K8OA 2PFFB 4ELVA 5BR8J 4MK8A 4RW8A 4Y2AA 2P2CB 5J2NA 1AROP 1HNWF 2XY5A 4IDKB 2QA2A 1JMTA 4CNYA 4I7FB 1FFWB 2HHQA 3PKMA 4Q44A 5HBMB 4CLTA 2V34A 5J1PA 2KH9A 4ZHRB 1VQ5S 1FRLA 2MKIA 4O4RA 2J9EA 3DNCA 2P6SA 3DKDA 2YPYA 1NO8A 3GONA 3R5BA 5A0YA 3FBFA 4FKXA 1VQNS 3CCQS 3VALA 4Q5VA 1YKWA 3DRSB 4GVLA 2PE8A 4A47A 5EHHA 3L95X 5A2QU 4CYUB 4RU2A 1KSPA 2V94A 4P2FA 4DOZA 3C16B 1HBUB 3H5XA 1SKUB 1M5VC 2CWXA 5KFOA 4CH7A 4USIA 2LEAA 4Y2IA 4B9NA 1CJKB 4QYZK 2L48A 5I42A 4ZPTR 2IY5B 4U96A 3PEHA 4O3QA 5C25B 1HWLA 2HNZB 2BRKA 4F67A 4C0BA 3HVWA 4A8FA 1EETB 2VICA 1S1UA 2AU0A 3F73A 3GYNA 2ZM6J 1S10A 1RWPB 3M30A 5HVGA 1UMJA 5H9FK 2QLWA 1M5OC 1FT8A 5ETPA 1HIYA 5L46A 4NLOA 1PYSB 2W8KA 2V9WA 1WG4A 1RTDA 1NSPA 1WF1A 2HHTA 5KG0A 3TYTA 4RKUC 3KHGA 2RIJA 1X9MA 3HVTA 1RZMA 3BSAA 4DR6F 1HBMA 1RT5B 1MG7A 3T5KA 3HSDA 3KUGA 3CDWA 1IQZA 3KTQA 4R8UA 2M9KA 1DTTB 1NDLA 2V4JA 5J2NB 2WONA 5KFVA 1F2GA 2V50A 2GC8A 1YSJA 5D0EA 4LFAF 2CJBA 1G1XA 4TLQA 3Q89A 1KP6A 2BA9A 2Z57B 3O8WA 2YPZA 2JNJA 3DRXA 5J2MA 2EKNA 2C2KB 1MMDA 3IR7B 1HBOA 3P3DA 3KLGA 4ZA1A 1C4CA 3PR5B 2MLZA 2PEBA 2ALYB 1YLXA 4DSIA 4KAIA 1FI4A 1ZAWA 1RAIB 1EARA 3OTEA 5EX0A 4U7CA 4DQPA 3IBCB 5DDPC 2HS0A 4C8ZA 2AYGA 1X31C 2EFNA 4M5DB 5AXNA 1L3SA 4KSEB 1FX4A 2CXEA 1Q86T 4J9UE 1CC8A 2PO4A 2GJIA 5EUHA 5I42B 2FY8A 1S1WB 1FXLA 1BWEA 2K1RA 2PFDA 5RUBA 4MKAA 3N6LA 3JSYA 5E3CA 1NJIT 2DYAA 2V5HG 2Y9HA 1MWZA 1CJTB 1URRA 4EO6A 3M2RB 1SC1B 4CRJA 4B3OB 2MGZA 5DLFA 4BCAA 3G8TA 3Q8VA 4ZJOA 2BJ3A 2HAFA 4CTAB 1RTDB 4JV2A 2YWEA 2XSJA 3A1YG 2VC1A 2OEKA 4BBYA 4ANEA 2ZNZA 4UOHA 3VQSA 3CC2S 4LSNB 1PG5B 3WDOA 1X4EA 3MEDB 4ES3A 4ZP9A 4DG1B 4X65F 1HBMB 1NJZA 2EC0A 3MEKA 3BO4A 2GQQA 2Z58B 3MM9B 4GVBA 3MF5A 5E5NA 3BDPA 2JJ4D 4MH8A 3FFIA 4QR2A 2LQ9A 5KFDA 2UV8A 4TY8A 3TR5A 4JYAF 2OPRA 3NEKA 4NA1A 2RVJA 2EFQA 3IN5A 2PA3A 3UFCX 1JLAB 2H54B 2LQ5A 5DZ7A 3P49B 2DRBA 2JOQA 4C11A 2IMOA 1O8BA 3PYEA 5H1SV 4NYZA 1X5PA 3GCXP 4U9RA 2XZWA 3NBPB 5J2MB 4WFYA 1Q8LA 3UN2A 2HLUA 2FJXA 2ZJPQ 3ULHA 4LF6F 4WK3A 4ECTA 1S0MA 3VGSA 1OSDA 3OVBA 3M6UA 3SCLE 3UNYA 3CCZA 3LP2A 5J1NA 4EU0A 3QLHA 2V4QA 1S4EA 1UVMA 4QWEA 3HHKA 2XY7A 3IRWP 5CYQA 4DL4A 4LQ3A 4USUA 4YB6A 2GGPB 3DC2A 2GA7A 2IM2A 1WORA 2IRUA 1NCLA 2ATLA 2XWYA 2V2ZA 2K1RB 2LU1A 2V8DA 5EWEA 1X5TA 1AZSA 3KUEA 2Y0SD 1WKJA 2DGQA 2LEPA 3BV8A 2OPQA 2HURA 2FUG9 1U1PA 3HKWA 3K2YA 5F8JA 2H5IB 3SXLA 4QBUA 1X4FA 3X1LB 1MWQA 3D3CJ 4JI4F 4CM2A 5CYMB 3MR6A 3EX7B 3VGUA 1NBEB 4A8QA 2PMZD 5KFZA 4DUYF 1QLNA 4DFMA 3RAQA 3W2VB 2CNNB 2VODA 2XSJB 4O0NA 4LF9J 2RRBA 3KHRA 2B6AA 2W2MP 3U1LA 4XPCA 3WHIA 2ZZMA 1Q79A 2YKMB 3G86A 5F8IA 1UVKA 2PI4A 2MHEA 4ES2A 4WXWA 4GVBB 1FD8A 1U8WA 2I6WA 1YJTA 3SFUA 3FFIB 4Y2CA 3UDEA 5E3PA 2EBGA 4TY8B 1NLKL 1R8CA 4A8OA 2OPRB 4C4WA 1SQFA 2XLIA 4UOGA 5EN1A 3DDIA 3W5YA 1NH7A 2MKJA 5KFXA 4DV2J 3L7PA 2ZBQA 3TRGA 2ROGA 3R5DA 4CNZA 2P6TA 3N5BA 1JKHA 5F3ZA 3FJ2A 2BM1A 4IFYA 2Y1LB 2KRRA 2V67A 4ZMMA 2IJFA 2KVIA 3KK3A 4LUBA 3QLHB 4LSLB 3KJFB 1S5ZA 1J5EF 3KLVA 5CYQB 1N32F 1S1TB 2GAHC 1YITS 5IM0A 1S6PA 4JV5F 5K14A 2GFFA 3K5MA 2K06A 3NKYA 3PO4A 5CHCB 1SKRA 3GTYX 4CO5A 2L3MA 2C3PA 3DLJA 1F5BA 3U02A 4X4TA 2OPQB 1X4AA 1JLEA 4IOCQ 2KL8A 1HPZA 4XK8C 4PWUA 1HD1A 1WC0A 2D9PA 2E1CA 5ETMA 3HF5A 1HNVB 2V6AA 1UTAA 1M5PC 2RT3A 3O6QA 1UPPA 2OKQA 3CJ4A 1N34F 1R8BA 2B6AB 4YB1P 3DGPA 3L4BC 3MEEB 3OPKA 2ERRA 1YJRA 1S7HA 2VKRA 1SIZA 2WSFC 2F3JA 2FLNA 3IFEA 3KHLA 1TZ0A 5GAHU 2M7SA 3FGVA 1WC1A 2QA4G 2CPEA 4F4YA 1YJUA 4NI2B 4JI6F 4K0KF 5KFCA 4P72A 4DR7F 3Q8SB 1LFPA 4MTPA 1WJ9A 1SC6A 3IG1A 3ENVA 1GX6A 5D4NA 3C6UA 3PJXA 4ITSA 2ZH4A 2OMLA 1OPZA 5DO2A 2Z56B 2Y8WA 4YY3J 2AJ2A 3I0RB 3M6XA 3T1HJ 2UXBF 4IFYB 4RU9A 1YHQS 2RDJA 1VQ4S 3QGHA 1J5OB 4QWBA 1U47A 1FFSB 2OMOA 3J81j 2A18A 4WKYA 1DQ9A 4YB7A 3PRVA 3UWTA 1S72S 2VL1A 1UEVA 2YH1A 4X4VA 3H20A 5IM0B 3CCES 1LV5A 2Z2LA 5HI7A 1GMUA 3AJ1A 2C1EB 2OLWA 4J9MA 2ZC4A 2RNEA 3KHHA 4ZVUB 2YY3A 2FHJA 5HMXA 1VQ9S 1VI7A 2CUYA 1RU2A 3OLAA 4OL8A 3C2PA 4DSLA 3PHTA 4RBVA 4YDXA 4USHA 3QIDA 3R8YA 2HW3A 4M5KA 1M0SA 2EPIA 1HNZF 4B9TA 1O0PA 3HFZB 4LVOP 2CPDA 4U7UK 1VRUA 3ZTRA 2ZOGA 5KFHA 4GRSA 4HT5A 2H51B 1PILA 3NNCA 3IS9B 4CWBA 4ATNA 4G1PA 4RW9B 2U1AA 1S12A 1NSQA 4B9LA 4PUOA 3KLEA 4DV7F 1D9FA 2R2SA 1R89A 4AFFA 2RQ4A 3IG1B 1IR0A 1VHFA 3OTDA 4BWJA 1XMQF 1X0FA 2ATCB 3GIKA 3SSQA 2QYCA 4C97A 5I4MA 4OZ1A 3KMQA 1N33F 2QMXA 5B7WA 4DR1F 1APSA 2XMTA 2YWKA 1BQNA 4JOUA 4IUFA 2B3TB 3H8YA 2W8LA 2BKOA 3VV2B 4W92B 2LP4A 5IWAJ 1F5CA 4RLEA 3DM2A 2L9WA 4O3RA 1TVRA 4N41A 3OJSA 5T14A 4OV1A 2U2FA 4LBIA 4QIFA 1CJVA 2VG5A 4JI1F 4B3SF 1UJ4A 1UA0A 1DRZA 2V63A 4DR3F 1A6LA 1ZS6A 1MSWD 3WX8A 1F60B 5L1JA 1RACB 4X64F 4RW6A 2MXYA 3RAXA 2LDIA 3DRRB 1RHJB 2BW2A 1WEXA 3OSPA 1M5HA 2H5JB 1RTJA 4FS2A 4ZLNA 5DDRC 3S01A 2XB2D 2D9OA 1OMSA 3CPWR 1N0VC 3QGIA 5LMNJ 3CJ8A 3A8KA 2I2YA 3KLHA 3KJVB 4DFKA 5ETKA 3JSBA 1GTHA 4RPFA 2CA9A 4LBPA 1IWGA 4NASA 1RE1B 5F8HA 5F8NA 3KLEB 2HNDA 1FFGB 3Q8RB 4YHHF 4J9QA 1YDLA 2KVQE 3R2DJ 3NG8A 3IMQJ 4DR4F 3ILJA 4OX8A 3QBCA 4ILRA 3UCUP 5C24B 5ETSA 1Q8BA 1U0HA 1RT6A 2KXNB 1V3RA 3LUYA 4NEYA 1IKYA 4DSEA 1UWBA 4WXOA 1A7GE 1WC6A 2GZOA 3HT3A 4H4KC 1L3KA 4G6VB 4J9NA 2WVDA 2HVIA 4AXJA 2BDPA 2QO3A 3RBDA 1D0EA 2RUGA 5A76A 2XLJA 1VBYA 4DL7A 4ZIVA 2J0XA 4X62J 4OLOA 5HMZA 2LA6A 4FBTA 3GE9A 3GFYA 3A8EA 4DR5F 2DXFA 2VG6B 1U09A 2DCLA 2YKQA 3D7SB 2DISA 1U1LA 1H6KX 1OQ3A 3K0JA 2NPIA 4K59A 1N5QA 1Y5LB 4QIVA 2VG5B 2W4PA 4U95A 1RHUB 3M8QB 2MQLA 4A48A 1DQ8A 4TLRA 2CPFA 2YNFA 2UUBF 4HTIA 5DQIA 4NYPA 2YNHB 7FDRA 4RW6B 4ANDA 4WWSA 1DQAA 4UF4A 2JRSA 1OWXA 2KG0A 3J7ZT 2E5LF 4PQAA 5DDOC 2AD9A 3UVJB 1HWIA 1H2VZ 2R7QA 5IT9Y 1RT7A 4F25A 2OAUA 4DFJA 1OY9A 5KT6A 4Y65A 3LGMA 3Q0AA 2DEJA 4A8MP 2NXNA 2DGSA 1R8AA 5KG2A 4JBCA 3VWSA 1FE0A 4B3RJ 4WU2A 3AB2B 5D3GA 1R8HA 2I0XA 5BYSA 1O6XA 1YBAA 1HMVB 3QSIA 2UUCJ 3EGZA 1FEHA 2C42A 4IO9Q 4NLQA 4NXMJ 2QYGA 3TO8A 2B5JB 4MFBA 2IM3A 2D7SA 5A8RA 1PJ5A 3TAMA 5LMUF 3BKTA 3JS9A 1DTQB 1S0NA 1UWBB 3F44A 4J37A 2UXDF 2CQ1A 3H4DA 4C0OC 4KO0A 4F4XA 2UUAJ 4PXCA 3TARA 5IQQA 1RWNB 1U1OA 4RUAA 3KK2A 4DU7A 2IM1A 2WZ1A 1Y3JA 3KWMA 1P9QC 3PHEA 3I0SB 1F0XA 1LK7A 1VDHA 2HHPA 2HS3A 1RK8A 1IXKA 1EIYB 2DNHA 2BE7D 4ZPCA 4I1TA 2W9CB 2M3DA 2H5EA 3P4UB 2BABA 2MSSA 2FQQB 2HNYA 5AJ3J 5C2GA 1U26A 2GO9A 1CULA 4RUHA 4KHRA 4ECZA 1GK8A 3AJ2A 3IGNA 4AL6A 2MPUA 4F3MA 3TEHB 1JLQA 4EBCA 4TYAA 1ZTWA 3BQ2A 4XTTA 3QGGA 4DUZF 2XMJA 5C42A 3M8RA 2W7AA 2XZTB 4D3HA 5KFKA 1K1QA 2RQKA 3NGRA 2MY8A 3ZFVA 3UCGA 3NGDA 3M6WA 2A6MA 4OI1A 1FRJA 2CIMA 4J9PA 5HK4A 4WP8A 1Q53A 3RTVA 5K8NA 2J0SD 4ZLLA 3G2XA 4RBUA 5K8PA 3AA8A 2UV8G 4L75A 3JYTA 3R6GB 1S76D 4QW9A 1S1VA 4MJKA 1IKXA 3DN9A 5KFTA 3W9HA 5AXKA 4OJ3A 4O0IA 4ECVA 2BE9B 2BQRA 6FDRA 4USVA 4ZIWA 2CJYB 3QT6A 1IBMF 1M1KT 3TUZC 2BJEA 2CKWA 3CCTA 2HFUA 1URNA 3DGVA 2WSCC 3EYZA 1MROA 3S6EA 3TAMB 2Y1RI 3D4JA 2AX0A 4NL5A 4KPYA 2ZH1A 4C8KA 3A3OB 3D0HE 3ETMA 4JI2F 4EYHB 3AXKA 2HFOA 4NLSA 2UXCJ 1R8PA 3IRXA 1K0TA 3KLFB 1U6ZA 3BREA 1N54B 4ALZA 3R3TA 1N5TA 3NNAA 2KTQA 2MQMA 4X4PA 5IS2A 4NLXA 1RAJA 5L38A 2HWIA 3MCOA 4ECYA 1KS2A 2KXHA 4WFXA 1XC9A 1Q8IA 1FX2A 4E8UA 1HQUA 1RUSA 3D6HB 2O3DA 1RAAB 4CP5A 2IDEA 2NZ4A 3PRBA 2E5HA 2DIUA 4E98A 1RTZA 2CQDA 3SDEA 3QATA 3IAM9 4KIAA 1K1SA 3W8PA 4V19J 1V3SA 2XMWA 2ACYA 3VAGA 3EWGA 3OHAA 4M95A 1JLFA 3D9BA 2VQEF 1WG1A 3FBCA 3HVRA 2CQBA 1U45A 2JEJA 3V4IB 4CO0A 1JLBA 3ZZTA 5HLFA 1J2VA 1SV5B 2PSZA 1SH2A 1HI1A 2RD5C 4CT8A 4DWIA 4URSA 2DITA 5DQGA 3JYTB 2XMKA 2AT1B 1ELOA 4PRFA 2UU9F 3CUNA 4NZ6A 5CZVA 1HNXF 3CJKA 3PR4A 4LFBJ 1U6BA 1AYEA 3D54A 2ZD1B 3HJFA 4ANCA 1SKSA 1R6YA 1AB8A 2B9XA 3OQ2A 2R7WA 4ID5A 4UUWA 3UPFA 1U25A 1N36J 4A8YA 2JDJA 2W2OP 2ZC3A 1MROB 3RBXA 2DBBA 3GIJA 1KHWA 4F4WA 1VLOA 1IBKJ 5KT3A 3QT5A 1RJJA 5DG7A 4UOFA 4NLTA 1B7YB 3KDOA 4JI0F 4L3KA 4ZVFA 2GW8A 3DLGA 1KLMA 2XGQA 3G71S 2CQ4A 4WKRA 3SI8A 5LSRA 1AT1B 4JI5J 2UP1A 1FNOA 3U7JA 3PKYA 1H2TZ 3KG1A 5A8KA 1HI0P 8AT1B 3LP0A 4G3IA 1CEZA 1E6YB 1MN7A 5EDWA 3HFKA 2IRYA 2MLXA 4Y3CA 4OYWA 5F0UA 4HI1A 4A4JA 1TU0B 2IA6A 1B0PA 2FGOA 2IC3B 2MSTA 1LWEA 1I51B 2BYCA 1ICEB 2F8EX 1RWMB 5E3RA 2YKNB 3S8SA 3PX6A 4K4WA 1S59A 2XMMA 2ADCA 4MKVA 2DCUB 2DXDA 1M90T 2MKHA 2XM3A 1NHUA 3MOJB 3TQ1A 4DQRA 3GQCA 2FDNA 3HCXA 2Z30B 2BV3A 3OTBA 4C6AA 1JLBB 1OO0B 3KK1A 5FDLA 3K5LA 1UW4A 2NUHA 2LQ8A 3L7UA 1Z4UA 4M8LA 2LXUA 2YVSA 2KXFA 1F1BB 4ZP7A 2KJWA 1KVJA 1UL3A 1ZBTA 3HHNB 3CJKB 4ED6A 3N6MA 3TVZA 1RYRA 3DI6B 2G1DA 2J7WA 3BGRA 3H98A 1RCOB 2LA4A 3OL8A 2JFDA 1RU1A 2DIVA 2RDIA 4ELUA 1YK9A 2CDRB 2DGVA 2OGUA 2QG9B 3CTRA 4OI2A 2HQGA 2KZZA 4PPZA 2GIRA 2YWFA 3BH7B 1TAUA 1HKAA 2EG2A 4DSKA 1X60A 1PYOB 3I87A 2K3IA 3QGPA 4ZN1A 4WZQA 2HHHJ 3KLIA 1Y11A 3I96A 4M5IA 2R2UA 4KGXB 1VQOS 2HVDA 4QW8A 1C1BB 1TKTB 2R7XA 2B43A 3HI9A 5J2PA 3V6DA 2DB1A 5H9EJ 4DV3J 3I82A 2OP5A 1FNXH 2COLA 1RB0A 3R5AA 4ED1A 3NOGA 1SQEA 2YKAA 1WF2A 3W65A 4DS4A 4GKKF 2QL5B 4UT4A 4F4KA 4Y34A 1X0PA 2GVDB 4PQUA 2DR6A 1UAWA 3ZNUA 4DCOB 4NLPA 4WF9Q 1VQ8S 2B51A 5KFQA 2R7TA 4JI3J 4YR0A 4NMXA 4LF8J 3LAMA 3OVSA 2R3VA 5D4OA 3MEGA 4O4GA 3R27A 3GMGA 3GV7B 3AB4B 4LF4J 4Q0BA 4ZVTB 3KK1B 4LVNP 4QIGA 4O3NA 3MM8B 3BGFA 2WSEC 2NYHA 4ELTA 1LW0B 5LJ3Y 1IKWA 3BR8A 4C8YA 3SV3A 3EUNA 3V4MA 3DOKB 1KVKA 4ED2A 3AHPA 3VAIA 4FN5A 3K89A 4X66F 1KBRA 3HM9A 3DXSX 4L72B 2HIYA 4DEZA 2YXLA 3MR7A 3V2UC 3RGIA 4A8SA 2YNIA 5GAEI 3MD3A 4NPOA 3CC7S 1FRHA 3BN7A 4N8OA 1HR0J 1KLNA 2PC6A 2GMJA 4QWCA 1EHWA 1NZAA 2DT9A 3US5A 1RCXB 3M9MB 2HHSA 3W64A 1ZAVA 1F5AA 5J2PB 3OHBA 4IG0A 1D8ZA 3QJLA 1TV6B 4AQYF 4LF2A 4Y00A 1D09B 1RWVB 1NK6A 2J7UA 3DOLA 3ISNC 1K0VA 4EEYA 1PSDA 4TYBA 4JI7J 1F6TA 2YKPA 3M4XA 4LR8A 1HWJA 3SEOA 2HIQA 5F8LA 4PQUB 1PYTA 4NLVA 1M1GA 1ZZNA 1FRKA 3HMJG 4KH1B 1OJ4A 3QIPA 4OIXA 1QUVA 3DHWC 3M8ZA 4Q0BB 4WP3A 1VMBA 1JLCA 1SL0A 3O5TB 4KGKA 5KT7A 3CO0P 3OR1A 2HGLA 2WOMA 3QO9A 5EWFA 4DF8A 1HHSA 3EXCX 1IKWB 3MHYA 1HNIA 1WHVA 4F0MA 1Q5YA 3L9ZA 3CNQP 2I38A 2R8GA 2L08A 1RI7A 2FY1A 4DX5A 1WNEA 2DGUA 5GMDA 4OZNA 1LWCB 1FJGJ 1A9NB 1ZOTA 1HYSA 2LQBA 3CD6S 5C5JA 4WFBQ 5K5MA 2YX4A 1BQMB 2QE5A 1Z2LA 3HD1A 4R5PA 4PG8A 1UZDA 5DQHA 1FDBA 2XHCA 3PW0A 1IWAA 3EZOA 2QLBB 3FQKA 1S97A 1SJ3P 5HATA 3SZ2A 2NCKL 4DV4F 1S9GA 3D66A 3MR3A 3UR3C 1JLGA 5DJBA 2JEIA 2OPSB 4IG0B 1FK9A 1GT8A 5EX3A 1RT4A 2VOPA 3QT7A 1Q7LB 4DV5J 2BVZA 1EJ7L 4ED7A 1RISA 1NK4A 3C19A 3ET6B 4UY8T 3CCLS 1B3TA 4LFCJ 1SVDA 2A2CA 1UVIA 2AIRB 4DLGA 2CQCA 2WW8A 1B7FA 1TUWA 1LWFA 3EGVA 1D9DA 2HGMA 1XNQJ 4CLUA 1EKSA 6AT1B 1FVQA 3OR2A 4RW4B 5HROA 1T3NA 3I4PA 4F02A 3QIPB 3TWZA 2KG1A 3CSKA 3HHDA 1WTFA 3MPYA 1G2EA 1REVA 3W7BA 3MMBA 2MQPA 2G0IA 5DGAA 2RRNA 1F9FA 1P27B 3OR1B 5L9NA 4URGA 2AEFA 4CCHA 1B0VA 2JZ5A 2DY1A 2AYBA 2KM8C 2IVMA 4IFVB 3ZTOA 3VZHA 1TKZA 4Z37A 1NHKL 2VPXB 2EFVA 1WHWA 5KFAA 1YZ7A 4GC6A 2GAGC 4RWXA 2F65A 4USJC 4J9KA 3F41A 3R7SB 2VONA 4PWDB 4B3TF 1QVFR 2QTWA 5FLXU 1CQNA 4RO0A 1FWPA 2J9DA 4NMLA 3MECB 2R8KA 3WIVA 4ZLPA 4KE5A 3H2VE 4WTOB 1TQLA 2QZ8A 3RW6A 2ILZA 3FBBA 1ZH5A 1RT1A 3M32B 1ZM2A 1JJHA 4ZVGA 2AJ1A 3I32A 4N56A 2XI3A 3D1QA 4DHVA 3RRKA 4J9VA 1BE4A 3FEZA 3QWPA 4IRCA 2J7KA 5F0WA 3J7AN 1SQGA 2DHGA 1N0UA 2HQIA 3IBWA 4FZVA 4DQSA 4P9SA 4R0EA 2DNNA 2F4VJ 1Q16B 1N6QB 2CQHA 4LF5F 1RTIA 2EFOA 3MTKA 1RT4B 5KOXA 1S79A 4QWDA 2V8VA 3B8HA 2F63A 3UD4P 3IXQA 2VU5A 4B3MJ 4P10A 4DV1J 2HVHA 3ADAC 3TX8A 4OYOA 5T7LA 2AF6A 1SJFA 2CPJA 5BR8F 4O44A 3R6LB 5KOWA 2MYFA 1LXJA 3C6TB 3OR2B 1VRTA 4U8VA 2HRTA 1WDTA 2QRRA 2C3YA 4EYIB 4ZLJA 4DZ6A 4IG3A 2M2BA 5FLXY 3VAJA 3MMBB 1VBKA 2ZE2B 2N4DA 2BKNA 2UVVA 3NNHA 4PYDA 1Z1ZA 1FTCA 1N88A 2ZOMA 1XR5A 3M8PA 4B02A 2ILYA 4KH0B 2KT3A 4Q8FA 3G8SA 1HBNB 4LR7A 1DARA 2AMCB 1TL4A 3LP1A 1FJEB 4OZ3A 4YOEA 1X4DA 4F36A 1J27A 1ROFA 1SJ4P 4TN2A 3Q23A 4HDGA 1U0SA 2DNYA 1QSSA 3W62A 1QE1A 3T6BA 4ZVPB 3MM6B 4OYAA 2W25A 4F3OA 4G65A 2JEFA 1Z2ZA 4HR2A 1SBRA 1P8GA 2BANA 5LOQA 2B8QA 5E33A 3MM7A 3SBMA 3POTA 3IA0A 3DDNA 3EZUA 4IO1A 3AXMA 2W4DA 4PZVA 1FEEA 1UKUA 2FC8A 1KTVA 1B64A 3B4MA 1S4FA 2F9JA 2ZM6F 3R5JB 2RSQA 5HVHA 3GIMA 4KKOA 3SSRA 2FHOB 3ENAA 4M5NA 4BDPA 4YUDA 2OEJA 2AJFE 2PMWA 1F9HA 1Y5IB 3ZTQA 3W2WB 4BWMA 2BRLA 3CJTA 3N6NA 1DFDA 3IO1A 1NRKA 2JFKA 2QEXS 2RE1A 2WCXA 3CCRS 2IFXA 4KR0B 3AD7C 4ED3A 4NCGB 3CJ3A 1OYDA 4J9OA 5T7LB 2QA1A 2V9KA 5KFMA 4CDIA 3SQGB 4HH0A 4P71A 4DPTA 1SXLA 1FD2A 1PJ6A 4NYOA 4RUCA 1VRQC 2K7KA 5A8WB 1Q81T 3DU6A 1U48A 4FPRA 4M63A 2NZCA 3LH2S 2DNRA 1S9FA 2RDDA 2PGCA 3W61A 2MEWA 2K2PA 2NSCA 3V81A 3BN4A 2G2OA 3CCWA 3R5CA 3EDRB 3EVWA 4NZ7A 4PG7A 2RAQA 5GAHI 2R8JA 5GADU 3OVAA 2XY6A 2I5JA 1LQ9A 1Y9OA 3PIOQ 3W9IA 3O44A 3GFHA 4OI0A 2R42A 4I7FA 3T5HA 1KOHA 2BQUA 4QU7A 5HBMA 3JB9k 3JQKA 3G9CA 2ZHOA 4Y6IA 3GYXB 1KRPA 4RJVA 2GQCA 5DM6Q 3R5GA 4RBTA 2VPYB 2BANB 2JC1A 1IKVB 3IBFB 4H4OA 4WP9A 2DNGA 2IVYA 2QT7A 2WBMA 3DRSA 5DZ6A 2BMBA 3EDQB 2P9GA 2E1AA 3PDNA 3RB3A 1NSKL 4MAKA 4CYUA 3M8WA 2E5LJ 3GR1A 2Q1LA 3C16A 1HBUA 4W4MA 3MZIA 4ZCMA 2NSBA 5A6PA 3HJVA 5SZTA 2FLOA 1NHVA 1CJKA 4DCJB 1BGXT 1U49A 3H7HB 5C25A 2ZHBA 5B0GA 4BC7A 5F41A 2ZFHA 1EETA 2MTLA 3DLEB 1VYAA 1V5VA 4WIIA 3CJSA 3PX0A 1WTBA 3OTOJ 4L6V3 3BGOP 3R9LA 2OHDA 1GTEA 3WZ0A 4P73A 2KFYA 3IC1A 4P75A 3B54A 4J91A 2WB1D 3HFVA 2OPPA 3KXDA 1BHNA 4YEAA 1VQKS 2IBOA 4FXDA 3UDLA 1LKZA 3NGSA 1FESA 5LSLA 3QQCD 4F3QA 4ZVQB 2CQIA 3HX9A 2MJNA 2AQ4A 3E01B 4FYXB 2HFSA 2YQ3A 1NM2A 5KFJA 2CG8A 3QNWB 1DTTA 2DHHA 2C2OB 3M05A 5D0GA 3JXOA 4GO7X 3PYFA 1RADB 3DYAB 2OTLS 4PEOA 2I5JB 4QU6A 1S48A 1NPKA 1WG5A 5GMEA 3BF4A 2UVWA 4OYXA 1RT3A 1TKDA 1XR7A 4OYMA 4NRUA 2C28A 5BYQA 1RAFB 3JSMA 2Z4PA 3MPDA 3I5AA 2QV6A 2DRDA 2DH7A 3H40A 1G6BA 1P9YA 4H4OB 5GAEU 4DV0J 3EVOA 1XNRJ 1I94J 3T1YJ 3HSGA 4WBFA 4DN0A 5CXTA 4J9SA 4U67Q 2DO0A 2ZUAA 3W8GA 1JQGA 1O5JA 4RX6A 1T9XA 1RABB 4IQXA 3HD2A 5M2PA 3DCAA 2OH2A 4F4ZA 3D68A 3PG9A 4M5DA 3NLCA 3M8SA 1TL3B 1B70B 2J8AA 1ZPWX 4KV8B 2EXUA 3IR5B 1GFWB 5IC4B 4QOTA 2RJZA 2M5YA 2DNMA 4HHJA 1S1WA 1H73A 4WZMA 3HHLC 4LF9F 2CYYA 3MPUB 1CSJA 4EWTA 4N77A 2G9OA 2DHSA 1CJTA 3AQPA 3M2RA 2D3ZA 4B9MA 4B3OA 3VF0B 1RAHB 2HYIB 2BOPA 2L9NA 2R2TA 2OPPB 4G1QB 4CTAA 1TUGB 4R0JA 4ICLB 3PZPA 3FDSA 5F8GA 4USWA 2GV1A 4F0KA 5L1LA 3GJRB 3FQLA 1XMOJ 3FNNA 3MMAA 4LSNA 3MEDA 4DG1A 1H74A 4HL9A 4DV2F 4NZ0A 1NNDA 3MM9A 5J2QA 4O3SA 4ZVHA 3MFIA 3IAS9 3CULA 1BC6A 1FDAA 2BE2B 1JLAA 4LF7J 4ILMA 3GJQB 4JI8J 4OZJA 1RT3B 1IBCB 4DQQA 4LT6A 3AAWB 2WVFA 1MU2A 2LXFA 3NBPA 3F56A 3JSMB 4ZVOB 3KNAA 1S9EB 2BXJA 3VCDA 1C4AA 5HQ8A 3WX4A 1FERA 4X4NA 4LBHA 4HACB 2DY9A 3G96A 2DO4A 4LSZB 1Y5NB 3EGWB 4WE1B 4C98A 4Y2KA 4OX7A 2AZ1A 2J9DE 1UCNA 3UO0A 2GGPA 4MK7A 3D28A 3DMJB 4ZK7M 1WKLA 4WU3A 1KQFB 3THTA 1M5KC 5AXMA 1FHTA 5CYJA 3HK2A 4ED8A 1SI9A 2J8SA 4AL5A 1C0TB 1G3OA 5IOLA 3N4WA 2R9LA 2HMIA 1HFEL 4PWWA 3IWNC 1XK8A 1AFJA 1X4GA 4OHVA 4DV6J 5CD4A 2GJ2A 5IT4A 4ZVEA 2ABYA 5CYMA 2MKYA 4R25A 3CE8A 4K4ZA 4L76A 1VK3A 1K73T 1I6JA 4ZCKA 1T7PA 3SFGA 4XAKA 3BKUA 3W2VA 3NMAA 3UQSA 2JX2A 3VHQA 4LF1A 3AOAA 3MMAB 4C8OA 2YKMA 3Q8UA 1X5SA 1NK8A 4DPWA 3A3PB 2UZAA 1RBLA 5J2QB 1YBTA 3IWLA 3W63A 4EGLA 1KDNA 3LGHA 4JP8A 2R7VA 1RAOA 3UCZP 2QA4S 4YY3F 3C3LA 4OHWA 3T1HF 2JLEA 1H2UX 2MZTA 5D77A 3TW0A 1IR2A 3QZ8A 1SH0A 2IDLA 1MU2B 5CQGA 1CBKA 4ZJLA 4NXNJ 3I31A 4YDDB 2KYZA 3CD5A 3BZQA 1N5SA 3C66A 1C0UA 1REGX 3V5RA 3GU0A 1X4CA 1EKRA 4Q2MA 1V9OA 4IQMA 2E1MC 4KGZB 4U8YA 1VBZA 4LSLA 2HKEA 2JL9A 3TEGA 5J1EB 5HMYA 1M5SA 1S1TA 2E66A 2OIHA 3QT8A 4KPCA 3I6PA 3TJAA 2D3UA 2PN6A 4YP3A 5KFBA 3ZZ0A 2A10A 4NLGA 1LXNA 1S7IA 4TU7A 2JC0A 1XN9A 4DUTA 1T95A 2YX7A 1JJCB 2FJEB 2HMIB 3GP9A 5IV4A 2IHR1 2IM0A 5E0OA 4DR2J 4EBEA 2M88A 3CWJA 4AUKA 3QWUA 2H48B 1QSLA 2EC2A 4ZPWR 3GG1A 3HSJA 1R27B 5ETQA 1HNVA 3CCMS 3LOUA 4OI4A 1PBUA 3CDBA 7AT1B 3MEEA 4CIOA 2DD8S 1HWKA 2KM8B 2QSWA 3C14B 1TKXA 3ZZRA 2HAIA 3N01A 1RKIA 3N0VA 5HQMA 4JV1A 4YN3B 2DPJA 3ZC4A 3CW2C 2EFPA 3Q83A 3BH6B 2E29A 4DSFA 2DK2A 3RR7A 4NI2A 2C2ZB 5CCMA 5D8HB 3NP5A 1JK9B 1U6FA 1VC6A 5HN0A 2IBKA 1WF0A 3G82B 1IBLJ 1T9WA 4Y2MA 3CCVS 5B08A 3M1VA 2D3OR 1NDKA 4X4UA 2WRMA 3PRDA 3ITHB 5IWAF 1WKKA 3GPAA 2JVRA 2QLJB 2KN4A 4WIQA 2VQFJ 3I0RA 1C1CB 1C0UB 2AYMA 1FKOB 1ZYQA 2ZBIA 1J5OA 1EP4B 4M5JA 1YRUA 1UJ5A 5M2RA 4CO2A 1FRIA 1FCAA 1R3NA 4ZOSA 3CVKA 3M9NB 2LU2A 3A13A 4V19X 1YI2S 1UW9A 2CG4A 1VBXA 4FYWB 3CJQA 1A0OB 2QL9B 4KFBA 4ENOA 1RLCL 3TAQA 4FF3A 5C7PA 4ZS6A 2KZMA 1LNQA 4MKBA 1ZA2B 5LMNF 1XWLA 2OUGA 4NLRA 4ZN3A 3OFEA 1TK5A 2KFNA 2IJRA 5AT1B 3OBIA 1X8DA 4RUBA 2JLGA 4C7QA 1DJ0A 1KN6A 4KJIA 4CO4A 3H42A 1JB0C 3U1NA 2J76E 3Q8QB 2HHXA 2G4BA 1OIAA 2QL7B 3VAFA 1YRXA 5FD1A 1NJXA 1LW2A 3IS9A 1TKXB 4DX8H 1V6HA 5L39A 4FYDA 2V8HA 3J7A1 4RW9A 4RNFA 5D15A 5JVGQ 4BHQA 2KI2A 4ZP6A 4QIWD 4HYKA 4I4BA 4AYBD 4DJBA 3C15B 1GMVA 2XS7A 2GHPA 2PIIA 2FJDB 2CQ3A 2NXCA 3TJ8A 3M1VB 4X62F 2C2RA 5L1KA 4Y0FA 3NCPA 3GZ7A 3S1TA 1YX2A 2M0GB 3AJDA 1CS4B 2RQCA 3CMES 2QLXA 1WHYA 1HHQA 2G0JA 2ZBPA 4ZVRB 2NR0A 5LM7E 2NXUA 1N8RT 3J80Y 2EVZA 2W9BB 1YJNS 4I2PA 1Y4ZB 2YNGB 4RZRA 2P9EA 4C8MA 3G6XA 4K5RA 2CJXB 2JEGA 2XMAA 4CLYA 1PJ7A 2LMIA 4BS2A 3PTWA 2HBYB 4ZCIA 5KT2A 5F8MA 1U2RA 4KFBB 3MAQA 2FIUA 4CT9A 1SL1A 3IGVA 3MCSA 4X4OA 1RGVA 3LGNA 3IP0A 4QZVB 2XYGB 3JAMU 1ZM4A 2B4PA 3ZZUA 4WJBA 2DTJA 2HHVA 2EKYA 2N3OA 2Q43A 5KFYA 1X7VA 3PEJA 4ES1A 1N56A 1GEHA 2VDHA 5IV3A 3BBBA 4A8XA 1FDDA 3DRRA 2KYXA 4KHPJ 1HW8A 1TL1B 4G1IA 4B3RF 2BW7A 3O3LA 4OHZA 1U1MA 2XO6A 3SMZA 2XNQA 3QSYB 2JH3A 5CD4H 4DL5A 2UUCF 4U7UD 1WHXA 1T9UA 1LW2B 2OSRA 4B08A 2RMLA 4NXMF 2BACA 1VHIA 2BR0A 3KJVA 5BXIA 4OJ1A 2X1FA 1KWMA 1MNEA 3TAPA 2QFIA 3NWGA 3AT1B 5I3UA 3CDEA 5JMNA 3ZNJ1 3I56S 1RWXB 4ER8A 2XYPB 4KRWA 3M7VA 2UUAF 5KFPA 2CQ2A 2EG1A 2XI2A 4UZCA 4YR2A 4KQZA 1QTMA 4MIBA 2IJNA 1SL2A 1XIQA 2GO8A 2KFZA 1HQ2A 5C24A 2QN6B 2RS2A 1QSYA 5KG3A 3I55S 2ZH8A 2YBVA 4AL7A 4Y28C 2RILA 2IYIA 1KVIA 1S6UA 4KGVB 3VAKA 2YH0A 4K4UA 1WOOA 3JAMY 4RNOA 3CIZA 3TA0A 5AJ3F 1SKWA 5IQ6A 4JV0A 2HPUA 4Q2LA 2FYXA 4O3PA 1DAXA 4I2PB 5F9NA 2XS5A 4HTJA 5G4DA 1GQEA 2KDOA 4F2RA 4PG4A 5ITHA 4J7CA 1H7WA 2W01A 2H3EB 4RL1A 1JXEA 2VG6A 3T5JA 3RU0A 1UP1A 2ZVSA 3EPGA 2XMUA 3JTNA 3UN5A 1FTRA 3R1HA 1WD6A 1NPRA 1TMMA 2CQ0A 2RKIB 4AE5A 3M8QA 2Q3PA 4WFNQ 1HL6A 3HZEA 4QWAA 2YNHA 1AUDA 1QDUB 3RYLA 1VQPS 1SJQA 4AD6A 2VG7A 3B82A 3OFFA 4RWWA 1I3OB 4PXEA 2JLFA 3BM7A 3HLUA 3NGUA 4IOBA 5LL6d 3UVJA 3LF0A 1T05B 1RHKB 2PDAA 2KRBA 3BKFA 1QVGR 3MTJA 2V68A 3M2VB 2OELA 2Q6BA 4NLDA 2GS8A 4KTQA 1D3WA 2IIHA 3QJPA 2HHUA 4GMKA 4Z7YA 3NCRA 5I3UB 3MUMP 4USKA 2VBWA 1RTHA 3HZGA 3MR2A 1LOUA 1Y3KA 2UXCF 5BJRA 3VQTA 4X4SA 3GLJA 1HMVA 5BYRA 2GCFA 4TXSA 1Q7YT 2CJAA 3PXGa 3PJWA 2WVBA 3RB4A 1WSVA 2B5JA 4I69A 5IT9U 2MZRA 4KBIA 3P96A 3P5TL 3JTOA 1DTQA 1R6VA 1RWKB 1OS5A 2CADA 2JWNA 1NDPA 5DDQC 1XERA 2Q66A 2MQNA 4B9VA 1Q78A 1TL5A 2HWTA 1NU4A 1N5VA 3I0SA 2Y8YA 4I67A 1T8EA 2ADBA 2AWZA 3GIRA 3HHLB 2FVCA 1RHRB 3RJMB 5I3PA 3OSNA 2W9CA 2BJ7A 1YWXA 4WK1A 3SYZA 3O1LA 1RA6A 1TL7B 4USMA 3HSZA 3B4DA 2FTRA 2DJWA 4H4MB 3PFOA 5G0RB 3SCIE 4Q43A 5EWGA 3J7Z5 3ZXWA 1TMJA 1JNRB 4HHHA 3JQJA 2PI5A 4CLFA 5LXRA 3GG0A 4LFBF 2Q6CA 2VG7B 3MAHA 4IR1A 4HDHA 4FF1A 2CPYA 1VK8A 4CH0S 2AGQA 5FJ4A 3HKZD 3K5NA 3GSDA 1N36F 3Q8PB 1JWWA 1NH8A 2DNZA 3G87A 3BSCA 3MAAB 5HSPA 5ETLA 2HQFA 1PGZA 2KU7A 1IBKF 2HFZA 3ZZOA 2ZITA 5HAOA 4C3MA 1RTHB 2QJ3A 4EBDA 4OZLA 2P9CA 4IKAA 3EZ5A 3G6ES 2FJBB 1IJFB 4HKQA 5HP1B 2WVEA 1GX5A 3ZO7A 3P5BP 3K8VA 3U27A 1XEZA 4JI5F 1RWUA 3TVYA 3FCHA 3PX4A 3OUYA 1EQMA 4KB7A 3MM5B 1K8AT 3LQVA 4MYUA 3R97A 1UVNA 3KJNB 2R4FA 4RW8B 5D6GA 2XZDB 4J5OA 2CJ9A 3N5FA 5HJYA 3H59A 1Q8KA 3LWMA 5A2QY 4FF2A 3H5YA 3KLFA 4LQ9A 1VQ7S 1V3ZA 4C8LA 2GHVC 2HFVA 1QM9A 3QRRA 3LANA 4NOHA 2QSFA 1MW7A 3MDFA 5A0YB 1DZ5A 2LECA 3NGKA 3HPOA 3CDUA 3AY0A 2ACMA 4PG5A 2N7YA 4OI6A 4OX9J 2ZH3A 4NCBA 1SH3A 4F4AA 1Y00A 2DNOA 5KFSA 1Y7PA 1H98A 3EPIA 1Q4RA 2MZSA 3J81U 4DN9A 3KUHA 1BMQB 4CM0A 3VVTA 3CCJS 2F8MA 2VH7A 1KTQA 2A6OA 5IXUA 3V4IA 1SV5A 2E1RA 1S1UB 2M8HA 2Z2ZA 4DS5A 3MPVA 2V2KA 2R2RA 3OW2R 1CG2A 1RSCA 4WYWA 1PIEA 4OYIA 2BJ8A 2PD1A 3M30B 1XBWA 2SXLA 1NK7A 4IRKA 4FPIA 3CO9A 4LRDA 3K58A 4OZ0A 4C48A 2ZD1A 2FHKA 3RG6A 3VR1A 4LIWA 2HHHF 3QAUA 2ZOFA 2BUNA 2A2DA 3HVTB 4KHMA 3OUYB 1BWVA 2O5DA 4ETXA 4DV3F 3I5BA 1LK5A 2HZAA 4OZ2A 2C3UA 5T41A 4R8UB 4QR1A 3UR0A 3PW5A 2V4JB 2WONB 3CCUS 1PAUB 2W2QP 4EO8A 5CZXA 3ETOA 3TP2A 1KHVA 3J81Y 5ETNA 2CFXA 3KDNA 2FVPA 4ERDA 2VA2A 2Z0GA 3TX0A 5D78A 4JI3F 4CO1A 1HBOB 3KLGB 1E6YA 4LF8F 4B9UA 4CLKA 3VVUA 1HNWJ 4IOAQ 2CPZA 4LF4F 3EVMA 5B0FA 1WC5A 1KQSR 3LA0A 5HVFA 2IC3A 1IJEB 2Y1IA 3B78A 5A6WA 5CAAA 3PW4A 3CJ5A 4X2BA 2AJ0A 9RUBA 3VAHA 2YKNA 4GKJF 1VC5A 1WSRA 2WBRA 3A4TA 2ZH9A 1G4CA 4DF4A 4NE9C 1UWAA 5GAGI 2FC9A 1QAJA 2H1YA 3A8IA 1T9TA 5KFEA 3GJSB 3NS5A 5MLCV 4DL6A 2DR5A 4DL0C 3FBEA 4C9DA 3HVAA 5GMKa 2PMHA 4PCQA 2MGZB 2WVCA 1F2HA 1TK0A 3DI6A 4ZKAA 2WAQD 1NXIA 3IM9A 2VJUA 4USTA 5E2QA 1WOSA 1HHTP 1HR0F 1SB6A 2HQ3A 1KKHA 3DLHA 3KKFA 1VIOA 4WFZA 2V2VA 4NLYA 4QYRA 5MAOA 3D67A 2R8IA 2B9WA 2VBYA 5HANA 1AA1B 5E3QA 1T94A 1ZTTA 2YWGA 4DSJA 4YFUA 5JJBA 5DLGA 5AXLA 3CB4A 4LRBA 1GNKA 2CPHA 3V6JA 2V2QA 2AP6A 4OJGA 4RNHA 3HT0A 4A8KA 4E0DA 2OI2A 4JI7F 4EZ6A 4C11B 4DL3A 1G7CB 4B17A 2CRLA 2DNLA 4DR6J 1C1BA 1TKTA 1MWYA 2MMYA 3E51A 4DLEA 3QAEA 1H3DA 3QYYA 3A3NB 1S6QA 4CH1A 5DM7Q 1Q5VA 2ZH5A 2CVIA 3QPIA 2MZ1A 1SUQA 3R7BB 4ZPAA 4CO3A 4F0HA 4LFAJ 2HBQB 2E5IA 1WUUA 1ZM9A 1YQHA 3LP2B 1HQEA 3BSNA 2GVDA 1S49A 3N9UC 5K20B 1O51A 1ZETA 2DNPA 4EFAC 3CMQA 4KT0C 3MPWA 3G4SS 3K5PA 2C2EA 3JQMA 2HG4A 1RBOB 3VGTA 3LPYA 4IH7A 2HBZB 3UDVA 2H4WB 2G0CA 3PYGA 2AJ4A 1YIJS 1AZSB 5B0BA 4OQJA 4CLPA 1FJGF 4TY9A 3F0NA 3AOCA 4IH5A 2BJ1A 2B4OA 3MM8A 2E9ZA 4ECQA 3T1AA 1KNZA 3WQPA 4IH6A 1U24A 2UUWA 3MCMA 3H2UB 4AXIA 1LW0A 4OX6A 1RKJA 2QFJA 3EXYA 1XR6A 1OY8A 4KYZA 5GADI 3DOKA 3PACA 1C2PA 4FNIA 2VPWB 2X1AA 1NKBA 3Q8YA 1GMWD 2M52A 4N8NA 1R0CB 2XCAA 4QPXA 4F50A 1YZ6A 4M5LA 2HZCA 1VQMS 2YWHA 3PM9A 1NB2A 1D9AA 4DV5F 3Q24A 4KY3A 1AW0A 1NK0A 1ULRA 2AEMA 3M2UA 3ISND 2RQMA 4LFCF 4WCEQ 2CNOB 5LT5A 3FUYA 4X65J 3KOAA 1GAOA 1RQ0A 1TV6A 1U1KA 1XNQF 4UTGA 1S6QB 4M94A 2GJFA 1JKHB 3FC9A 1U1NA 3VZIA 3CMAS 4JYAJ 2ZDPA 1SUQB 2K8GA 4P74A 3MOZA 4C0HA 1HQEB 3MFHA 3CXCR 3KK3B 5GVQA 4DPXA 4KGMA 3DFEA 1ZAXA 1TFWA 2DHAA 2R7RA 2ZH6A 2XULA 1V5IB 3GFXA 4CZCA 3R7NB 4PKDB 2C3OA 3D5MA 1S6PB 1N52B 2DVIA 1VQ6S 1YJWS 4LF6J 3KG4A 3MGJA 5K14B 2HVZA 5D0RA 3GV5B 3M9OB 2X3GA 1W26A 5E3AA 2LEBA 3SV4A 1HARA 2PEHA 2O66A 4N47A 7FD1A 1UFWA 2ZKUA 2XS2A 4MIWA 2ZVIA 4NX9A 1GH8A 1JLEB 2CJKA 2DHXA 1HPZB 2HHWA 1KFDA 3RBEA 3D6MB 1BXNA 2G2YA 1Y0HA 3PY8A 2WB4A 1KOOA 1TK8A 2W2PP 4WFAQ 4O3OA 2W1BA 2W2NP 1LWCA 3DGPB 3WIUA 4ECWA 4NLUA 1B4SA 4H4KA 1L3TA 3T41A 3GR0A 2F4VF 2I8EA 3JTPA 1BQMA 3SCKE 3PFEA 4K2JA 3G6YA 3CGIA 3WBZA 4JI4J 3BQ1A 4YB5A 1HD0A 3K57A 2VBZA 4ZJQA 2CJQA 1F3VA 4DUYJ 3M2UB 4K5SA 3M6VA 3X3UA 3MURP 5KFNA 1ITPA 2E5JA 2Z8QA 4B3MF 5CH7B 4MK9A 3MMCA 4ZDNA 4DV1F 1FRMA 2FPHX 3OXLA 4EUVA 1YGYA 3TVKA 2OPSA 3C6UB 3D3BJ 1W2IA 4XPEA 1JXVA 2APOA 4TQRA 2D74B 2CQGA 1NKEA 3W60A 1LEOA 3D1OA 2ZJQQ 4OHXA 3ET6A 2RRAA 2QC3A 1VJWA 2D69A 2B8PA 2RUSA 4TQSA 1CJUA 1WEZA 2A3JA 3BPSP 1UJ6A 2FVRA 4K4XA 1EX8A 4P2XA 2V8PA 2LLZA 5D4LA 3FRZA 4RW4A 4EK2A 5F9LA 1W7WA 2O67A 2C22A 2A1BA 4DI6A 1EZZB 2F40A 2J6TA 2CZVC 2DGWA 5DGBA 2XLKA 1FF2A 5KFLA 2HFNA 4DQIA 1KFSA 3T3FA 2H65B 2ASYA 4DZDA 2NXJA 2E7VA 2KKHA 1I1GA 3FMBA 1J5EJ 3I9V9 1UEKA 2ZWOA 1N32J 3QZ7A 2J6SA 2RHSB 2QX0A 4E2FB 4UQGA 3OL6A 2CPXA 4IFVA 3ISZA 4JV5J 3PV8A 3N79A 3EGNA 2GMHA 4RNNA 1YRTA 4PWDA 4DPOA 5IFMA 2RU9A 2AGOA 1YVFA 4A46A 1VRUB 1UA1A 3FVYA 4ZCLA 3MECA 1FA0A 3KFWX 2VFVA 2VJVA 5K8MA 3M32A 4BLGA 4PR6A 1BUXA 1IUJA 3PW2A 2W7PA 4QIEA 4OYBA 4PUOB 3NRBA 4LRFA 1SJRA 1RP5A 2Y3YA 3LAKA 2CPIA 2CVEA 1N34J 3EM1A 2DGXA 3H2LA 4UY85 1FE4A 2YWWA 3MMCB 4PXBA 1PCAA 3GCWP 5LSOA 2Y1JA 2R8HA 1N6QA 4ECRA 5ETOA 2OO4A 2BJ9A 4DX7A 1OYEA 4ID8A 1IQTA 2Z2YB 2W24A 3JSRA 4JI6J 3BB5A 4K0KJ 4OZ5A 3FKBA 2RU3A 4DR7J 1IM4A 2NXEA 1CJUB 3OXGA 2D3O1 4N7TA 2HBRB 2V69A 4M5GA 2MQQA 3NOCA 2W9AA 4MMOA 1BQNB 5B0CA 4DFPA 2C3MA 3C6TA 4I6WA 4LRAA 2N4CA 3NMRA 3DM2B 4HI2A 3OTCA 2VFTA 2UXBJ 1TVRB 3MUVP 5DG9A 2KT2A 2DKOB 2ZE2A 4UZBA 2MY7A 3QRQA 1CJVB 1VQLS 3NS6A 5AE2A 1FJCA 3ZZZA 1HBNA 4I56A 3W66A 3UI3A 3P6YC 1MN9A 4LMZA 2OSQA 1ZM3A 3RBZA 3GJTB 3NL0A 1TP7A 4P6QA 1RTJB 3H25A 1OSCA 5KG6A 3MMJA 5D0HA 2AZ3A 3MM6A 1EQ0A 3EMTA 2DR9A 1YBUA 3GB0A 3BBCA 3TUPA 4DBQA 3KLHB 1HNZJ 1HLWA 2ASLA 2XEXA 5KTQA 2HNDB 1WC3A 4FS1A 1F3FA 5DS7A 4C8NA 4XDDA 1NUEA 4OV6A 1FRXA 3OTOF 1WC4A 4B9SA 1JX4A 5LJ5Y 3BGUA 4DPYA 3AH6A 3H5SA 1UVLA 1P1TA 3LPEA 4F7VA 3KNGA 2VIHA 3FK4A 1H0HB 1U0HB 3W2WA 2ZNYA 1RT6B 1X5OA 5KFUA 1VCTA 1PKUA 2MZJA 1IKYB 5ADZA 1I5OB 1UFKA 1Q1KA 3WC2A 4DV7J 4A8WA 1IM6A 2HK2A 1IVZA 9ATCB 1U2FA 2ZBRA 2VA3A 4NCGA 1TTHB 2BX6A 3FMWA 2XGPA 2MB0B 1XMQJ 3SQGA 5GAGU 4QCLA 1X9SA 2Y0BB 3DXBA 2W4CA 3PYDA 5A8WA 1N33J 1U1RA 1NJYA 1HWUA 2NS1B 3W5ZA 4DR1J 5AE3A 3D0IE 4P7TA 3J7YI 4PAAA 4DCPB 2YNFB 1KQKA 1T11A 1R0BG 4DV0F 1XNRF 4I6AA 4ED4A 2IYGA 1I94F 3T1YF 4K2XA 3KYLA 2XCPA 5KG4A 4FP9A 1R0AA 1RDRA 1W2BR 2EEYA 3THVA 1FXRA 3IR6B 1AFIA 4JI1J 4ECUA 4B3SJ 4NA3A 2QMUB 4DR3J 2ROEA 3H90A 4RR5A 1RT7B 1E6VA 4BC9A 2ASDA 1IKVA 3CD7A 2C2MB 4OFZA 3DLLQ 3I5CA 3GILA 2WW4A 4X64J 3UN3A 2KHCA 2H9ZA 5D3GB 3K17A 1QJHA 1FVSA 4I2QA 1WDDA 4TKTA 3W1YC 1YJVA 2E7WA 2XYHB 3SIPB 1DLOA 4DX6A 3KG0A 1NPPA 4MFBB 5A8RB 2M4MA 3D1HA 4HLBA 2F5GA 3DLEA 1T0TV 4KO0B 1XMOF 2EFGA 4YHHJ 1WWHA 3E2EA 3KK2B 2VHGA 4YMEA 2E5GA 4DR4J 4YS2A 3IM8A 3LWLA 2CZ4A 3UD3P 2XMVA 1KONA 2NUUG 3FSIA 1VQYA 3T19A 2G1HA 4LIRA 2E9RX 4FVCA 4LF7F 4QR0A 2HNYB 3NAHA 3HULA 4JI8F 4YR3A 3BYRA 2XHWA 3NGTA 4ZPBA 1CULB 3OLBA 4Q7AA 5SUHA 4FYYB 1ZZFA 3E01A 4K7QA 1Q82T 1U2CA 2AYEA 1JLQB 1VS3A 3HXMA 1JNZB 1VR6A 2J5AA 4OMFG 1Q95G 4URQU 3D0GE 5C42B 4OYPA 2C2NA
chains in the Genus database with same CATH topology
3M6UA 3SCLE 4F2RA 4PG4A 1VMBA 1JLCA 3DYAA 1SL0A 2IVFB 5ITHA 3CCZA 3LP2A 1H7WA 3O5TB 1OPIA 5J1NA 4KGKA 5KT7A 3OR1A 2HGLA 2WOMA 4EU0A 2M70A 1JXEA 2VG6A 3QO9A 3QLHA 3T5JA 3RU0A 5EWFA 1UP1A 2V4QA 4DF8A 2ZBCA 1R0AB 2ZVSA 3EPGA 2DR7A 1UVMA 4QWEA 2KJVA 3HHKA 2GQ2A 3I4HX 2XY7A 4GO5X 2XMUA 3IRWP 5CYQA 4DL4A 4LQ3A 3JTNA 1FTRA 3R1HA 1WD6A 4YB6A 1HHSA 2GGPB 3EXCX 1IKWB 1NK9A 3DC2A 3MHYA 1HNIA 2GA7A 2CQ0A 1WHVA 2IM2A 3OV7A 2RKIB 1E6VB 1KD1T 4AE5A 3M8QA 2IRUA 6FD1A 2ATLA 4TNOA 2Q3PA 1X9WA 2XWYA 2I38A 4WFNQ 2RH3A 5THWA 2R8GA 4ECSA 1HL6A 2L08A 1S1VB 1RI7A 2FY1A 1IKXB 2K1RB 2LU1A 2DGUA 2V8DA 1WNEA 3HZEA 1VQSA 3FSYA 4OZNA 5EWEA 1LWCB 4QWAA 2YNHA 1A9NB 1X5TA 3FZBA 1AUDA 2Y0SD 3CJ0A 1ZOTA 1HYSA 3RYLA 2DGQA 2LQBA 3FSXA 3HHLD 3RAMA 1VQPS 1JJ2R 3CD6S 5C5JA 2LEPA 3BDEA 1SJQA 4WFBQ 2OPQA 1U4BA 2VG7A 1WEYA 2YX4A 1BQMB 5K5MA 3B82A 2MJUA 2FUG9 2JVOA 3OFFA 2QE5A 4RWWA 1U1PA 4FBUA 2AJQA 3HKWA 3K2YA 4PXEA 4K4YA 5F8JA 4NLWA 1Z2LA 3SXLA 2JLFA 4I2QB 4QBUA 3BM7A 4R5PA 3HLUA 3S7RA 1X4FA 3X1LB 2L41A 4IOBA 2EK1A 1MMLA 4PG8A 4JI4F 2EBEA 5LL6d 5CYMB 5DQHA 3LF0A 3MR6A 4DV6F 1T05B 1H38A 3EX7B 1FDBA 1TL3A 3PW0A 2PDAA 4KV8A 4A8QA 2LYVA 1DLOB 2KRBA 2PMZD 1QVGR 3MTJA 5KFZA 3FQKA 4DUYF 1QLNA 4DFMA 3M2VB 1TR0A 1S97A 3RAQA 2Q6BA 1SJ3P 1PC5A 4NLDA 3W2VB 3SZ2A 4KTQA 4DV4F 1S9GA 1D3WA 5D4PA 2VODA 2XSJB 3QJPA 2HHUA 4GMKA 3MR3A 2RRBA 2QMWA 2VC0A 3UR3C 2B4VA 2B6AA 3NCRA 5I3UB 4FXVA 3KHRA 1TFYA 3U1LA 3MUMP 1JLGA 4XPCA 2D41A 5DJBA 2VBWA 3RRHA 1Q79A 3T9NA 2ZZMA 1RTHA 2YKMB 3G86A 3ICLA 2MDAA 5F8IA 2OPSB 1UVKA 2JEIA 4IG0B 2PI4A 3HZGA 3MR2A 2MHEA 4ES2A 3SCJE 1FK9A 1XMBA 3IRXB 4L3NA 1JXLA 1GT8A 4WXWA 1RT4A 2F1FA 5EX3A 1LOUA 2J6UA 2VOPA 5JVHQ 1Y3KA 1Q7LB 2UXCF 5BJRA 1FD8A 2BVZA 4JUZA 2VOOA 3VQTA 3NCQA 4X4SA 1NKCA 1YJTA 4ED7A 1RISA 1HMVA 5BYRA 3SFUA 2AGPA 2GCFA 3FFIB 1NK4A 1T3OA 4Y2CA 5E3PA 4UY8T 2VD3A 2EBGA 4TY8B 4TXSA 5KFIA 4Q45A 3CCLS 4PPDA 1Q7YT 1R8CA 2CJAA 3PXGa 2VB6A 3PJWA 4A8OA 2E7XA 2OPRB 4C4WA 3RB4A 2A2CA 2B5JA 4G1QA 4I69A 3Q22A 1UVIA 1FXDA 2XLIA 2KT5A 5F3TA 4DLGA 2MZRA 2CQCA 2WW8A 4KBIA 4ICLA 1BD6A 3P96A 1B7FA 3P5TL 5EN1A 3JTOA 1LWFA 5KFRA 1DTQA 1KQGB 2VV5A 1NH7A 2QIFA 2MKJA 3K59A 5KFXA 1OS5A 1D9DA 2JWNA 2HGMA 5DDQC 1HQUB 3L7PA 1XERA 2Q66A 1FVQA 3OXFA 3C8YA 3OR2A 4RW4B 5HROA 3TRGA 1T3NA 2ROGA 2DGTA 3I4PA 4F02A 2MQNA 3R5DA 3CF5Q 4B9VA 3QIPB 4CNZA 2D1CA 3I9ZA 2KG1A 3CSKA 2P6TA 1Q78A 3N5BA 1JKHA 1TL5A 2X1GA 3K7RA 3HHDA 1WTFA 2HWTA 2DR8A 2I9SA 1NU4A 3MPYA 3DLBA 5F3ZA 4NXNF 1G2EA 1N5VA 1REVA 4I64A 3W7BA 3I0SA 2MHNA 3MMBA 4I67A 1T8EA 1GXTA 3O2IA 3SDEB 2KHDA 2MQPA 3FJ2A 2BM1A 4IFYA 2ADBA 2KRRA 3TA1A 2BE2A 3TNVA 2AWZA 5DGAA 2RRNA 3CEDA 3HHLB 2FVCA 4FNHA 1F9FA 1P27B 2N82B 5I3PA 3OR1B 1H7XA 4ZMMA 3OSNA 2IJFA 1S1XA 2KVIA 2W9CA 3KK3A 1YWXA 2N3LA 4LUBA 4WK1A 3QLHB 4YQWA 4LSLB 1JLFB 3SYZA 3O1LA 1RA6A 5L9NA 4URGA 4CCHA 1B0VA 1J5EF 1RA7A 3G8QA 2JZ5A 1MMNA 3KLVA 5CYQB 1N32F 1S1TB 3B4DA 2FTRA 2DJWA 4H4MB 2AYBA 4F8RA 2KM8C 1YITS 2ZDOA 2IVMA 3PFOA 5G0RB 2JSXA 4IFVB 5CCLA 5IM0A 5HLFB 3SCIE 4Q43A 3VZHA 1S6PA 1TKZA 4Z37A 5EWGA 4K4SA 3TUIC 4JV5F 2VPXB 2EFVA 3J7Z5 4W90B 5K14A 2V0NA 1WHWA 2GFFA 3FRYA 5KFAA 4GC6A 3K5MA 4RWXA 4J9KA 4USJC 1S9EA 3F41A 3NKYA 3PO4A 5CHCB 2VONA 4PWDB 1Q81T 1JNRB 1SKRA 4B3TF 1QVFR 3RB0A 4CO5A 3HP6A 2L3MA 2C3PA 3DLJA 1CQNA 2PI5A 1F5BA 2OFHX 3U02A 4FF4A 2DPIA 2J9DA 4NMLA 3GFZA 3MECB 2R8KA 5LXRA 4X4TA 2OPQB 4ZLPA 3GG0A 4LFBF 2Q6CA 2VG7B 3H2VE 1X4AA 1TQLA 2J9CA 2QZ8A 3MAHA 4KE5A 4HDHA 2ILZA 4IR1A 4FF1A 3K8WA 3RW6A 1KEKA 2X51A 4UUXA 1JLEA 4IOCQ 4WE1A 1ZH5A 1HPZA 1RT1A 2CPYA 4XK8C 4PWUA 1HD1A 3M32B 1VK8A 4DR2F 4ID5B 1ZM2A 1JJHA 4ZVGA 5K9FA 4CH0S 2AGQA 3MI7X 5FJ4A 2D9PA 3HKZD 2AJ1A 3K5NA 3DMJA 3GSDA 3I32A 2RF2A 1N36F 3Q8PB 4N56A 2E1CA 1JWWA 2XI3A 3D1QA 4DHVA 3HF5A 3RRKA 1HNVB 3FEZA 1WACA 1NH8A 3LW5C 2UVRA 2E9TA 2DNZA 3QWPA 3BSCA 1M5PC 2RT3A 3O6QA 4IRCA 2J7KA 1PGZA 5F0WA 4K4TA 2KU7A 2DHGA 2OKQA 3CJ4A 1IBKF 1N34F 1N0UA 2HQIA 2HFZA 1R8BA 3IBWA 4FZVA 3ZZOA 2ZITA 2B6AB 4YB1P 4DQSA 3DGPA 4R0EA 2DNNA 3MEEB 5B0AA 4C3MA 3DLGB 2L9DA 1KLMB 1Q16B 1RTHB 1N6QB 1C0TA 3OPKA 4C2MA 2CQHA 4EBDA 1YJRA 2ERRA 1S7HA 4OZLA 4LF5F 2P9CA 2VKRA 1DHMA 1RTIA 2EFOA 1SIZA 4IKAA 3EZ5A 3MTKA 2WSFC 3G6ES 1RT4B 2F3JA 2FJBB 2FLNA 1IJFB 3IFEA 3KHLA 1FNMA 5HP1B 1QAIA 4HKQA 1GX5A 1TZ0A 5KOXA 1S79A 4QWDA 2V8VA 3B8HA 5GAHU 4I68A 3UD4P 2M7SA 3IXQA 3K8VA 3U27A 1XEZA 3FGVA 4JI5F 2QA4G 2CPEA 4F4YA 1T03A 1YJUA 1RWUA 4JI6F 3TVYA 5EGYA 3FCHA 2OFGX 3PX4A 4K0KF 3OUYA 4P2SA 5KFCA 5A8KB 4J9LA 2LCWA 4KB7A 4DR7F 3MM5B 3Q8SB 1K8AT 2ZHAA 2VFUA 1BQXA 3LQVA 4MYUA 2HVHA 3TX8A 3LP0B 1UVNA 2R4FA 1LFPA 1TUVA 2AF6A 4RW8B 5T7LA 1WI8A 5D6GA 3BJYA 1IBLF 3DRPA 4J5OA 4MTPA 1SJFA 1SC6A 2CPJA 5BR8F 2CJ9A 3IG1A 3N5FA 3ENVA 1GX6A 3CT9A 4O44A 5D4NA 3H59A 3C6UA 5KOWA 2MYFA 3LWMA 1LXJA