2MT9A

Solution structure of holo_fldb
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
173
structure length
173
Chain Sequence
MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQILNEMAEHYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin-2
publication title Long-chain flavodoxin FldB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Electron transport
total genus 56
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mt9A00
5LBUA 4GQIA 4GR9A 1FLNA 1XYVA 2V5VA 3QFRA 4C76A 1YRHA 4OXXA 1JA1A 5LBTA 4ZVKA 3EYWA 3O73A 1QBGA 1C7EA 3OJXA 3ESYA 4YQEA 5ULLA 3U7RA 2Z9BA 2MT9A 4F8YA 2Z98A 3NHJA 2OHJA 2QMZA 4BMOB 3NHYA 1ZWKA 1YKGA 2Q62A 2WC1A 1AKRA 2QX4A 3ESZA 3O2NA 2W5UA 1V4BA 3KEGA 1CZKA 1WSBA 4C0XA 5BUCA 3OX2A 3FW1A 3F2VA 5EAIA 2XODA 4ZVMA 2OYSA 5TGZA 1ZWLA 2FVXA 1QHEA 2QX8A 1DXQA 1H69A 1C7FA 3OWHA 1DX9A 4GI5A 4NLLA 2RG1A 2QWXA 2B3DA 2FX2A 4U7GA 5LJIA 5NULA 5F12A 1FLAA 1DXOA 4QOJA 1XT6A 1GG5A 4PTZA 2A5LA 3HR4A 1QRDA 3N3BC 5EA2A 3TEMA 3K1YA 3JSXA 1RLJA 2ZKIA 1I1OA 1FX1A 3W79A 2FLVA 3GAMA 1KBOA 3EDOA 4CETA 3LT5A 1YDGA 3UXHA 4M0CA 1FLVA 1JA0A 2MTBA 1J9GA 3NHWA 2FZVA 1J9ZA 2OHIA 2XOEA 4U7HA 2X2PA 3S2YA 1TIKA 1RCFA 3R6WA 4NULA 3ES9A 3OX3A 3QE2A 3NHRA 1AKQA 2KQUA 5B3KA 1CZNA 4FGJA 4ZVNA 3N3AC 2M6SA 4YAUA 4U7FA 3OJWA 1CZLA 1AMOA 2MWMA 3NHLA 2BPOA 1FTGA 3HLYA 1J9EA 1FLDA 4QODA 1T5BA 2N1MA 4QOGA 3F90A 4R81A 2ARKA 3P0RA 3G5MA 2V9CA 1E5DA 3KAPA 4DY4A 1AKWA 2HNBA 3NHKA 4LTMA 1D04A 1SQSA 4FGKA 4HS4A 1FVXA 4LAFA 1YCFA 1OBVA 3B6MA 3LCMA 2HPVA 3L9XA 2BMVA 2QX6A 4N82A 2BN4A 5EMNA 3F6RA 5FX2A 5LJLA 4XDGA 4DIKA 1ZX1A 1H66A 3NHFA 3NHPA 1AKVA 4QOFA 2FAXA 4Y9RA 1B1CA 1SG0A 2M6RA 1XYYA 3GFSA 1RTTA 2X2OA 1CZUA 3B6KA 2Z9CA 1YCHA 3KAQA 3L9WA 2MOKA 5LMCA 1VMEA 3B6IA 1CZRA 1D03A 3GFRA 3NFRA 4YAWA 5B3LA 4YALA 4YAOA 3W77A 2FCRA 5FUQA 5NLLA 2QMYA 3D7NA 4H6PA 4XDHA 3FVWA 1J8QA 3N39C 2R96A 2QR2A 4D02A 3FJOA 1BVYF 5F51A 6NULA 1AKTA 4QOEA 3ESXA 3TZBA 3FNIA 1RLIA 3FX2A 3F6SA 1D4AA 5LVAA 1CZHA 2V5UA 3TE7A 2R97A 1KBQA 4J8PA 3B6JA 1AHNA 3U7IA 4S24A 5LLDA 4QOHA 4YAFA 3UXEA 4N65A 1AZLA 4ZVLA 4CF6A 1AG9A 2BZSA 3OVMA 4PTYA 1CZOA 1QR2A 4C14A 4LTDA 1FUEA 4H2DA 1TLLA 4ESEA 1BU5A 3SVLA 2KLBA 2Z9DA 1YCGA 1YOBA 1AKUA 3OWXA 5F4BA 5JROA 3NHSA 2FOXA 3QFCA 3K20A 4ICIA 2GSWA 2QX9A 2BF4A 1NNI1 3NHUA 4FGLA 4QOIA 5A4KA 2OHHA 4DILA 1XI2A 4BMPB 1OBOA 3RPEA 2F1OA 2HNAA 4Y7CA 4C0WA 4N9QA 4PU0A 4FX2A 3ZHOA 2D5IA 1F4PA 2Q9UA 4Y9UA 4HEQA 2FZ5A 1T0IA 5FA6A 3W7AA 4LA4A 1X77A 1WSWA 2FDXA 3OX1A 1OFVA 3GFQA 4LTNA 3KLBA 2AMJA 3HA2A 3NLLA 3W78A
chains in the Genus database with same CATH superfamily
4X3PA 4FCCA 4MV8A 1XXLA 1Q44A 2VYNA 5CAEA 2EZ9A 5KYYB 1T1JA 1C9DB 1ZJ5A 2V59A 2BKXA 4D8UA 1UBHS 4MB6A 1EFRD 1UMDB 4NOKA 3PXEA 5LOVF 3IA2A 3TZKA 2EKDA 2I0FA 3G0OA 4Q9AA 2A86A 3I2YX 3MILA 1NPYA 3KXLA 1FDWA 2AZ4A 1BH2A 4NHEA 1F20A 1FUIA 4RSHA 1QS0B 1JJVA 3K0BA 5G0UA 2HO4A 5HF5A 2I6TA 3ADBA 2QVYX 2H0AA 1XZPA 4KQXA 1BW9A 1SKQA 3H4VA 4MIOA 4NU6A 3E5RA 1EZ4A 1KF0A 4PAQA 3T7IA 3WO0A 2QYSA 4AECA 4D9GA 2ETVA 2J9YB 1RQXA 1GG2A 3RRJA 2ZFUA 4NFLA 5FTMA 4JBWA 5C46F 5AVUA 2QTRA 1TEZA 4BX9A 1J1UA 4I6EA 3UPTA 3G17A 1NZFA 1T3SA 2NSHA 3QLVA 4KE9A 1U5BB 3H5WA 3ROFA 2CGEA 4L4XA 4TKUA 5M3BA 2WHEA 3QVSA 2CVQA 4ZOBA 3S3TA 1G6Q1 3U4IA 3V7NA 3KSBC 3PPXA 4ND3A 1EHIA 3I09A 2CNDA 2ZRIA 4Q02A 1OX5A 1CYEA 4BU1A 5JALA 4ZD6A 2VJBA 1F4VA 4N8SA 2R8BA 3OQ6A 2DR3A 3ESQA 3IPRA 5JEEA 1HWYA 2BEJA 1NZJA 3OZUA 3QBVA 3SQNA 5D01A 1BNCA 2YX1A 3GLRA 3IURA 2DULA 4I4LA 1CUCA 1LDBA 2YBEA 2BFEB 2BTOA 3QITA 5DF1A 2PMEA 1ORHA 1NW8A 3ABOB 3FOWA 3LYLA 1K5GA 1SVNA 2GN0A 3MGKA 4PYJA 1CERA 1XGKA 1BRTA 2P6OA 3FYUB 4R54A 1IXSB 2BDUA 2UZ0A 2W2OA 3L4BC 3GZ4A 3EOZA 2YFYA 4I1UA 4GR4A 3KS9A 5EINA 1DKNA 1XTRA 1CBUA 1P33A 3E84A 5KQMA 2HY7A 4IIEA 1XIVA 2WF6A 1E6EA 3O2NA 2JARA 3PKJA 1P3Y1 3C3PA 1WSBA 3C5VA 3L8HA 3RUDA 4F2GA 1MVLA 3CUTA 4YRLA 1ISPA 2R87A 1N4AA 2IC5A 4V0SA 1SCBA 4L02A 1PR4A 4GI1A 5EKSA 2WFAA 4IDPA 3OX2A 4ZT3A 4B17A 4F8JA 5IUJC 4B3DA 5FWYB 2VDRB 1V39A 2N0SA 3PF8A 2GGSA 1TKCA 4WK4B 4AU1A 2OQ2A 3KWMA 4JKYA 4QBGB 1LC3A 1HK7A 4L28A 4DR1B 1XSEA 4AG3A 1WY7A 3EVNA 1JG2A 4TVKA 4OFBA 3T3GA 3WRWA 2GFIA 3GD5A 5I7RA 2SECE 1EFVB 1JLMA 1TIBA 2QPLA 3OICA 3MQ4A 1VSTA 4J0EA 4K1XA 3E22B 4LXYA 2N1BA 4MI9A 2LVBA 4W5HA 4DEYA 5CBPB 2YHBA 1T3GA 1SUBA 3C43A 4ZCMA 2NXJA 4AL4A 1NUAA 4L3WA 3CS3A 5BQ3A 1FTNA 2ZJYA 1SUSA 2XXJA 4HNGA 1NQTA 5A5EA 2QIPA 1UKBA 1VHTA 4M8LA 3EVTA 1E3LA 4CCAA 1KO4A 1MB4A 3AIOA 4DHWA 4AWAA 5JZOA 1H9CA 1CJUC 2Q9AA 4QNMA 4R2JA 5KVCA 5LP6F 2E1PA 2AFVA 2QLJA 2PFSA 3C48A 4KO8A 1F12A 2RI0A 3FCEA 4NNPA 2FPSA 2R6HA 5EJMA 1FF9A 5H3CA 3TQQA 3P9CA 5AIAA 4P3PA 3IV9A 2A1UA 4JLDA 4D82A 2IODA 5IAAA 1OLSB 3Q0TA 4D7AA 2ZYHA 2II6A 2CVPA 3LIIA 2XBLA 1G98A 4JLPA 4PTZA 4EGCB 4EJFA 4I1PA 3CG4A 2JFXA 4AMVA 3HXTA 1SFRA 3C8HA 3HR4A 1D6MA 4UHFA 5A9TA 4ALJA 2OFWA 1RMQA 4YRJA 3FXAA 4MUKA 2CCKA 3KT6A 1BFKA 2B1GA 4FSDA 2OBMA 1BXZA 1NXVA 1YRYE 1I6KA 1I1OA 2XOKA 3O8OA 3SJBA 1K7CA 2JPDA 5H8WA 2QQ0A 4WNIA 3DS8A 4Z86A 1KO1A 4PCVA 5JXWA 2GVZC 1RHUA 2QA5A 3CPHA 4RIHA 4GF5A 5IC4A 5L40A 2OG1A 1SWVA 3C5HA 1MT0A 3Q10A 4JB8A 1SZJG 3GDOA 4HDOB 1IG0A 3H2ZA 1E79A 4O4JB 3WBBA 4NRDA 3ZKWA 3EXEA 5D85A 2BHLA 5KKNB 2XQVA 1YTUA 3A70A 3DV0A 1HT2E 3TKLA 3UV6A 3NYWA 4EG4A 4PO8A 2GM5A 4YJ3F 2PZJA 3MIZA 4RXUA 2QVZX 5HIIA 1J4AA 3NOVA 5FJIA 2PSFA 2XUDA 1RSZA 1ZGCA 3WKAA 1W19A 1Q0QA 4DCNA 2VHXA 1E3MA 1DIHA 2JS7A 2ZAGA 2ZYRA 2FQXA 1EGAA 3VPXA 4UE6A 4ZV4A 3IMGA 4MUXA 5A2QA 4KQCA 1ZSVA 4G0PA 3LQYA 1W88A 4ND2A 4NULA 2YWXA 3STHA 2CJPA 2BEKA 2I2XB 2OZKA 1HC7A 3M5CA 2Q7XA 1I6WA 2CCGA 3R9XA 1WETA 1VBKA 3NBXX 4G89A 4RHTA 4HXFB 3QE2A 4QDZA 4BVFA 4Z0TA 4CMIB 2XWPA 4FNOA 4TTJA 1JDNA 4PNEA 1UXHA 1CR6A 3QXGA 3Q8XB 4KWTA 3F6PA 1WCIA 2YASA 5ALHA 2EHDA 3H05A 4BYMA 1NQ5A 4DR7B 1R12A 2EQAA 2JJ1D 4OP1A 3EZYA 4UPDA 3T52A 4DM3A 2HK9A 1GL9B 2A2ZA 1VHLA 2GCEA 3GYGA 4MULA 4P7KA 3P96A 2CVZA 3TNLA 1RRPA 5FPYA 5A62A 4GWLA 1XZAA 1QXSA 3ZGNA 3SXJA 4RVOA 2GEBA 2XMRA 2FDRA 1AQ6A 2NADA 3I1FA 1XXHA 4GQAA 4L9SA 4PV7A 5DGTA 3K30A 4O2AF 2LE0A 1ZNZA 3LBFA 1TUBA 2BGWA 1N8TA 2FWJA 2W6ID 1DFHA 3P20A 3C45A 2IYFA 5F1OA 1DJQA 2JGEA 3UMYA 4PZCA 3IUBA 1EE1A 5IJ9A 3DT9A 2B1IA 3DT6A 1QHXA 3TMAA 4BMVA 1DLJA 1VPLA 1EVIA 2W6JD 4I9NA 4DZRA 3N5CA 4AFNA 4F4CA 4EZEA 3GRZA 5DBOA 4LC0A 3LUBA 4TUYA 2HUNA 4CG1A 2C31A 2X8LA 3OOJA 1ZGGA 2GN8A 4AD8A 4EABA 1BKSB 3A6DA 5THXA 4BGIA 1QE3A 1K7YA 1UK9A 4ENRA 5BNZA 1EX1A 2VNAA 1SXQA 5JCOC 2EERA 3EGEA 3IT3A 4D57A 2QZ4A 3UF0A 5JR3A 2OD7A 3ILYA 3TPCA 4Q1AA 1HSZA 1E2FA 2WABA 3GRCA 4GBJA 1ZNWA 3PFBA 4NG4A 2VSXA 3ZS8A 2JJ2A 1Y5IA 1ISSA 1UMCB 1TTHA 2F64A 2GI4A 3DXXA 5IC6A 3GEPA 5AVRA 1W4CA 5EY5B 3BXHA 5L8VA 4N0QA 5E4TA 3D2CA 3GRPA 1Z6QA 1H42A 4IZOA 1WU7A 3GB9A 4K6CA 5ADHA 4OB6A 4CU5A 4L72A 1JHOA 2I6SA 3KQSA 3KYIB 3V80A 3OMWA 2E3JA 2O48X 3BUSA 2VTDA 3F9CA 1VFPA 4EB0A 1TZJA 1CFJA 5EMNA 4L3VA 1O87A 4O3MA 3OLYA 4G63A 1FQWA 1U3CA 5AM3A 2D7CA 4RL6A 1LX6A 1D0SA 2ZRKA 5BYJA 1J70A 3TCKA 3UYLA 2G40A 2ADFA 2ZM6B 3QVGA 1P17A 2WSSD 4UNPA 2D2IA 3FLMA 3UUGA 3CZPA 3PUWA 3GT3A 4P0TA 3LHSA 3LF1A 4N5MA 1RJ9A 5BOSA 5K5EA 3ZD7A 1JHAA 3KALA 3JQFC 2YIDA 4GX5A 4IBOA 1GFIA 4U7JA 3S8MA 4C6HA 3O8RA 3FCOA 1Y7LA 2FG5A 4JJ7A 3PSHA 4X44A 3TUIC 4YAEA 2QW8A 5HBRA 3M6VA 5JPIA 3TTSA 4BOYA 4NV1A 1RWMA 1RW4A 3D59A 3QVVA 3R6GA 5COQA 3VQTA 3UUFA 2ID9A 1SKYB 3TXAA 1W6UA 1ZP6A 1E2MA 4DQDA 4JI4B 2PNFA 2QSJA 5B6PA 2C2WA 5BMVA 2JFZA 4C6TB 4A73A 4AJHA 1AT1A 2ODNA 4ECEA 5DLPA 3G0IA 4HB4A 4RIEA 3DL7A 2H00A 4MICA 4LJ9A 2VDNB 3CVYA 3EGDA 2QYOA 1OT3A 5KYWA 3FKSD 4OOFA 1GFSA 3SHQA 5B3AA 2XE4A 2JK0A 4LQ4A 4UATA 3LPAA 4A1FA 3L8GA 5F64A 4KGVA 3A7DA 4G1VA 4JS0A 4ER5A 1K8RA 2QVXX 1XDDA 3QPDA 2C3UA 3JQ7B 2TMDA 3K2BA 4TS3A 4ZC8A 1ZJ4A 4J43A 2QD1A 1KU6A 4PGFA 3L0CA 2CNKA 3OHSX 4ZJZA 4RKWA 1R37A 4KXFB 3UK6A 5F21A 1A27A 1SELA 4EI8A 1UJNA 2EJCA 4CCSA 3VFDA 4ND8B 2FDCA 4B3XA 1THMA 3ABRB 1DT3A 4S0XA 5I48A 3PDHA 3V3TA 1BEEA 2K4MA 4I1IA 2C5EA 4P4GA 1IBCA 3D2AA 3MPOA 4NAUA 1L4UA 2C84A 4AJIA 2FQQA 4FE3A 5GV7A 4B3HA 4EJSC 3TGLA 3MHPA 2CEKA 2IUYA 1OH6A 1R0XA 1XNHA 2XUKA 3EWSA 2HQSA 4HFNA 2I71A 4I3GA 3IIJA 4A91A 2WTEA 4TSFA 5K3BA 1NVKA 1FQKA 5K8IA 1AKTA 1BMQA 1WU8A 3KOMA 2QD5A 2EQBA 3OG9A 1BYUA 1HYBA 1UWLA 3CKMA 4PRYA 4RTMA 4XR9A 2WIFA 3CBQA 3AERB 2FPIB 4FS8A 4I36A 4RZXA 3W2HA 3C3YA 3PZBA 1DB3A 1H4SA 4JYPA 1N6HA 3LYHA 1R6UA 3ZCSA 3FX2A 2P0EA 3L4EA 1E9VA 4IQFA 1SD5A 1D4AA 4MMZB 3VU9A 2XKKA 2DETA 5D2CA 5FOQA 1SULA 1EFCA 2QDKA 1U1CA 1I36A 1YR7A 3WG9A 3O4VA 1WZNA 4LNHA 4XJSA 3EVGA 2QRQA 1UBEA 2NU9B 4YJ2A 3OF5A 3IQGX 4HQOA 3X1ZA 2G28A 3DC2A 4EYKA 1C9YA 3AHFA 1PFQA 2CD7A 1BN6A 3I6ZA 4FR5A 2UZ1B 4ZCIA 4IKOA 3TSAA 1Y3FE 1R8SA 1E7SA 4AY5A 1QTIA 1K92A 1U3VA 2FWIA 1JAIA 1R27A 1OWNA 1QP0A 2FEPA 2Q1XA 3IELA 1F8FA 1YFKA 3ZE7A 1FE8A 2J9RA 4KSYA 4EPVA 1M6YA 1HNZB 2FWNA 1X7HA 3U7HB 4WCFA 5EZYB 3MJEA 1XDBA 5CIYA 1ODJA 1YS6A 3MSXA 3L0ZA 4I8DA 1Z06A 3GUCA 2P8SA 1DAIA 4TX1A 4YR7A 3UJDA 1PZMA 1R2QA 2XB8A 4PTYA 3V8EA 4KDEA 3BF7A 5A5DA 1KOFA 4J1NA 2NO1A 1E69A 5FT9A 4ESEA 4OHCA 2P3OA 821PA 2CMDA 2OB2A 1J0BA 2FJPA 2PS0A 1YI8A 4XQEA 2KLBA 5JNLA 3PHIA 2BFMA 2CUZA 1H2AS 1OF1A 3DMTA 5JFOA 4TKLA 1N5LA 3PGKA 1CETA 5C8YA 4E7PA 1DMRA 2XB6A 3ED5A 4RZIA 4HNVA 2NO9A 2AWOA 3KELA 3TQIA 3HEAA 1AQLA 4RPLA 1NVVQ 4BP8A 3HM9A 3OCZA 3EGXA 4RVCA 4ZOLB 2EBUA 2XDQA 4W8OA 5C8ZA 4WMLA 1VJ5A 2IHKA 2VCHA 4BNGA 1L0BA 4MAFA 3S4YA 4PGAA 1YB1A 1YJAA 3AWDA 5IANA 2BLLA 5F4BA 1L4GA 3CXUA 4PR3A 2FPGA 1ZRHA 2I2DA 3BL5A 1GZHB 2WHRA 2PZKA 3GGDA 1IY0A 4X8MA 3SF8A 2IHJA 4IDOA 4XUGB 5IKPA 1UINA 4TGLA 3EA5A 5ALEA 1S02A 1KXZA 3GAFA 4GM0A 2YIMA 5TRTA 4DSOA 3K9NA 1MRSA 5C7YA 3THXA 4G9GA 4UTVA 3Q40A 1WCWA 1Z62A 2WK1A 4Z4CA 5AR1A 3AJEA 4K6HA 1P5RA 2FUG1 1JTFA 1YUNA 2AJTA 2FUEA 2PKRA 5J1TB 3LAWA 4F46A 3U6BA 2GN1A 1D8AA 2IW3A 1OBOA 3BJZA 4UEWA 4BFWA 4U8HA 3EMVA 5IF3A 1EHCA 4RF3A 2CJWB 2UUOA 3UWDA 1TM1E 3L77A 4IDEA 4KXYA 3QMMA 2ZUVA 3ZH2A 4B5LA 1J1IA 4A82A 1C9KA 1NP3A 3CCBA 2H3HA 2OHOA 3EG9A 2V7PA 4LPSA 1BHSA 4R05A 3WIVA 2X4DA 5EMHA 4K9QA 1V3QE 1AO0A 3L8YA 3HJTA 3P9IA 4LF6B 3TG8A 5BURA 3LK6A 5ALUA 3T5CA 5C7OO 4YROA 5IX8A 2Y1CA 4UTNA 1BJRE 1OBFO 2FSIA 1ZCFA 3HXPA 4PG7A 3ZY4A 2VRWA 2VK8A 1CT9A 1YC5A 4UHJA 2NVBA 2IQ5A 4S1OA 3UYKA 4B48A 1DARA 3HDTA 5AICA 4KQMA 4C0QC 2ZW9A 2GH1A 2YN0A 3MGCA 4INZA 4Y2VA 3LFHA 2WMDA 2WLSA 4ENPA 1GNQA 2JJMA 3CT4A 3DP9A 3IAXA 5ERXA 2V96A 4PYRA 4KPEC 4NQZA 2AF4C 1AHIA 3OOSA 2JLUA 3U7QB 1DWPA 2Q3EA 4IZ6A 4WXRA 4I4NA 2QD4A 3LMKA 4AC9A 2I33A 4K28A 2LUOA 4N12A 2WTMA 5FO0A 1ZZGA 4RE6A 3AQIA 3W78A 5KYYA 5AK4A 5B7PA 5SZJA 1NYLA 1RAHA 4GQIA 3NVDA 1UMDA 1U4NA 1NG1A 4MUAA 2OZVA 4E70A 3B7WA 1N6OA 3VYVA 4COKA 3L40A 4KOAA 2CW5A 1MC5A 3MG9A 1V5GA 2YVKA 4JSTA 3ZUGA 1XMQB 2PX2A 3K0EA 1IEXA 4ARUA 4MVJG 1GEEA 1X8KA 2HWYA 4HWRA 4DV4B 2ZIWB 2ISCA 4DCJA 3LL7A 2I78A 5AVZA 2W4IA 3H8JA 2YJ3A 1IIRA 3H1EA 3RRYA 5BW5A 2IDKA 1C7EA 1SVOA 3FM9A 2QJRA 5FBHA 1PWYE 4NC9A 3B85A 3UJHA 3OHMA 3V2IA 1BS2A 1U5BA 1NLUA 3WGZA 2PLRA 1YXMA 1ZMBA 5CEEA 4ND6A 1VL8A 4IM7A 1NU6A 2HWXA 3NB0A 4QHTA 4O8ZA 1SBCA 5FBLB 3UAYA 2NG1A 1TZMA 1N6PA 3K0CC 3GVHA 4Y2PA 3F7OA 3QU4A 2MT9A 1OFUA 3BILA 3B9QA 1U7UA 1O1YA 5K8TA 4IDGA 1ZAYA 3UGJA 1E2BA 5CB4F 4QEDA 3AGQA 3N28A 3OIUA 4Q9KA 2ENUA 3WLTA 4BJ6A 3A9CA 2BFEA 1U0SY 2UVQA 4BCBA 1Y6JA 3IPLA 3K3PA 3ZDBA 3S6JA 1ULAA 3L7MA 1D2EA 3FYUA 1BG6A 3MTGA 4LECA 2NTNA 5P21A 4AF8A 3Q88A 4UNRA 2ZB2A 4RDXA 3C3JA 3UW1A 3WGIA 4RMIA 4MKZA 1JG6A 2Q1YA 1BE0A 3KSZO 4NBVA 3RGWS 1OIVA 2DFVA 3JYPA 3G1UA 1G21B 1C7RA 3PNBA 1R74A 3T7JA 3JQBC 3KEGA 2WKRA 1DO8A 4BX8A 4E51A 2ZUEA 5SY6A 1VL0A 3E7XA 4D9IA 2WWWA 3A1NA 4E5VA 2ZTUA 1UXGA 3CO5A 1Z6YA 4OBEA 4NH4A 4ZO9A 1P29A 1CUZA 3AL0C 1LCIA 1F1JA 4JVOA 1CDOA 1FU8A 4WOKA 4CZ2A 5FWYA 3SVTA 4PG6A 1GQFA 3IFSA 5B6JA 5IAKA 5DNCA 4QPDA 3C41J 5HZMA 1ZFNA 4G1MB 2OE2A 3WNDA 2Z95A 1EINA 2XODA 3WS7A 2ZSJA 4MR8A 2ZE6A 2F1RA 3HBAA 1EFVA 1O5OA 4FHCA 4GGOA 2HK8A 1GV1A 4O29A 5HKKA 1E89A 1Z5PA 3GJSA 3E22A 1SXIA 4KQ6A 1I2AA 1WVMA 1Y7IA 2VG8A 5CBPA 2PUAA 3ROTA 2QG9A 1J33A 3LLMA 5IHXA 1CNFA 1YU9A 3EVEA 5AKIA 2PLWA 5AJYA 4CIYA 1H1TA 1L4BA 3JAWB 3PHBE 1CUSA 3DF9A 4BZPA 3MQ2A 3CZMA 3LKZA 4HN2A 5EHZA 1DJPA 4MYDA 3ZGOA 3I4LA 5D3QA 3WC4A 4A1OA 3ZJVA 2IXTA 4GWKA 1EX6A 2EJWA 3I9V6 4R7TA 1DUSA 3R40A 1ZN2A 5JS2A 3EVDA 2OOSA 2R6DA 5CM9C 5AKXA 3D8HA 4ZODA 1SMKA 5K0BA 3PCRB 1K08A 4JENA 4HLUC 4O08A 5IZ4A 3WWPA 1OLSA 2ACVA 3L3BA 4GMDA 2NTJA 4MCIA 4FCVA 1TK3A 2MCFA 4EH1A 4F5ZA 3W04A 3NAGA 5G0VA 4US2R 2DPYA 2GNAA 3QIAA 1YULA 1YOVB 3TW0A 4JMLA 2XF8A 4K3UA 3Q3GE 4RBNA 2G72A 3WSWA 4EW2A 1H5QA 3O21A 4DN6A 1C1HA 3JSXA 3OT4A 5DOVA 1OAOC 1P0PA 3AEQB 3WYGA 3D6NB 3IVAA 3HL0A 3L93A 3N6XA 4M1SA 1JSXA 2O59A 2P69A 3FGPA 4FONA 1HEYA 3IEXA 3W2TA 1Z5VA 2P0YA 2J32A 1NSYA 5TPZD 3EBPA 2PXAA 2OY0A 2IZ0A 4OHUA 4ZRMA 2F3QA 2Z56A 3RV4A 3UMRA 3AHHA 5ECDA 3T94A 4DCPA 4O4JA 3DZCA 4A2QA 3ANSA 4DCTA 5I8WA 1K6MA 1SEVA 3DO6A 1HPLA 1IK6A 1U3TA 3ST7A 4HEJA 2E49A 3GP3A 5DYIA 1ZMXA 3KXKA 4LZLA 3VXKA 3D8BA 1Q1QA 1J9GA 2WU8A 4CM6A 2PYZA 2C4HA 1ZPDA 2J0QA 5KNBA 1JYEA 1XQ1A 3U31A 7GPBA 5L7YA 3I9MA 4IFBA 3LCJA 4UEJA 3K0AB 3RFUA 4CLOB 1N1MA 4EO9A 5ALWA 1R10A 2JD0A 8AT1A 4G0UA 2HO5A 4IL5A 5ALRA 1C9EA 3OKPA 5IFKA 5IVKA 4FDVA 3S81A 4BQQA 2C2MA 4NBRA 1NMQA 1W5BA 3KSDO 1R6XA 1V1RB 5A5GA 1GUYA 2VQ6A 3F67A 3WA6A 2HFJA 4CMIA 4FFPA 4EMBA 2WM3A 3L01A 1UM8A 2HUPA 1XR3A 3NTLA 4QWMA 4FNMA 1CSEE 1LZLA 5LQMA 1R4ZA 4AYXA 2Y9PB 4X1YB 7YASA 4HJRA 2AMLA 3GA5A 3TI9A 4HB3A 3WISA 1CZLA 1D2MA 5DU2A 5JS8A 4EGFA 4QXPA 5FULA 3N2ZB 1S0UA 4H1UA 5CM8B 3ZY5A 4Y7DA 4BVBA 1SUIA 3EGWA 3DW3X 1UKYA 4WFIA 5U9CA 4PX5A 1WZ2A 1GAQA 1S9DA 2FR8A 2AN4A 1N2IA 3LDGA 4LCEA 4DCVA 2ZBEA 4BX3A 5FDFA 1J5PA 2G77B 4DSUA 2TMGA 2R0QC 1R0LA 1U2GA 3B1WA 3ND8A 4QOGA 3D0QA 2IEYA 2YWGA 4TRRA 2NSLA 4HAIA 5DBHX 3AHGA 5BUSA 1GNVA 1YI0A 2BGUA 3P0RA 2PGAA 1HDRA 1V7CA 1E3SA 2QLMA 3OLQA 5FRDA 3UTDA 4EY8A 1Z0UA 1T8WA 3G5MA 3IUEA 3IX7A 3O38A 4OJTA 3TAUA 2QBYA 3V4ZA 3VDXA 2HM7A 2R11A 1DAKA 3BXFA 3OZAA 3ZLVA 3QXXA 3W4JA 4DY4A 1P19A 4BJ1A 1HKUA 1OUMA 2V0NA 4YREA 4WNCA 4E2ZA 6ADHA 2ZJ1A 3NHKA 1KI6B 5KNDA 1CJTC 3GLKA 2SBTA 2B25A 5DX0A 1D04A 4DOMA 1IMOA 4NPAA 2I2CA 1EA7A 1UMCA 4FGKA 3ORSA 4S2EA 5ALQA 4E94A 1AQIA 1FVXA 1I9CA 3ANXA 4EOGA 4XYMA 2GILA 4HDQB 4ZCTA 2ZWMA 3MMZA 521PA 2B2CA 3EZ2A 3WKCA 3S70A 2IOFK 3K9HA 3TIGA 2FMIA 1RI4A 2VN8A 1PTJA 2REOA 2D0IA 1ZIPA 4QM7A 1G7TA 2BP7B 2GHIA 4ZP1A 3OCUA 4HNUA 4D25A 1VCOA 1AK9A 3IAEA 4X6LA 2FB9A 2ATVA 2Q5FA 3WNQA 4Z51A 1U4OA 1OB5A 2YW2A 1JFTA 1N7GA 1DZ3A 2FK7A 1YC2A 2AQIA 2VYVA 3DCYA 2W2QA 4DIOA 4NJMB 1LWNA 3CF4G 4OHOA 1VE6A 4OI1A 4A3SA 5A1TA 4RTOA 1R0KA 1VHJA 3B7PA 3RSSA 2FZCA 1SB8A 1UJ4A 1PJ4A 1RI3A 2O2DA 2PUHA 3UWKA 1PS9A 2QYTA 4A23A 4Z7QB 1KQGA 1U7ZA 2AK2A 1FL9A 4J3FA 3CF2A 1CUHA 2ZBFA 2OC4A 3HY6A 3HXOA 2BKEA 3O4IA 3I04M 4C6TA 4DIEA 1UOPA 2FUKA 2QSZA 1H2WA 2B8NA 1G4UR 3CLRC 2VKQA 3PE4A 1HFEL 5EZ6B 1PK9A 3FHTA 2BSQA 3U19A 3KWLA 3WFIA 1B8PA 5KTKA 2C0QA 2CZCA 3L04A 1ZC3A 3H2KA 4TT3A 1I1NA 3B5JA 1HG1A 3FA2A 3R3YA 6LDHA 1LD3A 3DLIA 1DNPA 1Y1QA 4RTSA 3V9AA 3NXKA 4J0KA 4DCSA 4L16A 3JQ7A 2K5UA 1VLQA 3CLHA 2MOKA 3TAXA 9ATCA 1Z13A 5KNCH 2DBZA 3Q8LA 3URKA 4BP3A 5ELXA 4QVGA 1E1QD 4J03A 2HPAA 5H3LA 1YHYA 1H23A 4DBVO 4NPCA 1TUEA 4F4DA 4ND8A 3V55A 1QHHB 5KAMA 1FSZA 2C5LA 1U3DA 3LC1O 1WNFA 2VP6A 3OIWA 4QTTB 2PWZA 4BFCA 4PO3X 3LIPA 1VTKA 4MVXA 1ZJYA 5ECYA 2P78A 3HBLA 4IS2A 5DN9A 4B84A 3I2HA 4OIMA 4U4AA 3OZRA 4IG4A 2G5GX 1ZGBA 1NNSA 3ZDRA 4BVLA 1XCOA 2LRHA 3B82A 4I3HA 1ZH6A 2BMWA 3RSHA 3U3OA 2YIVX 2PTHA 1FQJA 1PL6A 2LIVA 3NIGB 1E1CB 5F51A 3NIFB 2O7SA 5A9SB 4A15A 3RIEA 2VSFA 1WDTA 2WSMA 3G13A 4PHTA 2A59A 3WYCA 4A0SA 2WILA 3KZVA 3FNIA 1Z4LA 3AERA 3B9RA 1D2CA 2FEWB 4I4CA 2FPIA 4KAAA 3RV3A 3V1UA 3ZHZA 2PKXA 1QUFA 2Q1TA 2FZGA 4EGSA 1XVLA 4UEKA 2FUG6 4FXPA 3K8OE 2FZLA 4G5GA 1H1LA 1ZSNA 4JASB 3PXAA 1KHTA 2ECFA 4KR3A 3D8TA 1YE3A 4LNUB 2OZPA 3VX3A 1JLLB 5K3CA 3FOEC 1LXCA 2O8NA 1CUYA 1D1PA 5JDCA 1M1UA 3PC4A 1TU0A 2Y1OA 2F2TA 4B5KA 3KQYA 1IQRA 2NU9A 2GBCA 3LUDA 4WNYA 1SZPA 1G42A 1OWPA 4P08A 1M1ZA 5C3UA 4NP6A 3K94A 2GJAA 4LGCA 1D1QA 1P80A 1JEOA 4XEHA 2J3IA 2GBIA 3F5FA 2UZ1A 2OCDA 3P9SA 3FJYA 4EW3A 1HMPA 5LM3A 2PLFA 2WUFA 3SICE 2GMWA 1EP3B 2AZTA 5J23A 3K92A 2IS4A 5JU6A 1RAFA 3G0HA 4OQDA 5J5VA 4NDNE 2C83A 1B0PA 9MHTA 4UTRA 4IILA 5EZYA 3OAAA 4B35A 5HE8A 1I2DA 2R6FA 2X5OA 4W5JA 5HILA 2IXDA 3EISA 5JE8A 2JLYA 1ATIA 2OLJA 4PR0A 1A88A 3BC1A 3QU5A 1JW9B 2FFHA 2WZBA 3HZHA 3GFVA 2BE9A 1E3DA 1MV5A 1R8JA 1LDEA 2SKCA 2YWFA 3ZI7A 1YKSA 4B3CA 1F4LA 4NEQA 2G9ZA 2HGSA 4DXHA 2P7HA 2VSYA 3FZYA 2O57A 4GPZA 4JK3A 2J3EA 4JL6A 1OSNA 4XIJA 5CEFA 1N9KA 3O9ZA 2MJLA 5CB0A 3ZI4A 2RK4A 4JJ6A 4OHXA 4I2VA 3I4CA 1N2CB 4TV9B 4BYGA 4D44A 1T0PA 4XKJA 2PVPA 2VDPB 2V98A 4LWOA 1E1DA 5JYCA 2HAEA 4OHVA 2G9NA 3LC2O 1GKYA 1V7PC 4YAIA 4GUAA 2EFYA 4ZOCA 3NEJA 4LF7B 1K2VN 3KT8A 2AYYA 3P9XA 3W2FA 4HUTA 1MTZA 3EXG1 3EZNA 4ZOLA 3TOVA 3HP4A 4YDRA 1ACLA 1G8FA 2BFFB 3V9PA 5HWSA 1KFKB 4TRJA 3LT0A 4CV2A 2P1ZA 1FS4A 3HMQA 4WJKB 3IAUA 4AO8A 1LQ2A 1P7PA 1CY7A 2PX5A 3ASZA 4W6QA 4XLLA 3U39A 5JZVA 4FFMA 1IZ8A 2JCBA 4RNDB 3V8BA 1GKKA 2EJTA 2WYHA 3M4XA 2VJOA 3DD5A 3QFCA 3UQYS 3WRXA 2H9AA 4BN4A 1XCLA 2AUTA 4URXR 4I2NA 1MGOA 1YS4A 1CY4A 4X95A 3RU3A 3OKCA 3O7MA 2X2EA 1AV6A 1CB7A 2QQ5A 2YYYA 2WI8A 2RJ3A 3SI7A 2QORA 5EERA 4B4UA 5A2GA 2HTFA 4XVHA 1FJXA 1TOAA 3U17A 5HF8A 1N2HA 2AG0A 1RVDA 2ANBA 4G25A 1MAWA 3BWBA 1NVGA 1B3RA 3N0WA 4HPWA 4L8YA 4UMEA 4ZDIA 2F3TA 1ML3A 5T5QA 2CJWA 3A6GA 4PIPA 1F60A 1L5HB 3E15A 4N18A 5K3FB 1AGXA 1P7ZA 3DEJA 5ALTA 4E5NA 2RGDA 1VLZA 1J99A 2GXAA 4KZKA 4XVRA 2F8SA 4RORA 4OHWA 3UY4A 5BR8B 4PC1A 1SGWA 1TQ6A 1FVHA 4KVAA 2DLCX 2D5IA 4XWOA 1U8XX 1TM5E 3O3MB 2AJCA 3N75A 4ZI7F 5AW8A 4HV4A 2DLNA 1V71A 2G9RA 1BFUA 2VZ9A 3ZV4A 3GGGA 3RU7A 3HEBA 4NTZA 2WF7A 2C07A 1K5PA 2FFBA 1RLUA 2DBRA 1WW2A 3EJ6A 4NBSA 4XJTA 3TZEA 1DEXA 2UYQA 4AJEA 3E35A 4GMGA 4HPXB 1Q7BA 5A1JA 4HGNA 3VZDA 1U7PA 5A4AA 3ABQB 3IKLA 2QMQA 3IULA 2IUFA 3PVSA 4HATA 5TDHA 2ZXEA 1GT6A 3TIXB 1GG8A 1SCJA 4G67A 1NC3A 4G5FA 3LWNA 3O93A 3A6HA 3DBLB 5JH7B 5DTMA 3DDUA 4WKBA 3LX6A 3ZXIA 4F3RA 3OEHD 4BV3A 3NZEA 4IJQA 1NBWB 1YI1A 3U7QA 3LPMA 1P5JA 3NOQA 3QBTA 4TKMA 5I9IA 4D3FA 5K6AA 5GIPE 3L6BA 2DVMA 1HDIA 3HB9A 1YU6A 2VRCA 3O8LA 3EASA 2WIAA 1NBMA 1P31A 2JEZA 1E5XA 4L76A 4COOA 1DEAA 4IIJF 1XCBA 1Y3AA 3R20A 3II6X 3AEXA 1B23P 1LY1A 2CWDA 4LMBA 4FGZA 2JK1A 1N0UA 1G5HA 1IHPA 5JFGA 1COWA 1G60A 4WVLA 1LLQA 2B99A 4RE5A 3R0ZA 4YY3B 2XUPA 3M6UA 2C4MA 1IATA 3VJMA 1SBQA 2IYYA 3GMIA 3TSZA 1SQGA 2CEAA 2A9VA 1CUFA 1YAJA 3RUPA 4N48A 4LF4B 3EIQA 5ALOA 4DMRA 1JEEA 2NVWA 5BT8A 1IY2A 3EG5A 4C6SA 1Y3DE 5AOCA 2H1RA 2L19A 3OA0A 1E59A 4ZJUA 2JKVA 2VK1A 3AM4A 4U6NA 1OGYA 4B44A 3EWIA 1UKCA 4C4SA 4DYHA 2QJWA 4IIYA 4BWYA 3KM0A 3GIWA 3ZDXB 4OAQA 2ZIFA 2WZQA 5JJCA 2PUVA 1J21A 1Z56C 2GT1A 2J0UB 2ZYAA 3L06A 1U9ZA 4U2FA 2PUFA 1RWKA 2G04A 2ZREA 2XYPA 4H7FA 4CHTA 1XA3A 2D1YA 2WUDA 3GJ0A 3HACA 3PQ7A 4QPZA 2X41A 2OHJA 2O2HA 4Z2AA 2IV2X 1B8VA 5DDIP 1U1EA 4GKJB 2B8EA 2GN9A 4X8OA 4P33A 3HP1A 3ANMA 3TCXB 1J22A 3IMKA 2EDAA 5GZ1A 4DKJA 1GOTA 1YKGA 3RSGA 4EATA 1Z2NX 4LHXA 5KYKA 3U13A 4EZBA 3AU8A 1ZI9A 4PBRA 3SVZA 2KX7A 3BWXA 5JSUA 3ZC3A 2HWUA 3IH5A 1G21A 3B3QA 3KYBA 1F0NA 1XZIA 4C4RA 2R4TA 2Q6LA 4QPJC 5CXQA 2P3LA 5K3EA 5KX5F 3PDIB 3EC7A 5IJZA 1W5FA 1YK0A 2DWPA 5G40A 1EP9A 3ITNA 1OA0A 3Q12A 1NSTA 2X13A 4EG1A 4P4TA 3LVQE 4MDYA 1FYWA 4HN9A 5TQ0B 3E9NA 3SYKA 2HQRA 4L2IB 1REQB 2XTMA 4XRRA 1D1TA 2J09A 1UJ5A 4H3VA 1V37A 2JAWA 2IKQA 4WL0A 3VR1A 2FVXA 4BKQA 3VDQA 1C7QA 1P9NA 5SZKB 3IAM6 1AH2A 2E21A 1OYOA 3MK31 3MUEA 3NP7A 3CGWA 2M98A 2QX8A 3LA6A 2IEZA 4GLFA 3MBKA 1KQNA 4CIDA 1IFXA 5GAJA 3I23A 3JAWA 1RP7A 4IO1A 4DABA 1EEXB 4QLOA 1GRVA 1OT5A 1ZLXA 3LUFA 4P92A 4PYIA 1OFTA 4RVNA 3INRA 2ET6A 3LUKA 2XZLA 3NORA 4LFCB 3LC0A 5F33A 5KTMA 4XYBA 3WHIA 4QD3A 5EE1A 4EAAA 3BB1A 3UXYA 2P77A 3MTEA 4AJOA 2FE4A 5FUWA 1JQAA 3BORA 2Q4RA 2J9XB 3MAJA 2AFRA 1HE1C 4IEEA 4GX0A 2RSLA 3RRFA 5A7FA 4ZZ1A 5L4LA 4R8KA 1OFUX 4JT2A 2C1XA 4DE5A 4HX2A 2ZSDA 1J39A 4IYJA 3ZWOA 1SU6A 3QG5A 4PEVA 1WLYA 4RJJA 2QZPA 1YOVA 1AN0A 1ZZEA 2C7RA 1XP8A 3EEFA 1J90A 1Q1NA 4N5DA 4EA6A 2D1QA 5HVNA 3AEQA 1G8AA 4R0NA 2AOVA 2JDIA 4ZVQA 4K26A 3DAFA 1XMXA 2AUNA 3GAMA 3PFWO 5L3ZA 4GZ6A 3W9YA 1XRLA 1GDTA 1ZUD1 3T9DA 3DXYA 2RAVA 5ITVA 1YDGA 3ONVA 3WLEA 4R83A 2BHSA 5C4GB 1IOVA 2W6CX 3PQEA 1OIWA 1B1AA 3AKCA 3AM3A 1MUUA 2DRIA 2GZ2A 8LDHA 1OFGA 3NDBB 4LE1A 4A2PA 3AR4A 3H6GA 1EWRA 1QRAA 2QXUA 3QRWA 1OX4B 1TYAE 4GQBA 4IAOA 4UU0A 2PX6A 4JBIA 5GONF 2PYDA 1EGVB 2R25B 1NXQA 3IKVA 4P3YA 1K4YA 2CNOA 4P80A 3K0AA 5BYBA 5K0NA 4CLOA 5FWXB 4X7RA 2BEUB 4H77A 4PLZA 4G09A 4OGLA 4M1WA 1JYFA 1WAMA 4KXUA 1VLJA 2V9ZA 1WEHA 4QQNA 4U0JA 5DZSA 3FCXA 1T29A 1IXKA 2IVZA 1EE2A 3HU2A 3I45A 4ZZ2A 1XDUA 4EG6A 1G41A 1Z47A 1V1RA 2BM8A 3V2GA 5EYPB 3IAS1 3VDMA 3R8FA 1QGED 3FFWA 1E2UA 1HM5A 4YYZA 2JAXA 2HBRA 4II3A 2JLBA 1E1YA 2KQUA 4O1IA 4OAOA 4Q4LA 1VYHA 2V97A 1Y37A 3AILA 3R0JA 4O59O 3TNJA 3OF3A 4BLQA 5C31A 3HC7A 4X1YA 5AYVA 1W36C 4B3GA 3N3AC 2JA2A 2COUA 4HNAB 4HQNA 4MKRA 1U0LA 3D8UA 1GP2A 2BMFA 4LKRA 3D2BA 1Q74A 2Y71A 4GOKA 2ZUTA 3R7DA 4D9HA 2IEDA 1PR5A 2IXGA 1DI0A 4YYEA 4DDWA 2IH4A 3E18A 1OXBB 1QNFA 1FDOA 1FTGA 1NXPA 1I7LA 3HLYA 5HM8A 1TJPB 2ZZNA 1JG1A 4XM0A 1HFKA 2NIPA 4D0NA 4TYWA 4IIHA 3KFXA 3LFUA 2Z57A 3O94A 1T5BA 2N1MA 2HR1A 4NENB 3GCZA 2XMBA 3ENZA 4FNAA 4MS1B 1A9RA 1LBEA 1Z88A 3IO3A 2JFQA 4I14A 3JD4A 1Z8HA 3NAMA 2O1SA 1BE6A 2ARKA 2AR0A 2H1LA 3DR5A 3UV7A 3VYSB 4OYYA 5D3ZA 4ARSA 1Y1RA 1T8RA 1FRFS 4LXIA 3IIEA 1PX0A 2E2WA 3ECCA 4PWYA 4Y2RA 4RV5A 4KMOA 3RAJA 4IR7A 4KK3A 4WERA 3VHXB 4BN0A 4C7MA 3VKVA 3EPPA 3A26A 4WDRA 1CUIA 4KRXA 2B34A 1KI6A 1T15A 2F17A 3H19A 1KPHA 1DRWA 2H2DA 3EDMA 5TY0A 2A78A 1VBFA 2WJ4A 4Z9FA 2Q8NA 4XUEA 2C5SA 1XAHA 1H6CA 1FK8A 1RC1A 3SXPA 1B2LA 3GP8A 1HY3A 1IN1A 4DTIA 2QTGA 3B6MA 3ROXA 1VIVA 3MRTA 2VA8A 1U8ZA 3OFVA 1Z0FA 3V8PA 2CFCA 5LXTF 2C3YA 2G5PA 5IXYA 1S8OA 1J5EB 4DLZA 1PV2A 4CG0A 4L50A 1TVEA 4HGYA 3LDHA 2GAAA 2OGWA 5CH3A 4Q6BA 1BQ4A 3CYFA 2ZTLA 1MF7A 1NR5A 3SJUA 3U5ZB 4YCCA 3UT5B 2B6NA 1RHJA 3L7DA 3N8DA 2Z83A 4AB1A 1SVSA 2YV4A 4NFHA 4NJMA 2VWHA 2BZ1A 2VP3A 2X8AA 3MD0A 3FLAA 5CLIA 5E9JA 1YJXA 1CHNA 3PTAA 4LYEA 1HETA 3DUWA 3NJ8A 4V38A 3U3ZA 3DL0A 1X14A 1X9GA 3GJ8A 3KEQA 3PDCA 5AI4A 4P58A 4KDCA 3CRVA 3FWHA 5LZ9A 4QM6A 3HWRA 1SUFA 3DAHA 3IEMA 3KQHA 2C61A 1YR1A 2XXAB 1E18A 2BJWA 2O52A 3DMPA 2MSEB 2HRCA 4QFBA 2YZMA 4QUAA 3MCVA 3PF9A 3ASUA 4M1KA 4BX0A 4DBLC 4ER7A 2R3SA 1FMLA 3K09A 3KSUA 4S0ZA 4EJ6A 5CK4A 3GFPA 4Y9RA 3GLGE 1L2TA 3F2IA 3QE0A 4BQNA 5AVVA 1FTSA 1Y6FA 1N9GB 4R9NA 3ER9A 5F5NA 1U2SA 2PIDA 3ZLBA 4YWJA 4F60A 4DIUA 1U81A 1YWGO 1M2GA 1V1JA 5LYYA 3ZCXA 5IEJA 3QF7A 3R5JA 4UXJA 4ZIRB 4E03A 1T0UA 1WBBA 3NQ41 3RSCA 1J56A 4NX2A 3DOIA 2F9LA 1Z0DA 4CYMA 1NV9A 3R5SA 1EAYA 1JLRA 2D1TA 5FWDA 4LHEA 2EW8A 3HBFA 2R8YA 2IP2A 3KDSE 3VUEA 4HAUA 3VR5A 4B6QA 2Y66A 1ELOA 3ZGXA 5B1YA 1NVBA 2P9TA 3NYQA 4RETA 5LMCA 3QE4A 1O57A 1HFJA 1M8FA 2GF2A 1BAPA 1WXWA 3UKOA 2X23A 1KKLA 4ZYTA 4OREX 4M0KA 1IE3A 1YVUA 3HY4A 1QHHA 4PIMA 3SSAA 3Q3JB 4ARAA 1FYFA 1F06A 1LW6E 2OXEA 1Z2CA 4IINA 5LMUB 1YZYA 5ITWA 3T1VA 1MZPA 3KK0A 4UBNA 4RELA 1YNOA 3F7NA 3W77A 1IZZA 1R0WA 1WA5A 3CMMA 4OLHA 2ZWVA 1JDBB 3HKEB 5IYZF 3U4QA 3ZJUA 3D7NA 2UAGA 1UFKA 1YMQA 3HR8A 1XTQA 1GARA 2P68A 4RA9B 3DDOA 2QPOA 1X86B 2IL1A 1FDVA 3WGTA 4RD6A 4EKEA 1BMTA 3E7DA 1FDUA 1E1CA 5A9SA 2Q45A 3DEZA 4BLOA 5K7SA 1NDHA 2I4TA 2CF5A 4QOEA 1O9BA 4RCZA 1EG2A 1Z18A 3B12A 5ESRA 1F9EA 3DEKA 3TMYA 4EPXA 4QFCA 3ISVA 4O4LF 4N8DA 1IXRC 2H18A 2GYVA 1DBQA 2WYUA 3AXTA 3NBUA 4IOMA 1O6GA 3GYBA 4LNUA 4RMJA 1JLLA 3FNQA 1B74A 4V1CA 3U9LA 3KJQA 1WB5A 2JNWA 3D8NA 3FSGD 4UXIA 5FBWB 1Q77A 4GNRA 3H9BA 4MVWA 3UMCA 2PKCA 4F85A 5AW1A 3TSYA 1KBQA 3ZJ5A 3C6ZA 4YMHA 1YMUA 4M9CA 4YMLA 2WAMA 3TFOA 2XMDA 3EIHA 4FFSA 1JIJA 2GPBA 4S24A 5CD9A 2AFIE 1A4UA 1GY8A 1Z17A 2FMHA 1TU3A 1RYNA 4A6XA 3UXEA 5L95A 2O8FB 2HBZA 1K9VF 1K3FA 1SXJE 2RH8A 2WKPA 3H83A 2IFTA 1P4AA 2C9DA 3TOXA 1UP4A 5DW3A 4Q0MA 2O0LA 3ZDQA 4MVYA 3DGFC 1D9XA 1KMNA 2J8ZA 2IIBA 2Q3MA 3P71T 1UBRS 4R01A 1C2YA 4BO4A 1N3LA 1P4SA 1R8QA 4OYHA 3VV3A 4D9FA 5KU7A 2RGWA 1WB6A 2PFKA 4N5NA 3JQ9A 5BV0A 1GU7A 2C7QA 3EPKA 1QGDA 1Z36A 5CYPA 3U6KA 2WSIA 4K87A 2BELA 1G3QA 1ZW6A 5DE3A 4XIGS 3REFA 2CNBA 3QIVA 1TGYA 1FZQA 4X0EA 3O95A 1KQOA 1TVMA 1N2CA 2OXRA 3BTSA 4TV9A 5FL7D 3W8DA 4BVGA 1JJIA 2YMQA 5C9ZA 1XA0A 2PD3A 2NU8B 4YBRA 3OSUA 1GPJA 3VMMA 4DMHA 3UCFA 1XRSB 1BJKA 2QTCA 2NZUG 4KMSA 3KJGA 4HUQB 3A6ZA 3F5QA 2VT7A 1FXWA 2I66A 3D6MA 2A8YA 4F38A 2R8XA 4V0KA 2BFFA 1ONNA 2PA3A 4EB6B 3RF6A 4DLRA 5K3DA 2EGGA 3I04A 1LF0A 2PQMA 4YT2A 1KJ9A 1IY1A 5K1ZA 5ECWA 3SC3A 1GDHA 3C85A 3FF4A 4HWTA 2OB1A 2TMYA 1LDMA 4A27A 2WEKA 3KIPA 5DMHA 3ZVRA 2IXBA 2YIJA 1IULA 3VOBA 2O20A 4NH0A 4A0HA 3ZNPA 1JKIA 3HU1A 5EIEA 4ZU3A 5BSWA 3FUCA 2G9UA 1WD5A 1ISJA 2JHGA 3LH5A 4L4ZA 4LF5B 1Q1ZA 1E63A 3GJ7A 4KJZA 3G2LA 4PNPA 2UKDA 2IOYA 3F7TA 3IUSA 4AG6A 4XLZA 1SHJA 1E98A 1R16A 4MKIA 2VDOB 3WOVA 4J16C 4AT1A 3I52A 1L5KA 4F2HA 2EV9A 3PX2A 2GCNA 5CA1F 1DRKA 5JMWA 3CMCO 3I83A 2QB5A 4FE7A 4JJKA 3EVBA 4NYIR 4F3CA 2H29A 3BZBA 5TLSA 2RKBA 4NWIA 4IZIA 4YCLA 3G8AA 2GAOA 1I94B 3RI3A 2Y93A 4ND5A 1L5HA 4I9FA 1Z73A 5K3FA 3RVDA 2GN4A 2C7PA 4Q18A 5MN5A 3I9NA 5E4FA 2XF2A 2HHAA 4BFTA 1EZ1A 5KJFA 3OKFA 1PZGA 1EM6A 4LMPA 3ZHRA 2QT0A 3OSZA 4B45A 4KQEA 1I5OA 4S2UA 4TTTS 2AFHE 1DG9A 3RS2A 4FJ1A 1Y1KE 4RLQA 1G18A 2PK3A 3G1TA 5AW6A 1JE0A 2UUAB 5CRIA 4AO6A 3JWHA 4EX6A 1TMYA 5AKEA 4AULA 5FLYA 1EVYA 4PXAA 2BMAA 5DHFA 1KFCB 1A1VA 4OX9Y 1GZ5A 3D4NA 5A02A 2FTKE 1C0PA 5CA0A 2OD9A 4GOLD 4NI5A 3AP3A 1YB6A 5EGNA 1Q0SA 3TAHA 3BHJA 3EAGA 4CDGA 2XEXA 5JISA 2OWDA 5JH7A 1KQFA 3BGDA 3QXCA 3DBLA 1CUDA 2O8CB 1EJ0A 3DCJA 3GJYA 1XJCA 4KE7A 2EU8A 3SF0A 4XDYA 3UKJA 3WLIA 2I4IA 5EPEA 2P9HA 1V47A 1IK4A 3U4DA 4UTOA 1PLLA 5K4HA 1A69A 2HJHA 5CCBA 3FZNA 5IMSA 5CITA 4B81A 4DV5B 1E5TA 1Q0RA 3NH9A 1GZDA 4LVOA 2DUUA 2JFHA 4G1BA 2O9JA 2H2FA 3OZVA 1E9AA 1VP3A 2AD1A 5FI5A 3HCFA 4DEXA 1ISIA 1YHZA 2HLNA 3PPYA 3IQIX 4R1SA 5ESDA 4YPOA 4AZTA 3OBBA 3W3AA 5AM1A 1N0IA 2BFDB 2V03A 2JLCA 3BWCA 2OV4A 2W6QA 4XPZA 3RABA 1Z29A 3CNOA 1GD1O 2DJ5A 2Q4DA 4ON9A 2VK2A 1E1MA 3UHOA 2NO7A 3ASYA 1EFKA 3PG5A 4L7QA 4Z9XA 1W2HA 1ODSA 1T34A 5JTTA 1RYDA 3BSFA 4R0VA 1ZM9A 3V42A 1HLDA 1VCHA 2GCGA 1WXEA 2H1HA 2SHKA 4BO5A 3HRIA 1ONPA 2N42A 2VLIA 4MQ4A 3VR4D 2V3VA 5EWLB 5JFTA 4ML3A 3VR2A 2WG0A 2ZXUA 1CJVC 2E18A 2B82A 1XZHA 1W0KD 1QQ7A 2I9PA 1MHTA 2NO0A 4BNXA 1TT5B 2XWQA 4PYLA 1IBSA 2HDNB 2J0UA 2PPVA 2Z9BA 3CW2A 5LQSA 3U7RA 5IBQA 4E22A 2ZR9A 1FA9A 4V0ME 1L7DA 1DJMA 1MNQA 4UKDA 4RTLA 1RPZA 3SC2B 1QQBA 3S7TA 4N6OA 2Q5IA 2R5WA 2YXEA 3CPEA 2A9RA 3BH0A 3G8BA 4IJWA 1DKOA 4TWIA 4X91A 5LNK6 2B4RO 3GH1A 5ELLA 4IJVA 3Q7QA 4WXMA 5EE0A 3S7ZA 4HGQA 2B2XA 1CS0B 4F97A 2IX9A 1V6CA 2QX7A 1TQ2A 4ZKDA 1O95A 1KIMA 3UPUA 1IXYA 1FTYA 4Q6WA 5EKXA 4WHMA 13PKA 3NNSA 1JLSA 3IUPA 4G4SO 4YV2A 4P3XA 1AQJA 5FPHA 4GHWA 2Z2JA 4HJXA 5AVTA 1C3OB 1G8HA 1ZUWA 2WJAA 5LLSA 5F5XA 4Z3DA 5TEWA 1N2OA 3T9AA 4E46A 1KEEB 4BNFA 2R66A 3PDIA 3T5PA 1HE8B 2XRMA 1RIFA 1UZUA 2OCPA 5BN4B 4BV2A 4FOLA 3K1JA 1JF8A 3BN3A 3ETGA 3GG9A 1Z7GA 3TLYA 4QXAA 5TQ0A 1U1IA 4UAJA 4RQBA 2I76A 4L2IA 1REQA 1H2FA 2HU8A 4WH0A 5JAZA 1YZQA 4FFNA 5EMLA 2WWXA 1DHRA 5IN5A 1M1XB 4KR9A 1GTSA 2DQYA 1KEVA 4Q12A 4V3CA 2IU0A 2JBAB 5KTRA 1ZI6A 2DF8A 3P9RA 3EQ9A 1HYGA 2Z6VA 2WVAA 1ZD4A 2HLDD 3CJRA 3IUQA 3AZQA 3NDRA 1J2EA 4BEBA 2G4LA 3HGTA 5BQ5A 1GWNA 4O33A 4DM4A 2P8JA 4JYCA 1KSFX 1KY3A 4PM4A 2HU7A 4MV7A 4CKXA 4J0HA 1YASA 5T41A 3OZXA 3UMGA 4FI3F 1OKKD 1G5FA 4RZQA 2CDNA 4Q00A 4ZQHA 2I8CA 4C4OA 1OC4A 3GN1A 3CUKA 3N74A 5FJJA 1TUIA 1U7OA 1W4LA 5AJVB 1PR1A 3KSMA 3FNHA 2I4RA 1M7GA 3GCDA 3L8FA 4UULA 1NR7A 1K8ZB 2P2GA 4FFVA 3ZJ4A 3QE3A 3GUZA 4IH9A 5EP1A 1NATA 2WG2A 4QZVA 1GG5A 3ETEA 4UAUA 2TRSB 4BRUA 5JNTA 4Y0VA 3MFQA 4BO2A 5EHXA 3GQBA 4BKMA 4DMKA 3WFJA 4Z6KA 1DWOA 2Y67A 1CNMA 1KSHA 5A5FA 1Y6QA 5C53B 3R23A 3NWEA 4U2CA 1NMEA 2PO7A 3QQ5A 1P0FA 3NEAA 1QLHA 1PJTA 5JTUA 1ZXLA 2XCSB 5BQFA 1M2KA 3FTPA 1KBOA 4KYUA 5JWOA 3FVQA 2PJUA 1FFXB 3RSOA 3BBLA 1QYCA 4CM3A 2HLHA 2C2OA 3MRXA 1JHUA 2EX4A 1K7FB 2LD4A 5A4MS 3SKXA 1K6IA 3L4BA 4V39A 3QY9A 1SUCA 4J0QA 5DOZA 3FMGA 2UUPA 2A9PA 4K7JA 2EFHB 3GT4A 4G0MA 4R1UA 2VYND 4DCGA 1QNLA 1SXJD 1NJ1A 2EZ4A 4KP7A 5E9AA 3T1NA 1OX4A 5FF9A 3VR0A 2JIPA 1QANA 2ZT8A 4WX2B 1H2ZA 4D96A 4LFBB 3G2OA 1TM2A 3INNA 1D2NA 3OP4A 5K51A 5F9HA 1R5OA 4M0EA 2JG3A 2BEUA 4IGIA 2K2WA 2UXDB 3T6KA 5IK2A 1VDMA 2FG6C 2DBQA 3A1DA 4NATA 1CQIB 5JBIA 1C8KA 2QLTA 1NVMB 1USUA 2QAGC 2ZSEA 3PS9A 5EYPA 3DFZA 4P1ZA 5THQA 1R9GA 1QGUB 3A0UA 3DVAB 1YFZA 2CCJA 3MZ0A 4R1NA 4UHDA 3ZWCA 5JWRA 4F96A 3GEHA 1POWA 3RYTC 2O6LA 5K0TA 4AKHA 1GNLA 3ZE9A 2C4VA 3PQDA 2X42A 4HNAA 4DMGA 1DAFA 3RKSA 1SVKA 1Y9EA 1EFRA 1H4TA 1E0KA 2NUAB 1Q7GA 1K8QA 1IPEA 1GPUA 3IRVA 2I7TA 3DVLA 4IDBA 1FW6A 3TDMA 1F7UA 1Q11A 4W5OA 3WQRA 3BIWA 1RWNA 2AF3C 1NUUA 3CVUA 3RFXA 3VZQA 3WQBA 3QKWA 1L3IA 1QOZA 2YHIA 1W29A 1T4MA 3GF4A 4NENA 2BGLA 4PICA 4MS1A 4MYCA 1G8JA 4PLGA 1KVQA 2AI2A 5M7EA 3PQ3A 3M1YA 4CIXA 3R74A 4YASA 1FNMA 1PSZA 4O02B 2EGHA 3T1QA 4F1JA 1OWLA 5HUHA 4JELA 4Z9YA 1HQCA 2ZIEA 2GD0A 5ENZA 4X20A 1HL3A 5I45A 3VHXA 5AKLA 2FWPA 5FHQA 1Z74A 1L5GB 2V9CA 3OLVA 4R2HA 1LPNA 3DE2X 3H2YA 3EFEA 3FCSB 3L6EA 3RBVA 3SDBA 4EBFA 4O6VA 1E5DA 3LHDA 4GMXA 4YAJA 5JJLA 4O4IF 2OUIA 2Z8YA 1RLTA 3C3KA 2Q99A 4G24A 4TL6A 1PIWA 1ZK4A 1Q20A 5HKLA 2QGZA 4J1QA 4UU1A 1QIMA 4XIIA 2B30A 3PEUA 4YI5A 4DLWA 3OZCA 4AN1A 3GHHA 1WPRA 4MIEA 2W6OA 3L6DA 3NEPX 2HA2A 2FLKA 4CNBA 5CLGA 3WLAA 2EYQA 1AQYA 4MW1A 1M2HA 3IBFA 5I8ZA 4MW6A 3CURA 4KN6A 4DGSA 1LA2A 2N47A 3BE4A 1L4EA 1PGOA 1RFGE 2VZ8A 4PC2A 1ZIDA 3HMKA 4M60A 1KI9A 1DQZA 2VTEA 3L46A 4I5DA 3KPJA 2I67A 4DJTA 1KAHA 5DCUA 1KDZA 1DIAA 1N7IA 3OZBA 4MHOA 4HMPA 1Y5RA 4EY3A 4GPTA 4JJIA 4N82A 2JGDB 2LXNA 4AW9A 3BE5A 5KMGB 2HZ7A 4W9RA 3SLKA 4KREA 1E4VA 5DHQA 3QPCA 3UT5A 3FPFA 4XDGA 5BN5A 4H6XA 2J08A 3ORHA 4IJ6A 1NDUA 1ZCJA 3L5KA 3QPUA 1JI0A 2IYVA 4IXTA 2P4SA 1QYDA 1CEQA 4Y98A 1TEXA 3IHLA 1UBUS 4O63O 4URUR 1KO5A 1S2MA 3UK0A 5I4BA 1XYGA 1YNSA 3BM5A 4ROSA 5JRJA 2XXAA 1E5QA 2NNLD 1X39A 4EA8A 3C1AA 4RTRA 2ZTMA 5DM60 4P2BA 1VCNA 1KFBB 1Q7EA 5IBPA 1KWKA 2P40A 4I0WB 4M0PA 1N6RA 5HTOA 3E9YA 3H2HA 1WUTA 2XX3A 4QQKA 3H6KA 2CK3A 2YXPX 3LOPA 5L7TA 1NE2A 4YQYA 4QGHA 2XGOA 2W70A 4OHZA 4MV4A 3GOQA 4BO6A 1RQRA 5G4LA 1L7EA 1NBIA 1RP1A 4UQPA 1T9HA 1EKXA 3UJ6A 3EGCA 1NUQA 4LJYA 4J1TC 4LCBA 3ROQA 3HO1A 1L8XA 2ZEJA 4S1VA 5IU6A 3DULA 5L3RA 2UZ4A 4IWXA 3AV3A 2EXXA 1J8YF 3B6KA 1KXJA 5EKTA 3JVIA 4HO1X 4QXMA 3A4IA 2PRJA 4EX7A 2DHQA 2ODPA 4L78A 4JC4A 1CZRA 3T0FA 1M2VB 1E79D 1BHO1 4ZCQA 4ZVVA 1CR4A 1E61A 2GN2A 4QYIB 3G59A 2GXSA 1DV1A 5F2OA 5ILQA 1MO5A 1Z0KA 1JRLA 1K6EA 3JY6A 2WIKA 1W4AA 3LX5A 3Q85A 3TOZA 4HVLA 1RPNA 3BJRA 2ZS9A 3HKEA 1YVRA 3DKKA 2PAAA 3J7TA 1BD4A 4HX5A 5JCOA 2VI5A 2BM9A 3NT5A 3EZ7A 5DYGA 3T5GA 3IA7A 4D74A 5JI3E 4EYOA 5EL0A 3KOWA 4W9MC 2GUGA 3MUNA 1EVKA 3F8SA 3R3UA 2PZ8A 3R77A 4KWEA 3ZGLA 2DUWA 5EIBD 6YASA 3E9EA 3H5AA 3PRJA 4L9RA 4EG7A 3ADPA 1RQGA 2WYIA 1HX7A 4KVGA 4CUJA 3N0RA 3TZBA 5CDTA 3OZDA 1GM5A 3BK7A 1FUYB 3GPDG 1I5EA 2VUIB 4U5XA 3Q11A 4NBLA 5FUXA 5HQ3B 4I1VA 1OI3A 4AWBA 3C4QA 1X1EA 1P6QA 1KEPA 4IIBA 4BVEA 2B20A 4GGPA 2W2XA 4EYGA 5A5VA 5FBVB 1XTSA 1ECBA 2VNJA 4NMHA 4KIUA 5CVDA 3HUEA 3RIHA 3EBOA 4M87A 1RE0A 4HWGA 4B3RB 1DG1G 2CXHA 2ZXFA 1GGFA 1WVIA 1F3LA 3G2MA 1E9FA 2G0AA 4DDKA 1CR0A 1XELA 1RFLA 2AN5A 3JQFA 4YUZA 1YRQA 2Q28A 4HQLA 4C07A 3LWZA 4MV9A 2XT9A 5ETJA 3DEYX 1CULC 3ZQKA 2O8FA 1XTVA 5DV9A 4RA6B 3QU7A 2ODTX 3THOA 3A2NA 1GU0A 1ZN8A 3FGOA 5ARDA 2GPYA 3BRQA 1JYSA 3DDCA 1YD7A 3FOFC 3RADC 1VPWA 1PBTA 2VTVA 5H3HA 1AS0A 2GEUA 4X64B 2GPTA 3OT1B 2I62A 3KPYA 4R0MA 3V3KA 4N5HX 4DR4B 3L7KA 1NXOA 3BOSA 1LKZA 1SCIA 3QXHA 1QK3A 5UKDA 1E3JA 1X2BA 5DRTA 3MJHA 3OY2A 3KYCB 4LFAB 2IIPA 4MYSA 4OYRA 4P35A 2W6IA 4UVHA 1I32A 3FYDA 3E2MA 1EK6A 1X9IA 3JAKA 4J7XA 3EIOA 4RFVA 2CLKB 1LNZA 1LPPA 2QL5A 3CN7A 4FYPA 2QUIA 1EE9A 2CXUA 3DFMA 1QGYA 4B82A 1T2FA 2OXCA 3W8RA 1H4QA 2J4DA 1XL0A 2W6JA 2NU8A 1M1YA 1Y81A 1IAQA 3HBMA 2XYVA 3F71A 5EJGA 2C99A 2FSGA 4HUQA 5DASA 4ASUD 1LPMA 4BRSA 1JQ3A 1T1IA 5I01A 2C7VA 1ZOSA 2ZIVB 1NRXA 1ZSYA 3SS8A 3HLKA 2VK4A 2O2GA 3DZIA 3TB6A 4CMEC 1Y9JA 1M2JA 1S8AA 2G80A 5G3ZA 4C0HA 4EB6A 5HYVA 3GUYA 4DR2B 4JIMA 4H7IA 1X1SA 2GXUA 3EWAA 3MCWA 4NARA 2J46A 4OLFA 2JCSA 4MQEB 1LRLA 1FUUA 1DV2A 3D5TA 3OUTA 4UW9A 3FKQA 3Q2IA 3WZLA 1KH1A 4R8RA 1NRJB 2O0JA 2OSBA 4TL8A 1ESDA 3NTQA 1WZUA 3PCXA 2XKAA 2X4LA 4Q1VA 3VC7A 2ZJ5A 5CCDA 2XNHA 1IN6A 1X1CA 4EECA 1W4BA 4PYMA 4X5OA 4I50B 1MTOA 1QPZA 2CXPA 2IHYA 4MR9B 4YT5A 3MBIA 3UNXA 5JWHA 1G5QA 3I62A 3KEOA 1EVEA 2OHHA 3PIRA 4DILA 1IEVA 2HNKA 3QKIA 3SIRA 1M54A 3IR6A 2L42A 1OCEA 3QYJA 2CFRA 3VC3A 3JX9A 2WSSA 3MD9A 3PQ2A 2RBEA 1X70A 2RGYA 1DBPA 2XNCA 3FYTA 5JNVA 4QECA 2XRZA 4MWDA 2OD2A 1CVIA 2HLPA 2VXOA 1F6DA 1TO2E 2Q46A 4Y7CA 3BXZA 1BHQ1 3AR5A 2VDMB 3ELDA 3T9EA 5FCDA 3BIOA 4EFKA 2FW1A 3SJZA 1B76A 2ZTVA 4FX2A 4MUYA 6PFKA 4KFCA 3HH8A 3OQHA 2YV3A 3DXFA 4LXHA 2ZUSA 5IMBA 1V8FA 1FFYA 2WMYA 3K32A 3G7UA 2ZU0C 3CRNA 4CKYA 5ILOA 4URVR 4GMHA 2XDAA 1V3TA 5JSYA 3G79A 5BSGA 3QEOA 1PNRA 4DTCA 3AQ4A 4TWRA 2F62A 4C2AA 3N7UA 4C4AA 1SCAA 3GRKA 3GG2A 2VH2A 4H1TA 3VZCA 4KLCA 5DI3B 2NAFA 3EGVA 2I6XA 4FPXA 1EK1A 3EGIA 1P9LA 2O8CA 3N70A 4F7WA 2V7UA 3H3XA 1UBNA 3NAQA 2HIMA 4TSFD 1VG0B 3KJEA 1UIRA 1FP1D 4CFYA 3HA2A 5TMDA 4YJGB 3B36A 2B61A 2VSOA 2JAPA 3EFBA 4IVPA 3WAJA 3ICQB 1T6XA 3H9UA 4AMUA 1TQ8A 3PVCA 5EIWA 4ZEVA 5KYTA 3B1XA 3BRSA 3DZJA 3HJHA 5IWCA 1MPXA 5KVAA 1FFDA 1YQXA 4CMCA 2BFDA 3AF3A 3FTFA 4JI5B 1HEIA 1T8TA 1XDSA 4G0XA 1VA5A 5BPFA 3BWEA 5TR9A 1SBYA 3WGYA 1SOUA 3E82A 1ACMA 2BFPA 2DYKA 2QW1A 2RONA 3DE0X 5LBTA 3UK2A 1KSJA 4DMFA 1R9JA 3RANA 3O75A 5T7BA 3GLIE 1CIVA 4E08A 2QPAA 1GPWB 1OHHA 2FJUA 4N9WA 4Y8VA 4LVNA 5BWMA 2BKAA 4BNMA 5E2AA 4AZ0B 5HJ2A 4E2YA 5EWLA 5E3IA 3JAMA 3B13B 4DFDA 4LG1A 4M22A 1N5OX 1JIUA 2D5BA 3R24A 4LDQA 3O9MA 4PXSA 1RJDA 4TWBA 1TT5A 3QUQA 3D0KA 1AC5A 4BMCA 2WSYB 1ONOA 1BA2A 5EXEA 2ACEA 4NZMA 5E1OA 1JUDA 1VGQA 3ABSB 4XEUA 3SC2A 2VS1A 2WE7A 4F8YA 2DFDA 4NOJA 4CM8B 3E9ZA 2IEGA 3CM0A 3ZR4B 1PJAA 4NE9A 3NHJA 3SFVA 3ZQJA 4RMGA 3N53A 3RTAA 2W11A 1CS0A 4AY4A 3U5TA 1DC4A 2PRSA 4AF6A 1NF2A 4O0LA 4IICA 4G65A 2WJGA 2KBFA 4GE3A 5MGBA 1CP2A 1P0CA 2JI6A 2ZIXB 4X41A 5TGDA 4BMYA 4D81A 1T6YA 1XHLA 1C3OA 4HLNA 3OPNA 1NNEA 2VHVA 4QYSA 1DAOA 1P4JA 5CIQA 4EMTA 1XC7A 2AD5A 3COSA 1QTQA 3QELB 1SXGA 5DMXA 5BN4A 1Y0BA 4BO0A 2AYZA 1KJQA 1HLPA 3FUTA 4A0GA 3THWA 3V4OA 3NBKA 4KQ1A 2LBPA 1I0IA 3USZA 2NW6A 4M1TA 4GFDA 3W7BA 4JKOA 5DK6A 1TLTA 3DAOA 3UXMA 1XAJA 1L8LA 4BTVA 1ZU5A 2GPAA 2O7RA 2XITA 3F2VA 2PUTA 1M0SA 3EC1A 4YJDA 3VZBA 5L3QA 2JBAA 3CUEF 1JNXX 1JHPA 5KOYA 2PUDA 4M1MA 4BNUA 1PUXA 2TECE 2JEOA 2VCEA 3H0KA 3O9VA 1P77A 4GDMA 4ZRDA 1E4EB 3ONEA 2HXYA 1IONA 1KZ1A 2VF2A 2R8PA 2YMMA 1C5KA 3E8XA 2RBGA 1GYRA 2XWJI 2VXCA 3D7RA 4XJXA 2FP4B 4HVTA 2P9BA 3ICOA 1QIEA 3NV9A 1C2TA 3LQKA 4QWWA 5JSHA 4K5QA 1O0SA 2TYSB 2ZU6A 2DE0X 4DSAA 2DU8A 1CJSA 5DHAA 4EI7A 3B1ZA 5FOVA 5T8KA 1NG9A 3NFYA 1YGYA 3P0IA 1XQ9A 3VU0A 5DIFA 3SFTA 3R5KA 3SZOA 1Y6RA 4D6PA 1H22A 1NFQA 2HU2A 1KAOA 5HBGA 1E2KA 3R41A 4UCXA 3SSMA 3WQHA 2O05A 1VC2A 2OFOA 4NNOA 3TNYA 3PGA1 4HDCA 4ADSG 1K89A 4UU7A 3TEFA 1AKYA 3OE4A 1QRDA 2Z1DA 1QIJA 4MVJF 2G1AA 1XOIA 2JAOA 2W8BB 1L9KA 3IUNA 1PQUA 1Q3KA 2Q1SA 1A4XA 1UFOA 4ZMSA 1OREA 5D5HA 3T38A 3BCHA 4EFDA 4B4VA 1U7WA 2YFHA 4HFJA 4RS3A 3FRIA 9LDTA 5KQLA 1X7WB 1QTNA 3AM5A 1R6BX 1MQSA 5FUYA 4RFLA 1FFXA 2Z08A 4DUZB 1L6IA 1VJ1A 5FPPA 3KU1A 1ADYA 4KMRA 3WFZA 4L0DA 3AR6A 1RKVA 3PXBA 5IJ0B 4Q3KA 5FBKA 3VX4A 3IDFA 5LP1A 3RO7A 3R0XA 4PZUA 1YR3A 1I2BA 4UAGA 3C0KA 2B7BA 3JQBA 4TRNA 2ZJZA 2NT4A 1T2CA 2QI9C 3WVNA 1G8KA 1UBCA 3I3SR 4CT5A 1KEWA 2X7XA 1IU9A 1MX1A 2ZIGA 4PBTA 4QDOA 4TTIA 2X2PA 2PSHA 3L8MA 4AKTA 4HQ6A 5C3MA 3O2JA 1CQIA 1P5HA 1GGJA 4YP6A 4E2FA 2GXQA 2I1QA 2HSZA 2XT6A 3WO1A 3GEBA 1QYIA 2EQ5A 4UQLA 4Z53A 2BGTA 4YRQA 1DKQA 1PW5A 1RWVA 3DVAA 4DCCA 4A0FA 4OUDB 4WXYB 1EGMB 5LZ5A 1DG3A 4GP6A 5IRCD 2ZRCA 4FKMA 4B75A 1JJBA 5AVYA 1JG7A 2DLDA 3SY8A 1OJ7A 1RCUA 3SEAA 1YA4A 1XFDA 5BUQA 5J2UB 1LEHA 4HH4A 2M6SA 2NUAA 3K6RA 5MGNA 1ZK2A 4U7FA 2FFJA 1RS0A 3LQ1A 3A3KA 4HI0E 3BTUA 2OK8A 5EESA 1UPFA 2HXSA 3BK2A 2WIBA 5HXAA 3H2GA 4BAZA 4KPFC 3DZHA 1TO6A 2LWIA 2IF2A 4I1OA 2ZYWX 4WKPA 2H8KA 3MMPA 4D2IA 2H59A 2R85A 1ADJA 1J9EA 3GK3A 5K2OA 3CLSD 3F7MA 2ZGVA 4MPRA 4R8VA 5LCXA 2Q41A 4ABYA 1V4VA 4RAQA 2Z4RA 4UNNA 1Q57A 4LXXA 3SR4A 4HLUA 1ISHA 1U11A 2G83A 1IQ0A 3HCAA 4F71A 4CIBA 3EZFA 1E62A 4MV5A 3T5BA 1Y5LA 3CQ9A 1SCDA 2XRFA 3KC2A 4JLOA 5I7HA 4Q4HB 1APBA 1DDGA 1EFUA 3NHBA 1HXHA 2XA9A 1O6ZA 4DV6B 2PL1A 3F49S 4ZI3A 2W6NA 2R68A 4PZPA 1KK3A 2C2GA 1OAOA 4RWZA 4LTMA 1ZD5A 2NSYA 4F3KA 4F4UA 5JUWA 4GO1A 5LU9A 1PR2A 4OPMA 4FC6A 4I9HA 2PO5A 3LPNA 1ULTA 3UHJA 3PEFA 4DQUA 1OZAA 4YLGA 1FX0B 2Q0HA 3FPBA 3EUEA 5A4DA 4FP9A 1LSJA 2DTEA 3UOGA 1F5SA 1KORA 3AEKB 5HKKD 1XCMA 1Z15A 3DTNA 4RQUA 4R5MA 4ZKEA 1O9GA 2FNAA 3UMVA 2PGDA 4OI4A 4C21A 3INGA 5HJ5A 3U3KA 4WK2B 3IALA 4UVIA 2JGDA 5KMGA 5HRUA 1F17A 2H48A 1W96A 4QT4A 2HF2A 1VB3A 2X0DA 2M1ZA 3RS9A 4GL4A 3BERA 1Z83A 4MNTA 1FIUA 5LJLA 1P3JA 4OQYA 3V34A 4DKXA 4Q9LA 3WL8A 1KI1A 1NTOA 1YVPA 3EMDA 3Q7SA 1JG3A 1Z82A 4QXRA 3GDGA 4HG2A 3S1LA 2GZHA 3TW8B 3PWZA 4M9XA 2FW8A 4JV5B 4RJ2A 3R7NA 3KD2A 1JEDA 2RC5A 2C97A 1DKRA 2CDCA 5F4ZA 4JLNA 2JCYA 2ZS7A 4FINA 1JWAB 3DM9B 4Q1DA 1L1RA 4N3AA 3UUEA 4WFJA 5EVJA 3ZZTA 2V3CC 1QVAA 5EUQB 3TRDA 5D1HA 4RPIA 1KOJA 2JI8A 3FDXA 4YRGA 2PQ2A 4B7XA 1MQ9A 2RK3A 3VDRA 2IV3A 5SY4A 1QYVA 3KZXA 3F97A 4WBXC 4AY6A 2J48A 4P22A 4B6PA 3UATA 2DERA 2X0FA 1LB1B 1GKUB 1RTTA 3CLSC 3VOSA 2C3PA 1LJLA 2QQFA 2NLOA 3IHKA 5CXXA 2YY6A 4K9MA 4KXNA 3T4UA 3T3NA 2JHPA 2Y27A 2VH1A 3FJ1A 2Z58A 2QM0A 3VO9A 2YMLA 5TJHA 1M2VA 3ZNQA 3FNRA 2X9GA 1WQ1R 1D4FA 1T43A 2HEGA 4MUBA 3CONA 2O23A 1W0CA 3DFKA 3PA8A 3N5KA 2QTMA 1VXRA 1B6TA 2X15A 4QYIA 4CM4A 1XRQA 3JV7A 4FMDF 2CSUA 1XVAA 2ZT6A 1ORIA 1X7ZB 2ZITA 4OF4A 5E38A 1NYRA 4K6OA 4AZ3B 2FCRA 3P0EA 5JQWA 4RYLA 4OQQA 4ZI5A 1C29B 4YV0A 3QOFA 4ZO6A 1H5NA 1KK1A 2BFWA 1J8QA 2P2YA 1NU8A 3JZAA 4GSKA 5FBRB 1DWUA 3VR6D 1Z35A 2MSCB 2QR2A 2WLTA 1SU4A 3PJDA 3PWTA 5HCNA 3W5DA 1RMYA 4B1FA 4IHJF 5EP4A 1RXVA 5TPZA 3TFWA 2G17A 4MRSA 3KSRA 4RTPA 1X42A 2BDTA 2RCYA 3B2NA 2L69A 3CEAA 3AW9A 2MSWA 1CU1A 3R8CA 3RS8A 3UAGA 1VQ1A 4BC1A 3WGKA 5HQ3A 3ODGA 3CVXA 1BX0A 3O26A 2YJZA 4O5OA 1J24A 4M9SA 1O94D 2QJFA 4N3BA 4ENVA 4J3JA 1H9BA 2BTEA 2GRJA 1O2DA 1GCOA 2A5JA 5LVAA 3O8NA 1F8YA 2I2BA 1IBRA 4DWOA 1YA6A 1M5UA 5REQB 3QW4B 3FKJA 4R1MA 1QIKA 1VLVA 2FX3A 2IYWA 4G56A 4YXWA 2R97A 5CMLA 1E96A 3UWMA 5JJ5A 4J8PA 4E15A 1UQTA 3GGSA 1AHNA 1L5ZA 2G76A 5AP9A 2YJ4A 3ZS9A 1P4RA 3TINA 4CT4B 4WZ6A 4QUDA 1HE2A 3AI1A 3ZIDA 2Q1UA 3TLEA 4I55F 4XX0B 1OAKA 3RS3A 4BFVA 1DAGA 1HNWB 4FFWA 4HB0A 4G5YA 2ZWOA 1CY6A 2Q2WA 4WBNA 3CVOA 3OT1A 2PUWA 3RJZA 1BROA 4O3FA 4FSHA 5TARA 4ZT5A 2QTAA 2EG9A 4LRQA 1GNPA 3RUCA 3K72B 1Q6YA 5FIUA 2W83A 4H1HA 2ZBPA 2HQ1A 2COEA 1AG9A 5KNDD 4ZAFA 4EDHA 2YICA 1NAHA 3BWVA 3P9KA 3KYCA 3OVMA 5L9AA 1KH2A 1PK8A 4JWTA 4LJLA 5DHRA 1DMSA 2BTQA 1ZD3A 4C14A 5D3KA 5CBKA 1JB9A 3HWWA 1TECE 1V9CA 1VI6A 1TLLA 1G8MA 6CHYA 5GIOE 1EESA 1GTVA 5LA6F 1Z3CA 1EDOA 1EIZA 4DLLA 2ZB7A 1S3FA 3K96A 2Q7DA 4XARA 5F5LA 4HYYA 1PGPA 4YMGA 2ST1A 1GL6A 1C50A 1OXTA 1R64A 2NUBA 3CLTC 4UDNA 5DWQA 4GI3A 5DT2A 4G2NA 3HK2A 4G01B 2O5EA 4N4AA 4YGYA 2OGUA 1E3QA 5FLKA 1Y1SA 3TTWA 3OI7A 4MDFA 3IYLW 1G6HA 4WKCA 1GYPA 4BS9A 5D86A 1JQDA 1BQ3A 3HGMA 3DV9A 4MQEA 3GBPA 3NVKI 4EIWA 2J5XA 2JLZA 1J5XA 1SKUA 2EL7A 4HLDA 4G0ZA 3ZIAA 1NR1A 4PF1A 3ZZ0A 4DBZA 3ROGA 3TCNA 4I50A 4D4HA 2ODEA 3LZ6A 4ZANA 3BGOS 4MR9A 5AJHA 4AKIA 1GV0A 1L5VA 7ADHA 2JGKA 5KTPA 1F2VA 4KQFA 2P2CA 4NZNA 4B31A 2HSWA 4UHHA 4CPDA 1EJBA 1JHDA 1HE3A 1I2MA 1NI3A 1RHMA 3A04A 4JQYA 4NEHB 2G8NA 2LIPA 3BQMB 3BHIA 3ELWA 1YB7A 5HA5A 1I8TA 3PT5A 3DR3A 1ECCA 4LHYA 4KR7A 1ODLA 3P9YA 3RIMA 2A9KA 4TT3D 1BKDR 2NM0A 1B0UA 5LZ2A 1RHKA 3HDQA 3DDWA 1CF9A 2JFVA 1EFHA 3ML1A 4N9QA 3SZ3A 4I6GA 1DU4A 1BGVA 1WXIA 1YZKA 1Z4JA 3SX2A 1FRVA 1DUIA 2FU5C 3L0OA 2Y1GA 4UC0A 4DA4A 4ZEWA 2F43B 1NWHA 1KK2A 1Z22A 2B78A 2OTCA 2YXNA 3RC8A 4B4WA 2BAGA 2QUBA 4FQ8A 2Q2VA 2IGBA 3V1KA 2W93A 1T4GA 3FE2A 1KOLA 1G9XA 2W4QA 2J7KA 4MMXB 3TRFA 3O1JC 1CUBA 1SZCA 1TAUA 1JWBB 3L4SO 2CY0A 1H0HA 3DMGA 1QMGA 2F1JA 4ZHQB 2YHUA 5ALKA 1L8OA 1SEPA 1D3AA 1I4LD 4IG9A 4E21A 1ZONA 3Q1KA 4OQPA 4E0BA 3RQIA 3C6QA 3COPA 4PFSA 5DI3A 5IVIA 3WY9A 2HMYB 2VP5A 4FHDA 4ARIA 1P1CA 3D1JA 2QYHA 2I99A 3GA7A 1JFFB 1EFAA 3FBGA 4IOKA 3GVPA 4IQ0A 3L4JA 4Q9DA 4U02A 1TTQB 4KXVA 2V6MA 4Y30A 3QPBA 4YJGA 1C8BA 2AQ8A 3T0GA 2F4NA 3V00A 3I39X 3SPXA 4BZXA 1VRCA 4F11A 4OXYA 1I7PA 1PT9A 5FV4A 4LQLA 4UD2A 2XZTA 3NPAA 4YRRA 2Y6UA 2Q4EA 4UZFA 3IQWA 4GT1A 2P9CA 3PLNA