2MT9A

Solution structure of holo_fldb
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
173
structure length
173
Chain Sequence
b'MNMGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPKLMEQYDVLILGIPTWDFGEIQEDWEAVWDQLDDLNLEGKIVALYGLGDQLGYGEWFLDALGMLHDKLSTKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQSWCEQILNEMAEHYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin-2
publication title Long-chain flavodoxin FldB from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Electron transport
total genus 56
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2014-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2mt9A00
2OYSA 1SQSA 5ULLA 3KAQA 1H69A 3ESZA 1X77A 3FW1A 4ZVKA 3FNIA 3NHRA 3L9WA 4LAFA 4BMPB 2QX6A 5TGZA 4C0XA 4QOGA 1AKVA 2FDXA 2W5UA 1FVXA 1E5DA 3B6JA 1ZX1A 1YRHA 2X2PA 4U7HA 3ESXA 1AKWA 2OHJA 1OBOA 4FGJA 1RLIA 4ESEA 1FLVA 1T0IA 4U7GA 1AKUA 3F90A 4YALA 4DILA 1DXOA 1FLDA 1VMEA 3TZBA 1CZLA 4M0CA 1NNI1 2Z9CA 4QODA 4D02A 1AG9A 4HS4A 1CZKA 3NHYA 5LLDA 4QOEA 3NLLA 5LVAA 4N9QA 1WSWA 3L9XA 4U7FA 1JA1A 3U7IA 3N3BC 4PU0A 3NHJA 1FLAA 1YOBA 1RCFA 4YAUA 2Z9DA 3N39C 2KLBA 5EA2A 4ZVNA 3TE7A 4C0WA 4H6PA 3W77A 2OHIA 2QX8A 3NHFA 1F4PA 5EAIA 2RG1A 2AMJA 3OX1A 4LTDA 2V5UA 3GAMA 3B6IA 5FX2A 4LTMA 1RTTA 4OXXA 2A5LA 1YCGA 1TLLA 4YQEA 3KAPA 1OBVA 3D7NA 1I1OA 2BZSA 2HNAA 3KEGA 1FUEA 4H2DA 4GQIA 1WSBA 2R97A 1CZOA 1KBOA 5F4BA 4C76A 4FX2A 1JA0A 3W79A 2FCRA 3HA2A 1ZWLA 4ZVLA 2QMZA 2FZVA 1AZLA 5LBTA 1ZWKA 3F6RA 1QHEA 3NHKA 1FTGA 1KBQA 1V4BA 1AKQA 3ESYA 2FOXA 4PTZA 3OJXA 4LA4A 4N65A 3QFCA 4Y9RA 4BMOB 3F6SA 4YAOA 2MT9A 5B3LA 3N3AC 5FUQA 4NLLA 4YAWA 3OWHA 1J9EA 3HLYA 3UXHA 1OFVA 5JROA 5F51A 1AMOA 5F12A 1J9ZA 3F2VA 3ZHOA 1D04A 1AKTA 4YAFA 1CZNA 2WC1A 2FVXA 3LT5A 4GR9A 5LJIA 1YDGA 3QFRA 4S24A 4QOHA 1D03A 3S2YA 1QR2A 2BPOA 1FLNA 4GI5A 5LMCA 2HPVA 4NULA 3O73A 1C7EA 2QX9A 1DX9A 2MWMA 3P0RA 3B6MA 1XYVA 1AKRA 1GG5A 3O2NA 5LBUA 4CF6A 1H66A 4QOFA 3B6KA 3OJWA 2B3DA 4QOIA 1SG0A 1BU5A 3R6WA 3SVLA 4J8PA 1BVYF 3GFRA 1YCFA 3EDOA 4ICIA 3OVMA 4HEQA 3KLBA 2M6RA 4LTNA 3GFQA 1J9GA 5B3KA 4XDHA 2ZKIA 2FAXA 2QR2A 3FX2A 1B1CA 2X2OA 4C14A 2OHHA 2FZ5A 2QWXA 2Z98A 4Y7CA 1RLJA 2XOEA 3G5MA 3NHUA 2N1MA 2Q9UA 4F8YA 5BUCA 2BN4A 2BF4A 5EMNA 2D5IA 5NULA 2HNBA 1C7FA 4N82A 2KQUA 1QRDA 2QMYA 5LJLA 4CETA 1YCHA 2R96A 3EYWA 3W7AA 3FVWA 3UXEA 1J8QA 2V9CA 2XODA 2F1OA 3K1YA 3LCMA 3NFRA 4Y9UA 1T5BA 1AHNA 3RPEA 2GSWA 2MOKA 1XT6A 3GFSA 3JSXA 2Q62A 1XYYA 4FGKA 3FJOA 2V5VA 3OX2A 2BMVA 2M6SA 3NHPA 4XDGA 4FGLA 4DIKA 3NHWA 1CZHA 3U7RA 3K20A 1CZRA 3W78A 4PTYA 2ARKA 3TEMA 1XI2A 3OX3A 4DY4A 2QX4A 1YKGA 3QE2A 4ZVMA 3OWXA 2FLVA 3ES9A 5NLLA 1FX1A 1TIKA 1CZUA 4QOJA 6NULA 2MTBA 2Z9BA 5FA6A 1QBGA 3NHLA 2FX2A 3HR4A 5A4KA 1DXQA 1D4AA 4R81A 3NHSA
chains in the Genus database with same CATH superfamily
4BQNA 3PXXA 4DG8A 1V1RB 2GAFA 2POQX 2Q3DA 3ABOB 3VJLA 1OGIA 1OZGA 4WXHA 1UT5A 2QD1A 2GOYA 1VP9A 3EVFA 1SB8A 3OZWA 3M6XA 3PGJA 4GBMA 4DFDA 1ZCBA 2XGSA 1HORA 3DWIA 4F71A 3U48A 3RT1A 1TJ4A 3C48A 2ZAMA 2WSIA 2XBUA 4OFZA 4K9QA 5FI1B 1BCSB 1E0JA 3D6HA 4R16A 2EW8A 4CCYB 4U7TB 3UCFA 4BQSA 2D59A 1M0WA 1SCNE 4MI9A 1MDBA 4HAUA 4UAUA 1P72A 2Z6VA 1F6WA 1LNQA 1Y3AA 2Q2VA 4LRXA 2FLKA 3S1AB 3U26A 3QE4A 4KGDA 2QX6A 4YGYA 1OXVA 1NXOA 4RU1A 3CLTD 3HU3A 3UWDA 3F9CA 2PJZA 3E84A 4E30A 1P2FA 1CF9A 3WRYC 1G9TA 4XWYA 4B76A 1USIA 2J9ZB 3ENQA 5EE0A 4FKMA 3ZK9A 1RJDA 5HBGA 1D6SA 2AQKA 1UBOS 1EK5A 2DP4E 1PW7A 1ID8A 2FMTA 4LXGA 1V4NA 3K92A 4W9NA 4ZQEA 4P0PB 5EMKA 4FCWA 5HG0A 3PNSA 3SS8A 1HE1C 1T8TA 1TCAA 3KB8A 3NRCA 3QU2A 2HYDA 3B38A 3TTUA 4FT2A 3OPYI 4GXNA 3H5OA 3KT3A 2TMKA 2EBHX 1H94A 2Q3FA 1PP4A 4J91A 4B6OA 4JB2A 4YREA 1JAXA 3C70A 4X62B 3IR5A 4Q4HA 1SKUA 1YOVA 3PLNA 3BS4A 3NVDA 4HDRA 5A3QA 3G85A 1E62A 3KB6A 1KOJA 5ERXA 3ICCA 1QHNA 3H1FA 2RI6A 4R1PA 1KOGA 1O95D 1VG9B 4A8TA 1Y6ZA 1E2IA 5I9MA 3DB1A 5U4QA 3NTQA 3OIWA 4NWIA 3F9RA 1O77A 2Z2IA 3TZBA 1T8RA 3HFJA 4CKEB 1MX5A 1FL9A 2ZJ8A 3VO2A 3CCBA 4AROA 4Q9NA 3AVPA 3CWQA 3EQ2A 1QPZA 4MIKA 3ISJA 4D02A 1BX1A 5AJHA 2OXFA 4PG4A 3F8SA 1DAKA 3ZHVA 3I0NA 1ML3A 5IK2D 3QEBZ 2P7IA 2PMWB 4QEDA 2JEOA 3RANA 1G0OA 2NU6B 1Y5RA 5DM0A 4ZA2A 4B9AA 3ZK7A 1TM2A 3VDNB 5JJKA 4KPUB 3FOAA 3T3MB 4BNXA 2DBRA 5ITZB 4JIMA 2J7PA 3QMWA 2Q21A 3PCXA 2BM0A 2AWOA 2ZYIA 1YZVA 3PEFA 4KVAA 2Z8YA 2ID8A 3HUEA 1OW3B 3GRUA 5HILA 5HF6A 3ZBTA 1T5SA 5EIBC 3RRXA 4ETNA 3SVTA 1ZJWA 1BMFD 2KPOA 4IVPA 4H1VA 1HFKA 2ODPA 2PANA 3OQ1A 1UDWA 4Y2YA 5DNVA 3VYTB 2GAOA 3CUUA 3DYBA 2W2XA 3DBLA 2FJ0A 2PU7A 4JBLA 4LXUA 5E0OA 4MV8A 4H7IA 5BSTA 3N39C 4BZQA 1KMNA 2P30A 3HVKA 3T4UA 1UF9A 2CNDA 4IXNA 4PG5A 2IYTA 5EHIA 5J2UB 3IUMA 5J9FA 1JFSA 1B00A 2B25A 2OP0A 4WHMA 3A9CA 4LDJA 4M86A 4NICA 3OKCA 3ZW8A 1H2WA 3PHIA 1CY6A 4UFPA 4ZQIA 3R9XB 4WBSA 3EFOB 1KYWA 3DE7X 2QK4A 1GILA 2C7PA 3RK0A 2VXCA 1B93A 1R12A 4C2BA 2YY7A 3EGEA 2LTAA 1PR3A 2PZLA 1MH9A 1LBEA 2PNJA 4I4LA 3Q5DA 4IDCA 1DEOA 5BN5A 1XXHA 3FBWA 2YWGA 2IH2A 3HB7A 4R8SA 1QOZA 5FOTA 3HBLA 3MWEA 4NNJA 1XRNA 2W0SA 2GZRA 3LZ6A 3MSXA 5DF1A 1NU8A 1CK4A 1L5HA 4PLWA 2P6UA 3NG1A 4AZ0B 4AY4A 3B2EA 2C4UA 1GN9A 4HMOA 3PPXA 1GG2A 5I48A 2C07A 2II6A 2OOKA 4WFJA 3CZRA 1QR6A 1RXCA 5A9SA 1WMDA 5JXIA 4DUYB 4BZZA 4BQIA 3LL4A 1RP7A 3IKLA 4L7QA 5BW5A 1H3EA 4A26A 3UAXA 5AKKA 4EI9A 1AB5A 3OTIA 4M98A 2QB5A 4C05A 3TSWA 4QZVA 4IOJA 1AC5A 1DE0A 1KYIA 5TGTA 2QRPA 3ND8A 5HZGA 4X3CA 3L7JA 4O5OA 1IZZA 1WXXA 3FCXA 3PNOA 5K2MA 1UIRA 5C4GB 4YJHA 4C89A 2JJQA 3PLAE 3W1WA 2AG5A 3TVTA 1EK0A 2PSSA 2VT6A 2Q2OA 1L7AA 4GSYA 1U0JA 5EYPA 1C81A 4WZAB 4ID9A 4CGZA 5BOVA 3Q3EA 5JYCA 5ARDA 3WMGA 3L0CA 4OQEA 4Q3NA 4G4JA 5BR8B 1WM1A 1XZBA 2J0QA 1VLMA 4TT3D 4DLPA 1E9DA 3GA7A 2EFEB 2PKQO 3RGGA 3DTVD 3SR4A 2XUJA 1T91A 1QUFA 2O8CB 4ARVA 5CT9A 4YFVA 3BXEA 4Q9DA 2AEFA 5CAEB 3GCDA 1WETA 4C6HA 5JS7A 1I36A 2IY8A 1MABB 2C5EA 3SEFA 1J97A 3KT6A 1L7MA 3M81A 1FFXA 2V98A 2RHDA 3IP1A 5EIBD 1T0JB 4WTOA 5IN4A 3F6BX 4Y2RA 1NVTA 3FLBA 3IXLA 3ENVA 4PR3A 3NTOA 4RGVA 4YAGA 4ZN6A 1THTA 4ZZ0A 4BHTA 5JECA 2YXDA 2RGWA 2R7MA 2R2AA 3GLIA 3QUAA 4JZKA 4RM2A 1N8NA 1B23P 5GOTA 3JQCA 3HADA 3AUXA 1ESDA 3OE4A 4NXNB 1NSTA 2QRVA 2X15A 4IV8A 4XYBA 4PYLA 2KHZA 4KJZA 1JR6A 1R0RE 3EVZA 2IHNA 3A6GA 4CTOA 4AJEA 1B6RA 4OXIA 2R84A 2CHFA 4WI1A 4LY9A 4NK4A 1NASA 3NXKA 1IULA 2C9OA 3U17A 4JLJA 1J22A 3KKKA 4ZT7A 2R8OA 3SE7A 4URZR 1XL1A 4P54A 2IITA 4D56A 5J4LA 3U31A 2WAMA 4ARZB 5JJCA 2AI3A 2H1HA 3M5DA 5BMOA 1AGRA 2OXCA 5JROA 2I76A 1A2KC 3M89A 4KBFA 6REQA 4QARA 1GYPA 4M1OA 4EITA 1VE7A 3SOPA 4KIGA 3SKXA 1Z82A 2W48A 1QDEA 4JLVA 3REOA 3W5UA 1Y8CA 3X1YA 4EKGA 2HPZA 2VUIB 3WQHA 4F5EA 2XIQA 4AKHA 1QNLA 1V8BA 4OTZA 4B44A 2COEA 1Y6FA 2E4YA 3KK0A 4YDRA 1WMBA 2OSVA 3GHHA 4WN9A 1KK3A 1Y5MA 1NHWA 3R3WA 4RW0A 2IV2X 1ULZA 2HGZA 2WD7A 3ROZA 2VWQA 4QXMA 2G77B 2XUHA 4RTOA 4PVCA 3X1KA 4MW7A 2P2DA 1YUBA 1JKJB 2ODQA 2YMMA 3QVGB 3RSQA 3G9UA 5AKGA 3PQCA 1O03A 1WZEA 4DXHA 4E5YA 2IBSA 3JQFA 3SX2A 1DBVO 1KFBB 4K3UA 1Y9AA 3ORYA 2WJZB 3CZ9A 1KF0A 4UXJA 2VJKA 1I7PA 4BBZA 1FNBA 4A03A 5J4VA 4KXLA 1FQJA 1T1RA 2G1UA 1YA4A 2Y4OA 3I2FA 3R0VA 4EW6A 1PWXA 4JJFA 4LMAA 1Z5NA 4K0RA 5IJWA 4KYUA 5CM2Z 1U3FA 1FFDA 1Z2CA 2P9YA 2Q0QA 5IM4A 5TMDA 1L5ZA 4C20A 1HWYA 4CF5A 2BAGA 2I1WA 5M29A 2C5AA 5LYJF 1EDEA 4WVFA 3F3MA 5KINB 1NUTA 1EH5A 1WZNA 3HB1A 3RQSA 4MW5A 3P0RA 2NUPB 1KZHA 1HPLA 3D8SA 2FMIA 3AV3A 3E48A 3EHDA 3OCVA 1DRWA 1U2RA 2OQ2A 3V1LA 5JBIA 1JHXA 4GNKA 3HCCA 4UUQA 1X1QA 5BYJA 1K6JA 3NC1C 2OHVA 3BWDD 4ZEXA 3USCS 3ZE6A 4LYYA 1QJ4A 4LHSA 5CVVA 1GZSA 4MGIR 3TKAA 4ECEA 2JI6A 1FF9A 2EWMA 2BE7A 2FSVC 2O7NA 4B17A 5H8WA 1SRRA 1SG0A 5EG5A 1KY5A 5DRYA 1SB9A 2O2SA 3M82A 3RAPR 4YO7A 3TIVA 3X1XA 1E1QA 4DR2B 2CVZA 3IAHA 5AVYA 1INLA 1VHDA 1C1YA 1L5MA 2QP4A 2RKWA 4P98A 4DV4B 3HO1A 2YJ3A 4IIBA 4QEKA 1ZJ5A 1W36C 1DQNA 1BC5A 1Z47A 2G4VA 1Q92A 5H59A 5IVHA 3C5CA 1HC7A 2BBSA 1FYWA 2JRLA 3DZCA 3UGKA 1OFTA 1S3GA 3R7NA 3JYPA 2J5RA 5JNVA 4DV5B 2Z1MA 1M83A 2VT3A 4JQCA 1KJIA 2NV2B 2AGVA 2XOKD 3FE2A 3HB0A 3JQAB 4IX1A 4QA9A 4YRTA 3FNQA 5HW0A 1H05A 1FVFA 3EGWA 1XXHE 4FC6A 1MHPA 2XW6A 3TRKA 3K3PA 1Q57A 3RBZA 5K3OA 4CM4B 5K8UA 1IVSA 4GI7A 4JVNA 5JZBA 1D2EA 5CJJA 1PZFA 2H8KA 3D4BA 4IDQA 1U8FO 1KKMA 2XWPA 3QF4B 4HYTA 4NENB 3W5JA 4XRGA 3BL6A 1XZGA 4CE6A 5CBPB 3DTTA 4P0QB 4NECA 5M04A 2D3TA 4HI0E 4M1MA 2Q0HA 4GMXA 4BRUA 4BJ1A 2OCXA 3VKHA 1XTTA 3QI2A 1BEZA 4X1KA 4ZO9A 5E8JA 4MJ7A 4BNVA 3GU3A 5BV7A 1Q0SA 3TR5A 4PPNA 1H4TA 4BP9A 2WHYA 2GUWA 4WD3A 5IHXA 1PYOA 2PCLA 1K8ZB 3S68A 4BECA 4ZHQA 5HKKD 5LU9A 2CUTA 4BRWA 1U5BB 3C85A 3DOFA 2BGKA 1E94E 1KP2A 2AJTA 3NBKA 3JWJA 3PPVA 4QICA 5FWXA 2NU7A 2BI8A 4I50F 3B1FA 3LDAA 4OXKA 1LSOA 1W25A 2FXVA 4K9KA 1XTPA 4LY0A 2ZVQX 4ER3A 3U44B 3QV2A 3RKSA 2DFTA 2J4CA 5A5EA 4JLSA 1MDFA 2PUJA 2PVSA 4E12A 4KODA 4A6EA 2JLVA 1T9DA 2CXHA 2JBAB 4ENPA 4U3JA 2H4WA 4BKQA 3RYTC 1PJTA 1BSVA 3IBYA 5NULA 1G59A 3IESA 2WU0A 4FDMA 3W8DA 4DV2B 2RIRA 3GELA 4R8VA 4XM0A 4I5FA 3FOWA 3AUYA 1E6CA 3B2NA 1O96A 4TWAA 5KJFA 4LF7B 1XGKA 3LT1A 3U3ZA 3EYWA 2BE9A 3BE5A 4M22A 4TL7A 4N3BA 4D5GA 1TNDA 4R71A 3UJNA 4IKPA 1MG5A 2VDOB 4WASA 1A82A 5JAOA 5LWHA 3H42B 4OKNA 5JCOA 2Z09A 4G4GA 3GLIE 3PFNA 3UJHA 2F1OA 3C0KA 3HXQA 3FR7A 2C7OA 3PQ5A 1TVMA 1QHHA 3E2PA 1Z5GA 2CNLA 5DCYA 3GQBA 3T0FA 1CY8A 4UDXX 2OGUA 5FA5A 3O9MA 3SJUA 3MWLA 3EMVA 4D1YA 1T10A 4QXAA 1XO1A 2A1TR 2UZ1A 4LZZA 4BNHA 4KHPB 2FCAA 3ZBPA 3PQ7A 5B4UA 3DDOA 3PEYA 2IIQA 1ZI8A 3CH7A 3BWBA 3MBOA 5D3KA 1TVCA 3OEHD 3V55A 5DYTA 2FR8C 4H0FA 4JQZA 3N58A 3TL2A 1IE3A 5A1JA 5K01A 5DGTA 4AS1A 2C4VA 1DDGA 4CMIB 4P32A 3BF7A 3FCUB 3BUSA 1Y6QA 4LXYA 4TXNA 1BVRA 4AIIA 1TMKA 2WM8A 1T3GA 4R1TA 3VTZA 2HLHA 3UMVA 5DHPA 3UWMA 3ICPA 1IH8A 2EQAA 3CH6A 2G9VA 3ECAA 3TIXB 4UTRA 1WCV1 3ZZ0A 5HJ7A 3ZNQA 2FRVA 3BH7A 2QMUA 3Q6MA 1G38A 2IGTA 4M1WA 4E1BA 2D00A 2WWVD 3HEBA 4NDNE 2VEOA 4KDCA 4C03A 1QKJA 2QBYA 3NCHA 2DSNA 1B26A 1OZAA 2FQWA 3IPXA 4DC1A 3NNDA 3ZK8A 1UEIA 3IP8A 4B4VA 1H2BA 1K27A 3O21A 3BTUA 4H0CA 4N0PA 4RK5A 1CR6A 3QW2A 2E4UA 1ADBA 3TEMA 3ZZMA 4WPGA 1E1LA 2QL7A 3GK3A 4RMNA 3WSVA 3FMOB 4MWBA 5EY5B 5KNDD 3GV0A 3HUDA 5EUQB 3OWXA 3X2SA 4CRWB 1QFZA 4B8ZA 2H1FA 4FHCA 2XQIA 2RK4A 2UYGA 5IEJA 4L5IA 4EJMA 2H2DA 4Q05A 2FGJA 4J0KA 3C15C 1OB2A 4Q7EA 5EXSA 4BZPA 5AT1A 2NO5A 2CFSA 3GY0A 2DB3A 2R5NA 3DD5A 3VSDA 3CX6A 2VNKA 5JYDA 2PKYX 1B8VA 1DV1A 1GR1A 1HM5A 3THWA 4P5DA 2WINI 3IJ5A 4G26A 4UMEA 1ODCA 3GPDG 3C3EA 5K8VA 1X9HA 4IWYA 1DTWA 2QTMA 4BGUA 1KQGA 3RF7A 1P60A 1Q77A 3FR8A 1AZTA 2O6LA 2ODBA 2ZYSA 3FZNA 3NKVA 5D7BA 1JGTA 1BX3A 4KLAA 3JD3A 4EJSB 5EUBA 4Q34A 4BYMA 1R27A 3A7DA 3DBLB 2Q3BA 2Q50A 3I1YA 1WPXA 1F5SA 1ZY2A 3MT8A 3MW8A 3C7DB 5ALNA 4C43A 5MN4A 1XD8A 2E87A 2H2AA 2QM8A 3IERA 1VSTA 3WYCA 2JHAA 4ZGWA 3NHSA 1H2XA 3FCSB 1WB6A 4RORA 3V8VA 1AUXA 1HT0A 1XHLA 3R40A 4NZZA 3SKYA 2JAXA 1YUMA 1U1GA 3FAKA 3PFCA 5AK3A 1YFLA 2MDTA 4P9NA 1O6GA 2HSZA 4TUYA 4Q1CA 5KKNB 3RADC 3I9JA 3TM5A 4NMMA 2HU8A 1VDZA 2ORWA 1DRKA 4FTWA 2EKBA 1ZN2A 2X8LA 5B2EA 3E1GA 4QUEA 4EJSA 3LPAA 3O9VA 1SCIA 5AJWA 2PA3A 2GM9A 4EQ6A 4US1R 5LLTA 3PGMA 4DUZB 1H6BA 1NIPA 4BFZA 3VXKA 3WGJA 3ZY3A 1AVTA 5E4FA 4Q1FA 5G0WA 1C80A 2MMCA 3K0BA 5JIBA 2HF7A 4DC0A 2UVPA 1MCZA 4Q93A 2IHBA 1MMFB 3DFKA 1XUOA 2CEKA 2J6CA 2NV6A 4GAEA 1CFZA 4LAFA 3B1ZA 3RU7A 5HZKA 2XXAA 1XVVA 2ZUFA 3QG1A 2M2IA 1JUDA 1IZ0A 4U4AA 4ZQFA 5L3RA 5BWOA 1RKBA 2FDXA 3EXEA 5LMNB 1SHUX 2PKRA 1R1DA 1Y3CE 1UDBA 2W5UA 1NBWB 3RYHA 5ENZA 2VPQA 2G9QA 4O4IF 3GJRA 3AIMA 2WUFA 4YRAA 4YJHB 1JWLA 3LVFO 2JHPA 2X2PA 3E9NA 4NYMR 4Q3OA 1TEZA 1K5GA 4BKOA 2FYTA 4AJ2A 3QP9A 4IDBA 1UJ6A 1A69A 2D1SA 3I6MA 4FGSA 1HURA 4YP7A 1ZGGA 5JNLA 2OQVA 2QDKA 5F5LA 1W35A 5GINE 2WKSA 3RBVA 1XVUA 1UK7A 2WF5A 2XF8A 3V4SA 4XQGA 3URKA 3CURA 5A71A 3ZVNA 4LWPA 2CT8A 2IODA 3DEFA 1MGOA 3BJIC 4HWRA 1GL6A 1X2BA 2B1IA 5DTRA 4YXWA 5LZ2A 5CFRA 3KKLA 4KMSA 1E79D 1XJCA 1D6MA 1ZOLA 4Q1VA 1RPNA 4AZWA 2RHJA 5SYMA 3LWZA 2GPTA 1T25A 3ZG6A 2Q6LA 4ZYVA 1P62B 3R7AA 1KKUA 4ZCLA 3NHYA 3U4HA 4CM9A 4YECA 4RIEA 4HOYA 3U6KA 2NLOA 4HNQA 4BN5A 4WCVA 4ETWA 1E77A 2QRVB 4KQCA 3O31A 3AT1A 3PZRA 1CVIA 4JJ7A 1QM5A 3TLGB 1N3IA 3C6ZA 4PZZA 1IM2A 3UPUA 2YDXA 2GXQA 1EHIA 3BWVA 1T8YA 7REQA 2B2NA 1I33A 4RHTA 5FJIA 5KTYA 1CCWA 2JIZA 3N53A 4YUWA 3UYKA 4W5WA 5AM4A 4ZARA 4EHNA 2GN1A 2YZ7A 3A4YA 1K9VF 4L3OA 3V8MA 5JHGB 3LX4A 4KQ2A 3A3PA 5C7LO 3HZHA 2HV9A 4J07A 4V3CA 5AW1A 1V8ZA 1OLOA 4KEAA 4QYXA 4CQMD 1TXGA 1T5LA 1BWQA 2XMPA 3ZHQA 1G20A 3N2GA 2DBQA 5KYGA 2R9VA 4PZAA 2QLLA 2QYTA 1MN6A 4IINA 3RO7A 5WRFA 1EGMB 3R4VA 1I0LA 2ONJA 1EESA 4B82A 3KSDO 1J0DA 1XCJA 3TQIA 1R0ZA 4RD1A 2C5LA 4G5XA 1J5PA 1RM5A 1Y8QB 4JB3A 4WN9B 5D00A 1KC3A 1JZQA 5KJCA 1SXPA 2PUCA 2OAQ1 1P5ZB 3DP7A 3RS8A 4DLWA 3INTA 4LTMA 1I51A 2ORIA 2B5OA 3UK2A 3N2YA 5BR4A 1NNUA 4GKJB 2QJTA 3F4BA 1PN3A 2B4TO 3UVEA 5TLSA 3Q7PA 2OK7A 4D80A 5H68A 2E5WA 2XNDD 1WF3A 3BICA 3DEJA 3EWSA 4RAQA 4W9NC 4WK6A 4UOQA 2DFVA 2P9HA 4LS3A 2FSFA 2O1XA 3HCBA 4IQGA 1NDHA 3RYFA 1Z8DA 4XVCA 4C0QC 3WLHA 5JD4A 2A4KA 3HL4A 3I3OA 5LZ5A 3RSHA 3GT3A 3L8FA 1II0A 3CBGA 1OBHA 1NZJA 1T8SA 1U0TA 1UPCA 1ZCZA 3Q0IA 3L4SO 4HJXA 5I7AA 1O1YA 1VRCA 1D5WA 1NL3A 2R47A 3M5PA 4YJ2F 2O8BA 5CVEA 5EP2A 1HF3A 3AF3A 5ADHA 2FUNB 5BXQC 4KE7A 5FUXA 2I67A 2NNWB 2XMZA 4CL8A 5U1PA 1JP7A 4MS1B 1PGPA 2AG8A 2DJIA 2EYUA 5I4KA 4BRZA 5JI2E 3I73A 3U1BA 1W0CA 5FLXA 2F17A 2FGKA 2V7BA 2O2JA 2EW2A 3DBVO 4JJGA 3CKKA 5KCMA 3CNHA 1Q5PA 2DRIA 3EZYA 1JFRA 4EPXA 4KP7A 3IQXA 1JHVA 2QN1A 4B75A 2JI4A 1G64A 3G79A 5H9WA 3C87A 5JJ5A 4FB5A 1HZJA 4D43A 2JLBA 4F46A 4L16A 5FCDA 1AKQA 1KR2A 4MZXA 4Y0AA 4F3YA 4KQ9A 2JBWA 3HV2A 4HNSA 2D8MA 3F9IA 3G2IA 2YXPX 4MRRA 4AY6A 3W4KA 5MN6A 3PVCA 4OFXA 4JP3A 3ILVA 4RVDA 1YQTA 3DZIA 4X71A 1SA0A 2ZGVA 4BE7B 1DPFA 4JBGA 2C54A 1M8KA 5AW4A 2B83A 5EINA 5LQUA 3NWPA 4B4KA 4L9RA 4G0XA 1EUCB 1IY2A 5ALEA 3TVYA 3CRQA 5A7FA 3VJRA 2AZTA 4PLTA 4CZ2A 2PL5A 4NMHA 4QQFA 3FOEC 4ZYYA 3ZBQA 1Y3DE 1T36B 1JDBC 3EIXA 1AZSC 3RFTA 2HFJA 4NLLA 5DSTA 5IXJA 1O4VA 1V47A 2F8MA 4U9HS 4I5DA 4AN0A 2OEPA 4WXEA 3DQQA 5EP1A 2XCRB 5KTMA 3O4VA 4GRDA 5ADWA 1KAEA 1NQWA 1N1MA 3WWYA 1XZMA 2OFXA 1GD1O 2GK7A 2OM6A 1GITA 1OWNA 3G68A 5EE5B 4C29A 2P0EA 3NKLA 4QLOA 1B0AA 2V6FA 5EKTA 1K97A 1FP4B 1OFVA 3G2QA 4PLCA 4ZEOA 2Y1EA 3HLTA 3W6ZA 4XQ0A 2OLEA 5FPPA 3DO5A 4IG9A 1J9ZA 1U5AA 5IZ4A 1JH9A 3T4XA 5TE9A 1SY7A 3MWDA 1COZA 2NVBA 4KWIA 4QGAA 1HFWA 4ETIA 1VMKA 4MP6A 3T34A 1ODKA 5AI6A 1I4WA 3VH2A 1CZNA 1NPYA 1L8OA 1QV7A 5FWXB 2NU7B 2GLXA 2YZNA 4G67A 2PZBA 2LXNA 3QHQA 1N1EA 3F6PA 3JD0A 4IIGA 5EJ5A 4CHTA 1EIWA 2O2IA 1PLKA 1V2GA 1QH8A 2CSXA 4L50A 5I9NA 3SD7A 4PC7A 1K5HA 1MORA 1YL6A 5FNVF 1RQNA 1PSZA 2W2LA 3C7AA 4FBGA 3KAKA 4D9KA 3BSWA 3PYMA 4U3JB 4Y9SA 4OSOA 1EZ4A 3R4CA 4LYHA 4LNUA 4RGQA 5CLIA 2POCA 4S2EA 3UENA 5DB4A 2H00A 2QZSA 7ABPA 2O2GA 2ZT8A 4A3SA 3LPCA 3ZCUA 2Z57A 1YDEA 1YB7A 3KVYA 5AI0A 2YOFA 4WLNA 3KKQA 1ZI6A 5COAA 4AULA 2QAGA 3R76A 5JRDS 4C2AA 2JGLA 5TC4A 4ZMBA 3LYUA 3FPJA 4LJ8A 4FI3C 1ACLA 3RYCA 3MJRA 4HQNA 3LCJA 2R4TA 3BIWA 3ZDAA 3LYLA 2P40A 2VYCA 4Q82A 1DRVA 2IFTA 4GP6A 1H2AS 3WLOA 4YAIA 2AE1A 4FJ2A 1EKXA 2EW1A 1VLZA 4FFSA 5DCUA 3BIXA 3AFGA 1VGRA 2QT1A 2VTDA 5ITVA 2GN2A 3ISVA 2UZ1B 1EU1A 2CV1A 3RT9A 2ZUDA 2BTQA 3IS3A 5L3SA 5FTKA 3E7DA 2DUJA 2QPLA 2EHJA 3NRJA 1N0UA 5CM9C 5K09A 5DLDA 5CW2A 1Z2PX 3D4PA 5LXTB 4Y1GA 1U4NA 2D62A 4J1TA 5BY2A 1P3JA 1K2WA 4TT3A 3CLKA 1V96A 2F8LA 4RDXA 8MHTA 1SUWA 2BBOA 3GCWA 4R51A 3DTVA 1IZYA 3MPOA 4GKBA 5JAMA 2O59A 3WA6A 3H17A 4TSFA 3N2ZB 1G20E 1M2JA 3A7EA 5FOXA 1YCFA 4BB0A 1I80A 2P4SA 3E0XA 4XVUA 1A04A 2BR4A 1NNSA 5I3CA 4CDMA 1LKZA 1O94D 4TS1A 4YACA 1O6BA 2AOTB 3TI9A 5I4BA 1U3UA 3L49A 1W5EA 1JJVA 3FWPA 5DLPA 4S05A 3RDPA 3EGDB 2FG7C 2HC9A 4I08A 4IWXA 4O29A 2NO7A 4YWJA 5KAPA 1FUUA 2VJDA 3HR7A 4P35A 1HH4A 4A92A 2BGIA 2Q3MA 5DBEX 1VSQA 5HUHA 4Q9LA 3AR3A 3AP2A 3W2IA 3EPLA 2PX6A 5CNKA 1R8JA 4YRKA 2CNNA 1NLMA 3E9QA 3U80A 1M2NA 2I1LA 3S70A 4DXDA 1SQ5A 5JATA 1Y48E 1N8KA 3O6VA 4R4JA 1PK9A 2AYYA 1JHMA 1TYAE 2GD1O 3T7IA 2J41A 3OJCA 9ABPA 3WGHA 5HQJA 1U9YA 2JFPA 4J1SA 1M2HA 3V2UA 1J2YA 1CJUC 2CV0A 1P6UA 3G9QA 4O0LA 4EG5A 4RD2A 1QWOA 3ONWA 4WFIA 3L7DA 2H07A 1P39A 1HG1A 2CB9A 3PUJA 3WL3A 1QHXA 2MSLA 3E3LA 2JEZA 3T9CA 1QX3A 1TYCA 1WG8A 3THWB 2VHJA 4K0KB 1IXKA 2FDCA 5C1DA 1V6CA 3LC0A 4TRNA 3QVLA 1Y7HA 3PNLA 2PRJA 3C6YA 1P2BA 3D3NA 9GPBA 1UBHS 4X90A 1HETA 2GD6A 3HB5X 4I2NA 2X0KA 1AO0A 1J33A 1LEHA 3UUFA 2D5IA 4ZPJA 5T3YA 2VXYA 4FNMA 1GUBA 3UOAB 1QHGA 2CHQA 4CCAA 2C4HA 1IM5A 2HNBA 1JKMA 3KWLA 3C8ZA 2V96A 1C9JA 3MJHA 2G06A 4OQLA 1UJMA 3ZI7A 2QN2A 3KWFA 3HM9A 2O5CA 4L4UA 3MS4A 1S3IA 4XSVA 5KTRA 4LY3A 3W7AA 3U49A 2P2YA 1PQPA 3FVWA 3H05A 5AW8A 1KI6A 4ZVUA 1V3UA 4UUNA 2AB0A 1U1EA 3G5LA 1CY1A 4U2BA 3OCXA 1PJ4A 2XDQA 2Y8EA 3SZLA 3NFRA 3ND6A 4Q6WA 1BX0A 1TZKA 3JQBC 1U3CA 1HDCA 1GFZA 3QE0A 3OBIA 5TPZD 1QCYA 2BISA 1G6KA 1Q19A 2NOAA 2P9JA 2XYVA 2ZWIA 5DTQA 1PSWA 2IW3A 1G5IA 3B48A 2P5YA 2AUTA 2J9FA 1UJ4A 1MJHA 3RHFA 2Y71A 2Q3LA 3BGOS 3IEXA 3LQFA 3INYA 1EE9A 3PC6A 1ESCA 1XRMA 3ZKWB 3AV0B 5EZYF 3AF0A 1K98A 4ZCPA 2J07A 3ZLVA 1DOZA 4KWEA 3LV8A 5AK0A 3VVBA 2H4YA 4O2AA 3MTIA 3MXOA 5AHOA 4F7WA 2Q3EA 5A62A 3F97A 3FAZA 4BTLA 4XB2A 4FYYA 3LSTA 4NU8X 5BXYA 2E82A 1XJ0A 3BXOA 4LW8A 4RV9A 4J0HA 1KEPA 2H31A 4G9GA 4PAGA 5ABPA 3GCXA 4EHIA 2D06A 2QYSA 1EUDA 1VGQA 3K20A 3C16C 2CZQA 2DPGA 5G53C 1V1JA 5H80A 4BASA 3CNLA 2XSZD 1C3VA 3KVNA 2YASA 3RGWS 1I4DD 2J31A 5EMLA 5DZSA 1HFJA 3SP1A 2X0NA 3AU9A 1JWBB 4INAA 2R1VB 3HXLA 4E3WA 3ETDA 4QRDA 4BATA 3MBIA 1ODLA 1MD9A 2KI5A 1OFIA 5AWFC 3SFVA 1RRKA 5BW8A 4C08A 1YS9A 1CLUA 1YKFA 3D8TA 3NGXA 3N7UA 4OHXA 5ALSA 2ISCA 1RRCA 4NU5A 3R44A 3IBTA 1VIDA 4UM7A 2XMQA 3R6LA 2DPHA 2OE2A 4GMFA 2C2YA 1YBVA 3MEQA 1K4YA 2YHBA 4GMGA 5BYBA 2J5XA 5D6OA 3FN4A 1UZUA 3AEKA 3RVKA 3AXTA 5EP4A 1IWOA 1HDGO 5CX4A 1DIOB 2WTBA 2WWWA 4LGVA 3PFKA 5EKUA 3GUYA 2AX3A 4G01B 4F3KA 3EYAA 5KSWB 1BQ3A 4KYVA 1XL0A 1V4VA 4EHHA 3PJFA 3GLRA 1XFAA 3EF0A 3CLRC 1J5EB 4X1YB 1XZEA 4DR6B 4CT5A 2Q1SA 3LHFA 3NOQA 4Y6OA 1DI0A 3DW1X 4CMEC 7REQB 2ZRBA 5IJ9B 1N0IA 4Q37A 3P0JA 3AHFA 3GMTA 2H1CA 2FPWA 4HQRA 4RKFA 5ES3A 5JCOC 1DXQA 1O7JA 1ZCJA 1COWA 2IOFA 2O5VA 2PO7A 2VDWB 3QKSA 4QTXA 3V48A 5L40A 4REQA 2DERA 5EJ6A 2J3IA 3H19A 1OKKD 1RW4A 1G17A 2AT1A 1DMSA 1W47A 1ZJJA 1G20B 2CWDA 2JHFA 3N2GB 3QWIA 4HNHA 1JKXA 3C8HA 1J42A 2X7HA 1GQYA 2X7JA 4URWR 4QO8A 2O8EB 4TV9F 4J6FA 3AR2A 5JOQA 4MLZA 3EASA 2A5JA 2FFBA 3VZQA 4O59O 1D1TA 5CPBA 3H8VA 3O74A 1G7RA 2WWXA 1M2KA 3H2KA 2R7AA 3ESZA 9LDTA 2AK3A 3Q8KA 4ZEMA 2BC9A 3L5OA 1UMKA 2ZSFA 3FWHA 4MWZA 4HZUA 3KBBA 4IV5A 1E0AA 3AM4A 4PWZA 4ZVKA 3NHAA 4BCCA 3W5DA 2C84A 3VHQA 1AUOA 4JT8A 4N1AA 4BMDA 4AG5A 5LQMA 2FN3A 2VF8A 4G4SO 4WINA 2V6BA 4YEDA 4I1IA 3RYFB 5JPDA 1C7JA 4EB8A 2N1BA 3L8DA 1QF9A 5ECWA 3QVWA 1I9CA 4BLUA 4M7RA 4K9OA 1AK2A 2O20A 4O2BB 1GZHB 1RS0A 3DLCA 3FWYA 3GROA 3SC3A 1T15A 4US0R 2X6TA 4LSMA 2W6ID 1I1NA 2IDJA 2GNAA 3K0FA 4GU5A 4DCUA 2QE7D 3LYAA 3FGNA 4KCGA 4B0OA 5IXYA 3QFTA 3MJSA 2HA5A 3O2SB 4JSRA 3LT0A 4OLHA 4ABYA 4OO3A 3UATA 4P08A 1T5TA 3EIOA 2HD4A 1UMDA 4R3NA 1FQWA 3GOQA 4OVKA 4TMTA 1RLIA 1BW9B 2CZCA 4ESEA 3E05A 1UBFA 4IDPA 1FMJA 1O97D 2ON6A 2V6IA 5PNTA 3B82A 3GIDA 3DOIA 4JLBA 1J99A 3QLUA 2IWHA 1J49A 2AEJA 1Y33E 3BA1A 2QY6A 4KO2S 1J0EA 2ZR8A 2BKAA 1CXZA 1TOAA 1L6RA 3D59A 3DFFA 4GM1A 4PC1A 5HM6A 3ZWKA 2NSLA 3H0CA 2DQKA 1QDLB 2ZW9A 2GERA 4BAZA 4C3ZA 4EL5A 1YBHA 4LHVA 5FFNA 2A58A 1XLTC 4JV5B 1SA0B 2X42A 2I62A 3RASA 5L7TA 3A4TA 4YQZA 1C0LA 2AHRA 3HS3A 2YNMA 2P5UA 1U65A 4Q21A 3A31A 4B74A 2XD9A 4G5RA 1ADGA 1XIVA 2QRGA 3NW9A 3OQBA 3GFFA 2W43A 4MUHA 4W82A 2YYYA 1MB3A 1S01A 5EMJA 1CUJA 3FGZA 3RUDA 5CVUA 1V5WA 4DCPA 2YIJA 1NG9A 3GGSA 1FX0A 4HRYA 4IIFA 3ZQ6A 2IS4A 1SZJG 3PEUA 2HRZA 2XJ4A 5H82A 4J1QA 2NO6A 5JSUA 2X4IA 5FR2A 2FPGB 2BL4A 2ZAOA 1JBEA 2ZRQA 4KWCA 2EIXA 3UY4A 1CR0A 4UJ5A 3T7DA 4BB6A 2WYHA 4XX0A 2Z9DA 1VKNA 1B41A 1O9BA 3WS7A 3X44A 4D46A 2WQZA 3V7YA 3KHTA 2X4DA 1PNRA 3L82B 1VI5A 4EY8A 4GP7A 5CNIA 5D3ZA 5BYAA 4Z3KA 2VJLA 1Y4UA 4BNJA 5C5DA 1KWKA 2ZM5A 4HEA1 2XZLA 1CJSA 4MLPA 1QUEA 3T95A 1XZAA 4YJFB 4ENVA 4ZYZA 4JYZA 3JQ8B 4YCDA 3AOEC 4PGGA 1TZBA 2Z4RA 1AGYA 5I47A 1POWA 3HN6A 3KDAA 1E2EA 2Z4SA 1YDFA 4MJXA 3MC1A 1ECPA 4BNIA 1J56A 1DKOA 1VLJA 1ZH2A 1NI4B 1UPBA 2CKMA 5TEWA 4Q4DA 4EX6A 5KIAA 5DRTA 1JR2A 2CXUA 3HZZA 5AICA 2OYCA 4BEJA 1RJGA 1ISMA 1MAAA 4YLYA 4A36A 4FYVA 4B5LA 2A5LA 5EE3A 3MILA 3TNYA 4F2DA 1J2JA 1RMQA 1DU4A 3G2JA 4JSTA 1VIMA 4X6LA 4CV3A 2ZE6A 3M3DA 4BTVA 4C21A 2ZBRA 4B6RA 5JQWA 4AUKA 2IS2A 1XZCA 1Z2AA 1JYSA 1QORA 1XK7A 4LNUB 5DHSA 4DLAA 2C2OA 3Q4GA 1PVDA 2B6HA 1O8CA 2GK4A 3DWGA 4GBJA 2W2OA 2VNJA 4WLEA 4W5QA 2R97A 1DWOA 4M89A 4NCHA 1IN6A 2K2QB 4JLWA 3WYGA 2WWTA 1QYRA 2CLEB 2WIAA 2JB9A 3BB3A 3ZDBA 4XCQA 1ZXXA 4M0EA 1Q1ZA 4M49A 3F47A 4R5HA 5H0IA 1BGVA 1SU7A 3C3WA 4G2TA 3NM5A 3DJFA 3JQ7A 4XWAA 1ZR4A 5DGHA 1AD2A 1TW3A 4FYXA 2QA5A 2Y1XA 1NURA 1XVLA 2CF5A 3FY4A 4PLHA 4IIUA 1E6LA 2RGDA 2NT4A 1ZUD1 3ZOKA 1NLZA 4EPTA 3D6AA 4F85A 3QHPA 3QVVA 4N8SA 4HT3B 2HK9A 4BX0A 3NFYA 4BOYA 1L4UA 1P5RA 1XDDA 2QTFA 2J87A 2RGBA 2BTQB 2ZSUA 4MB6A 5EWJB 4DJDC 4DLLA 2JGNA 5L3SB 2WJPA 1DBIA 3W8EA 2CNKA 4HVCA 2NGRA 4MKFA 3WC4A 2Y76A 2WT9A 1BE1A 1N2CA 2V7QA 3H8SA 3IBGA 3ONFA 4DJTA 3S8YA 3HK2A 1FMCA 4UBIA 2CDAA 3B2QA 4AJNA 1R16A 1NY6A 1IU9A 3DTVB 4I4IA 4IO0A 1JJIA 4LEIA 2C04A 3SSNA 3VJKA 4CUZA 5KOYA 3KKZA 2GRJA 4LIPD 1DRUA 2YR0A 2WICA 3FSJX 2W0MA 4WA7A 4ZAYA 1P7PA 4JB0A 1W1UA 2VT2A 4WK2B 4Y2VA 5DULA 3ST7A 3BXFA 4MGZR 1GNRA 4UHHA 4KQFA 1QVAA 4DA7A 2R3SA 2QW0X 2ZJOA 3Q0EA 2JJ1D 4PQEA 1NYRA 2NTVA 3FZYA 4JEMA 4IQ8A 1X94A 2R87A 4UXHA 4HLUA 5J43A 1DBRA 2XDAA 1NXPA 3FWZA 1P4SA 3G2MA 5AKJA 5FUQA 2Q1WA 3DZFA 4NCJA 4ZANA 3EAGA 4LC9A 1Z6TA 2C7QA 1XU7A 1C7RA 4GM4A 4O4HA 2FP4A 1VRWA 1Y42X 1JN0A 2I6GA 3OCWA 1MU0A 4FDVA 1TU3A 2GCPA 3L0SA 4YCJA 2XNJA 4LK2A 4PPYA 1UCFA 2BI7A 4Z1MD 4KQXA 1YS4A 3F3SA 3QPDA 4DDVA 5DTJA 5FEUA 4EO7A 4MRVA 4N76A 2ILVA 2GZ1A 4JVLA 1OIWA 4PC6A 4PNPA 2CLIB 2Q7XA 3EUWA 3SQLA 2O48X 1UPXA 4UM9B 4JH0A 4ZKEA 3VO9A 1SVMA 5ILGA 1V11B 2ZIZA 4CQMB 2O3SA 3A6KA 5KNCA 2ADOA 3O1HB 5E1OA 2G07A 4XGNA 1B8NA 3BTSA 3LHIA 3N70A 4HGOA 1OXKB 2BJHA 4PO1A 4FS3A 4QULA 1DJNA 1YU9A 1HYQA 3E9MA 2HIGA 3DBHB 3JZMA 1JU9A 3PYXA 2IYVA 2FWIA 1O0CA 1QQAA 2FEMA 3RJ9A 5JDIA 5K20A 4XKJA 4GR9A 4IXTA 1XLUA 3L04A 4J0JA 3SLGA 3HXOA 2YXBA 3K0CC 2GBCA 4Z51A 4DQVA 4PX3A 1KE2A 3QU9A 3NAMA 2PRKA 2QRHA 3OIYA 1KFCB 3PIIA 2YC2C 4TXHA 3SBEA 3I62A 3H6GA 2RFLA 3KOOA 4BFVA 1A1VA 4IMPA 5DDIP 4G85A 2IJGX 3OBBA 1ZJZA 1Z33A 3ZBUA 5JRJA 2QL6A 1FTSA 1EB8A 1TQ2A 2IUFA 2RBGA 2I6UA 4UMVA 1R9MA 4GL2A 1M67A 1OHHD 2C9MA 2XKKA 3FETA 2XUPA 3HKDA 3DE2X 5H9VA 2ORVA 3UWSA 3HWWA 2GFIA 1R8YA 3O8OA 3UUEA 1U4SA 2BGMA 3K8ZA 1SOVA 1KI6B 2QVCA 2VAMA 4QNRA 5TNXA 2LIVA 3SYTA 4ZCRA 3FRJA 4YR9A 3M70A 1DFGA 5C8XA 5ES4B 3ETEA 3JQDA 4QJIA 4XEUA 2XDQB 2CUNA 5LP6A 4QM6A 3DZGA 4Y1RA 1V3QE 3UTCA 2V7WA 5AKEA 3VGPA 1CFJA 2AOUB 1M72A 4HGNA 5CCXA 1MIHA 2X23A 3IVCA 2ZUCA 2A0XA 1WLSA 2J9FB 2VDNB 3E1KA 4I55B 1KJWA 4QOFA 4PGAA 1FRVA 1T8UA 2H3EA 2ZATA 3DQZA 1HYBA 3FYHA 2GMWA 2J0VA 3KPWA 1ZAYA 1IB6A 1VYHA 1UM8A 2B3DA 3JYLA 4Z0NA 2ZI3A 2X0EA 4WSOA 5L51A 1P0CA 2I4MA 5KTKA 1XAJA 4IVNA 1F8XA 1N5DA 1FZQA 3EDRA 3DBRA 2W37A 3HWX1 1EBUA 2ZYTX 3GUCA 1LDYA 5BW4A 5TX7A 3K32A 4TRRA 2PPLA 3RVSA 4JGIA 3RVQA 4LF8B 4B1FA 4LMBA 5B53A 1GUFA 3COSA 3FNBA 1N4DA 3WLMA 7MDHA 3QG5A 1FSSA 1P2GA 5FEMA 2C1EA 3NJ8A 3ADDA 2WKRA 5M3BA 1VFNA 1XU4A 2G3YA 1BZYA 3GLVA 2DFNA 1EUDB 4LRUA 1S9HA 1W85A 2I65A 5E8RA 5KVAA 4CMAA 1O3YA 4EJFA 2OT3B 3QXSA 3A3YA 5KS2A 4JJ4A 1QIMA 2QM7A 4LI3X 4P3OA 1ZINA 1EAMA 4WEOA 5H1YA 3W4IA 1JIVA 1T2FA 3GRKA 3IMEA 1MH1A 1P61B 3Q9SA 4F56A 4E6EA 1YQWA 4LOAA 1KDZA 1ZBDA 1O6FA 2DX7A 5H7XA 3HE3A 4GMDA 5IBRA 5A9TA 3RYIA 3T9DA 1MO4A 2IDKA 4IZIA 3DZJA 1DXHA 2H1OA 4QE3A 1UMBB 3MOIA 2YFKA 5DK6A 1ZK2A 2P3LA 2XUKA 2CLDX 2Z98A 4C5CA 4UJ3A 4OJKA 2QVLA 1Q6ZA 2IP1A 3WBKA 1R5BA 4WBNB 3T3DA 5K8CA 3F98A 4L7VA 3S7TA 1QU3A 3I8SA 1JDPA 1K6MA 3KZNA 4C30A 3K5PA 4TQUS 3DMGA 4Q01A 1PD1A 2DHEA 4YBZA 4EKIA 4JUBA 1F6BA 3D4NA 1XU9A 3CUWA 4HDKB 1KGSA 1RAIA 3UM9A 3KUCA 4P7KA 4ROTA 1EWYA 5J1TB 5BQFA 4OATA 1Q83A 4QU5A 4KOAA 2A57A 3QSYA 1EFAA 1UWCA 3KLNA 3L0BA 5KTNA 5E3IA 3THYA 3WZ2A 3QKSB 1JI3A 2HZ7A 4YRGA 3TLBA 3L06A 1W59A 2PGNA 1N2CE 2JF0A 4WAUA 1T8WA 3LOPA 1FW8A 3GJ3A 3M2TA 4B3DA 3UB2A 2Z5LA 3CRVA 4KQWA 1XQXA 5F5NA 3IELA 3LQYA 3W8RA 1QYCA 4E11A 1KARA 4L9AA 4RDIA 4DR7B 3ZWNA 4IJMA 4E03A 1IJEA 2MSWA 4L8GA 4RD3A 4KWTA 1OZFA 4KN6A 2H92A 4MI6A 3I9FA 3VNSA 4RANA 4TVBA 1KDYA 4RKQA 2W8BB 2GLTA 1USWA 2IOQA 1WUHS 2Q4OA 3NOOA 3PNQA 3GDGA 2QS9A 4J1TC 1VYUA 2E6KA 3P4YA 1WEHA 5FPHA 1N9GA 1UJ5A 1DCMA 2GEVA 3ID6C 1YC5A 3KXDA 3A36A 4UHKA 2PM8A 4HZUB 1XYYA 1XX6A 4YV1A 3EK2A 4Z3OA 5IKOA 2IZ0A 3SIPA 1Z25A 2OZEA 3A04A 2VTEA 3K1AB 1IPEA 1JRLA 3SOZA 1E99A 1C9EA 1RAAA 3AEXA 3ONVA 5ALMA 2FSUA 5SY9A 3IMGA 5D51S 4QVIA 3RUPA 2Q1YA 2QZ9A 3Q40A 3HZRA 3WGZA 4FYIA 3MB5A 2PBFA 4KL8S 4RS4A 1E58A 4IVQA 4OHZA 3V6LA 1ONPA 4DIKA 2VJOA 1VB3A 2ZRFA 3I09A 4G37A 3QLJA 3PIDA 3NHWA 4TVKA 5ESDA 4KXWA 1RI3A 3N59A 3UO8B 4MQMA 4IG4A 1P5JA 4PCVA 5ALPA 4RZHA 3HU5A 3BFXA 3T5GA 3K0FB 4DZZA 1ZNZA 3OLXA 3AHEA 3ZDFA 1W73A 3VYUB 5DK4A 3WQBA 3I34X 1T2EA 3BMQA 2QU7A 1N1DA 4RVCA 2AMLA 4W5TA 2ORED 2MYUA 3GPCA 3DNMA 1E32A 1VE6A 3B7GA 1Z26A 1V9CA 1RYMA 3G13A 3O2QB 1C0IA 4XOUA 5K45A 2H4HA 3OFND 4AUNA 4QXRA 1J8MF 2QMHA 2Y0BA 4L5CA 1PEKE 3T1OA 2WUEA 2V74B 5DXFA 3I72A 4NS4A 1VCHA 2QYOA 3ONEA 3U37A 4EG1A 1FRQA 2WHPB 1J70A 2R6JA 5AMXA 1GPMA 5IBPA 5MGNA 2VF5X 4LQCA 1GGFA 4TYMA 2ZIEA 1MZPA 1X1TA 4E09A 3GVHA 3PNKA 4EG3A 3ZVKA 4MUEA 4F97A 2SHKA 1HT1E 2UXBB 4EP1A 1EXMA 2R6FA 3UBTA 1YS2X 4ONEA 4F5WA 1UP6A 1TC2A 4FMDB 1YZUA 1SFRA 1DTSA 2ACKA 2EDCA 2BM9A 1VCOA 1L7BA 1PDOA 2GZAA 2LNDA 3AHJA 3Q87B 4GX0A 3SSAA 2F4VB 3L0YA 2VZ8A 1Q7CA 4NJOA 3EG9A 1NG1A 1PJZA 1ZIOA 3QOXA 1T9HA 1XTKA 5FA6A 1LQ2A 1O6ZA 2Q28A 3ZWXA 3QEMB 3PUZA 2ZSJA 3SC6A 1M2OA 3UCEA 3ZDQA 4DN6A 1MC4A 4R3UC 3T9FA 1GKIA 4IDNA 5ALZA 1NU6A 3A05A 3FKSA 2FX2A 1FYFA 2J32A 5IZCC 3ICWA 2L2QA 5JCJA 2XMDA 4L28A 3ZDDA 4QDUA 3WRXC 3AG6A 4OGFA 1JR4A 3S8MA 3BK2A 4XX0B 3J7AC 4EPRA 1CY0A 1CUVA 5I9BA 3JZFA 4WDRA 2HRCA 5C46F 3AI7A 3Q7SA 4EJ2A 1Z83A 3FWKA 5K5EA 4OHRA 4QFDA 3CEJA 5CYOA 3HDHA 1TMGE 2Y27A 3PFFA 2DUNA 5G1PA 2NU8A 3T5AA 3DOCA 3M6WA 5ED0A 1FE8A 4LF5B 2HRBA 2W6NA 4KC0A 4P3YA 1JHRA 4PWYA 5EQDA 3W1EA 2I8CA 1X9IA 3MTEA 4Q1AA 1FDWA 3C7KA 4S1PA 1U3VA 4Y7DA 3SN6A 5BUQA 4B84A 3UFXA 521PA 3UMGA 2FJUA 3CUSA 3ZXSA 2C31A 2NAPA 3DV9A 4JXJA 3IP7A 1NMYA 5HE9A 2PSEA 3ENWA 3WKEA 4ZK6A 2PDAA 2KJQA 3CIFA 1ECBA 2O50A 1UBLS 3H3FA 5I7SA 3A6LA 2BCEA 1LLCA 3AUSA 4DQDA 3I92A 3RABA 2C3MA 3FNIA 3H3XA 4J43A 3BWYA 4BMPB 3TQQA 1ONNA 4PSUA 4D25A 1M6WA 3WMWA 3IE0A 3OT1A 4BAGA 1AKVA 3RVNA 4N7BA 3FB4A 1H0KA 2JFZA 3FDJA 1QTRA 2OMEA 2VZLA 3EOAI 3X3HA 1LS6A 5CCEA 3KJIA 3GMDA 2NMVA 1DBSA 2PSFA 3JX9A 3C4QA 1FVXA 2YN0A 3CG4A 4GI2A 1XEFA 2YX1A 1XTZA 1VL6A 3IIIA 3QI7A 3ZJUA 4G9EA 4NCBA 2WNIA 2OV4A 1BDBA 3P0FA 3RD5A 1H8ED 3JQ7B 3M4ZA 4N5NA 3QF7A 1E20A 3LSYA 2A94A 3IKJA 4U7HA 5ADVA 2PY6A 3VHXB 5K3FB 1G9SA 4B3RB 2HSWA 5FOSA 3CW8X 3KL2A 4ZI2A 4AXXA 2DAPA 3RROA 2PZKA 5JQGF 4B3SB 2EGGA 5ELLA 4QJ4A 4MWOA 5CLGA 2EJTA 1VKZA 1NT4A 3B6EA 5E9AA 1ZGAA 2A0FA 3VMMA 3LTNC 1RPZA 4BU1A 1CBUA 2H57A 4Q12A 1TVKA 1NW6A 2XSZA 1Z8HA 3BMOA 2DHQA 3KXIA 3LPNA 2IZ5A 1N2CB 1WMAA 4MRMA 4NU6A 4WOCA 3VR6H 3DE6X 4QU8A 4L8LA 3Q6NA 1AY0A 3VO1A 4ND8A 5EVCA 2WHEA 2W6QA 4WLFA 4CEHA 5DNUA 3THXA 2AS0A 1YRQA 4CODB 1QIFA 3Q5EA 4QODA 4QNMA 3KQSA 4KV7A 4MA5A 2OORA 3COVA 1TF7A 4GPTA 1YFKA 4S0ZA 3RS4A 2PUBA 4GPZA 2B1GA 2YBDA 3CUVA 1PWHA 4JJEA 4CTJA 3UWKA 1RRGA 1I3LA 3CZ5A 1EK6A 3OFSA 3DLAA 4HLDA 4EEXA 3RFXA 5KUTA 4BNGA 3ASYA 3E81A 1R7RA 2BZGA 1DLJA 2DWCA 3VHLB 1AOXA 2FK7A 2JGFA 3PXUA 3W4JA 4ZKDA 1XPRA 1OROA 1UINA 4P1ZA 4XD2A 2OHGA 1H0HA 1RHUA 1JA1A 2K6GA 2V8BA 3HRKA 4O4HB 5BOSA 2FP4B 4P81A 1KAHA 1WOYA 2O5EA 5KQPA 4GWGA 1GAQA 3ESDA 2A78A 4O4LF 5DO9A 4C0KA 3N9IA 3D8NA 5KQSA 2FWPA 2ZS7A 5LKRA 1B8OA 1ST3A 1MO2A 1RCFA 1TW2A 4B5KA 3DYVA 1C0KA 1C2TA 1UBJS 2KLBA 5H3CA 5H3HA 4ZVNA 4D9CA 3AR7A 4L9SA 1Y1SA 2RMKA 4MTLA 4C0WA 1HFEL 5BV0A 5IC6A 4D99A 2FN9A 3W5HA 2HK7A 1IWBB 1ZH0A 3NHFA 3MTAA 4GR4A 5G1OA 3H6KA 2JRCA 5IANA 1Y81A 5CP8A 1V39A 3SMQA 1UIMA 4DSOA 2E21A 2RH4A 1GAEO 4PFSA 2RH5A 1CUHA 4X85A 2XRYA 5EWMB 4XJXA 4TMKA 5JSZA 1T2CA 2VAWA 3UGQA 3LK7A 1QGAA 3AFOA 2F43A 4PSVA 3IXQA 1M2VA 5B3AA 3X1DA 1EDOA 3KZCA 3LBFA 3PNMA 4EUHA 3ZH9B 1E4VA 1GXSB 2YVQA 3A1UA 4YQEA 1Z7BA 4YRSA 3SEQA 3VR1A 2IP4A 4A8PA 1JFLA 4K9LA 4BO0A 1SIBE 2Z2JA 4EZBA 4XARA 4RADA 4TN1A 4EA8A 1FYVA 1N6PA 1W0JA 1G5RA 4H2DA 5B6IA 2QJOA 2DQSA 3EDQA 5J58A 5KOHA 4R8MA 1HOTA 2OM2A 4D6PA 5DH9A 5LZ7A 3AF4A 4G8DA 4CQJA 1V95A 2YV1A 3HGMA 5B36A 4OQNA 3SIRA 1HTBA 1KZ7B 3PLRA 4GPAA 4UXIA 5E4TA 4ZVSA 3SZUA 3OHPA 2WT4A 3GD7A 2PGAA 1NJ5A 3N28A 3SDBA 3AM5A 2B6NA 1P73A 4OK3A 1XMOB 1Z8NA 3MWYW 3RJTA 4Y1RB 4G0NA 2W2VA 5F52A 4ZD6A 1APBA 3CZCA 3LQKA 3NOXA 5EXXA 2P79A 1XCPA 3TN7A 5J2UF 1WHSA 2FJPA 2XR1A 1RYZA 3HN7A 2H7CA 4E15A 3ZQJA 4D9FA 3JAKB 1WSAA 3IPAA 5F2KA 3NHKA 4HYEA 1AF4A 4KLZA 4LI0A 1C4WA 2JZNA 2QIOA 4MEBA 4ZQCB 5F78A 3SU8A 4AP9A 4BO5A 1RXVA 3WLLA 3UYLA 2F9FA 1A8PA 4OYHA 2Q4RA 4DY6A 5LOVB 3DBRB 3PSHA 5EPEA 1KHHA 4UTPA 1II9A 2IEAA 2WUGA 4NZNA 4BL5A 5IU6A 1A9SA 2E1RA 1N77A 3D7LA 4CMJA 3ZGXA 5TMPA 2Q2NA 1JEQB 2Q5OA 1Y9DA 3W5BA 3BMNA 1CRPA 4GECA 3QKIA 2IE0A 2AC2A 2ZUBA 2ZIUB 2NVUA 3PJRA 4C7OA 5A3JA 5LSAA 3CXRA 1QCCA 4WIAA 4DEYA 1W85B 3D7KA 2WAXA 4FLEA 1A1SA 2DEUA 5CH8A 2RHGB 5IWCA 4L3VA 3I1JA 3S5UA 1TAUA 5IVKA 4OB6A 2X22A 2OILA 4K5QA 2FW7A 1WBJB 2H5JA 1VJGA 3FUCA 3TBHA 1L3IA 3DC2A 1BRTA 1GPAA 1OT5A 4QQ8A 4YONB 2VKTA 4L07A 3VDQA 2I6SA 3SQWA 4GOKA 5AKIA 5ALHA 4ZT3A 3GLFB 2XUGA 2ZUEA 1XRSB 3OIDA 1IL0A 3LKZA 1DZIA 1ZCFA 3A0RB 4URHA 3TFQA 5ILOA 1V26A 1JG7A 4F4FA 1PR1A 2WAAA 4OHVA 3QLVA 4FU0A 1RQRA 1KSHA 3QVMA 5EIOA 2SKEA 3MJTA 2NP7A 1CHNA 4HH3C 1P7ZA 3CINA 3R3ZA 2P6MA 3JD4A 3KQNA 3G6KA 3ZHRA 3E9DA 1E5XA 2Y0PA 2ID7A 3W2TA 1YRLA 4CMHA 1Q0LA 3EJWA 1E1RD 1BROA 4L2IA 4FONA 2WZQA 3U9TA 4D4IA 1GGEA 2HHJA 4AKSA 1NR5A 2AR7A 3F5DA 1AKTA 1X0XA 4ENRA 1QZZA 3LQ1A 5DWDA 3TFWA 4JDUA 4O0MA 2ZXUA 2ZAYA 2DBZA 3UK0A 2QR5A 1QV6A 1LSSA 2FR1A 4KQIA 2D8AA 1OI4A 4BFWA 4GVPA 1KYVA 3ZV3A 1HL3A 3G8DA 2O57A 3GZJA 1IHPA 5EKDA 3B9BA 4JNKA 1A5TA 2FN8A 1YDGA 2PX3A 4I50A 4TS9A 3THYB 4L22A 1VJ0A 4K9NA 3HCPA 4G81A 4BKPA 4ZJYA 1LI5A 4FOLA 5EOVA 1TEXA 1OFUA 5FTNA 2XE4A 3CR8A 1T3LA 1QR2A 1ZYUA 1U2DA 3RSZA 3SBXA 2HF9A 2VRCA 3ZDRA 5LMCA 1VC2A 2O8NA 4H3SA 4LOIA 3D31A 2EJCA 1L4NA 2I71A 2YZ2A 3MK31 5AM5A 5CH3A 1R66A 3MINB 4WNCA 1Z56C 2VP3A 4LX0A 4YJDA 2VRNA 4BMYA 5AVXA 3G2OA 2ODTX 3W2GA 5KSZA 5L3QA 1Y6GA 3BGVA 4TZ0A 4ER0A 3ZN2A 4JYPA 1XEWY 1R5NA 4NZYA 4U6QA 4Y1EA 4I1VA 1W5TA 4I6JA 1Z39A 4A2QA 2XJ9A 1ISHA 5AQ1A 3K2IA 4HWOA 1G8KA 1W44A 3VR5D 3K6JA 2WYWA 3BFJA 3OJWA 4DYHA 1K9SA 1J25A 5LQRA 2PRZA 4NJMA 2HNKA 4I3FA 1Z4LA 2UZIR 1FDSA 3EF3A 4OHFA 3W6NA 4CJXA 3JARB 2WIFA 1A4XA 5ANRB 1JB9A 2RAVA 2PXAA 1BEUB 5L7YA 1HYHA 1XC7A 1MV8A 2B34A 2CFOA 2GDJA 1BD3A 3ON5A 1BJRE 1QQTA 2CNWD 3OETA 4JKIA 4X54A 5HK9A 3H65A 1X7YA 2PS0A 4Y6RA 4B4UA 1V5FA 1KO8A 4D57A 5JZOA 2I5PO 1YACA 5FP0A 3MRSA 1GLGA 5TQJA 2WF9A 5DM70 3EVCA 3SHOA 4Q7JB 4UPVA 1HSOA 5AFSA 1KDTA 5H81A 3O8CA 1E7MA 3TLKA 5C1OA 5K3EA 2FWJA 1T1IA 2G9UA 2M9MA 3KVVA 1P81A 3BMQB 3D2CA 1VPEA 4LZAA 1RYEA 2EV9A 3CW9A 1N32B 3AVVA 4IJ6A 2X8JB 3ZWMA 5GZ1A 3L1IA 2KSQA 3OPYA 1WCIB 3ER6A 1JDZA 2GJ8A 4RZUA 4TYYA 4RKYA 4W8OA 2JJ1A 2YICA 3R7WB 4Q39A 4BLPA 4I4CA 1NXVA 3SYMA 1CS0B 5FULA 3BRSA 3RIHA 4NMXB 3CNNA 2FFRA 4KV9A 4UDYX 2IV7A 1Y5NA 2GEUA 2QR2A 1E1YA 1ORDA 1B1CA 3GCZA 3IAXA 4OGKA 4TMYA 4YCBA 4MB0A 1E4EB 2GVNA 3C3XA 5JDIC 1V43A 1RWXA 3DQPA 3I6ZA 4TLEA 2H5EA 1NFQA 2GT1A 2WTMA 2ZTHA 3P1JA 4QHYA 3O1JC 2UYHA 2DH5A 3VDXA 1M8GA 4PONA 1UWVA 3KB1A 2AFIA 3KQYA 2PKWA 1K7SN 5DE3A 4K7JA 2G0AA 4R84A 5C9ZA 4KI7A 1E9CA 1DHTA 5EC8A 1PG5A 1UDAA 3JR3A 3EG9B 3KZ1E 5DLEA 4EAQA 5K4GA 1DCKA 1PFQA 3WIEA 3O26A 4UU1A 4PFKA 1HBJA 1YAHA 3L79A 3LUCA 4HN9A 3D4OA 4IOLA 5BUCA 2G72A 1MC1A 1T9GS 1ABEA 1ZCAA 1B15A 3TW4A 4HQLA 5CNMA 1RHJA 2GYUA 3X1MA 1EZZA 1UDRA 4U7DA 2PUAA 3GD5A 2WNHA 3M6MD 3WKBA 1SCBA 2BZ0A 2O3JA 1SUCA 4FQ5A 3GA0A 5CFMA 1C7FA 3K8OE 5JZVA 1QX4A 2C61A 5LP6C 4TVSA 2NSDA 4RV5A 2J67A 5AP9A 1BWSA 4KTVE 4LYFA 4E07A 2I29A 3KP1A 1WULS 1XRRA 1Y3IA 1YZLA 1SQ6A 3D54D 3HDVA 1ZKMA 3E5NA 4FHDA 3ROFA 1XMQB 2LW7A 4KO3S 2NU8B 5BSFA 4J6EA 5G0UA 4HVTA 4F21A 2HHLA 3BZUA 1U04A 1R4MA 4ZK2A 1ZQ1A 1M8JA 2GCOA 4OK5A 4DMHA 4AMVA 4CKBA 4TQAA 3UFXB 4ZTUB 1JR3D 2F1JA 3FPHA 4PG8A 1U0NA 3EGVA 4BBPA 1WPQA 3FOFC 2BGGA 2CKDA 3MGAA 4JYBA 3FDZB 1Z2EA 5KYUA 5A4DA 3NEYA 3E70C 4S1WA 2WD8A 3JATA 3LBIA 4IHAA 3OX2A 4I7EA 4KE8A 2E3JA 4UUBA 4E5PA 3HL0A 2C99A 4X1IA 3PXGA 2D0IA 5AVUA 1C5KA 4AKEA 5HK8A 2BTOA 1XF1A 2G1JA 2A9QA 3RKUA 1FS5A 2Y67A 3CU5A 1FXWF 4PAOA 1WEKA 4RPLA 2OAEA 3EEQA 1A9XB 2NUTB 4EIWA 3ZVRA 4EG7A 4IHJB 3ZY4A 4JGBA 5HX7A 2DKOA 1B42A 5EI5A 4JOSA 1QG6A 5EKXA 1GPH1 1PFWA 3NALA 3V7FA 3L1JA 1I94B 5ALUA 1W49A 3OZTA 3JPWA 1NBHA 3F71A 3IB3A 3CRRA 4YRPA 2DR3A 2WWFA 2PAFA 1P6QA 2H4XA 3RLFA 3U7FB 5TIIA 4O4IA 1Z29A 2Z95A 3Q41A 4NR0A 1XI2A 5LDDC 3D5EA 3B1XA 1NBEA 3GGCA 1TVKB 2FLVA 3BMOB 3LX6A 4RVUA 4MRMB 3VV2A 4LXQA 1Z08A 1WX1A 4H1WA 2CMKA 2C4WA 3CF6R 1TK2A 2J9XB 3P9PA 2BONA 1DJMA 5B5SA 4FZVA 3ICQB 4ZT6A 5TV2A 4YUZA 3IBCA 4CEHB 2CVHA 5HQTA 4TVOA 4LNHA 4KK3A 3HA7A 4F04A 4HFRA 1QLHA 5IMSA 3WRWA 4H59A 1RC8A 3G9ZA 4TM8A 2WK1A 1I7NA 5HQ3B 3F7TA 4JBYA 2NXWA 1K66A 2ZE7A 5F7XA 4LFBB 1X38A 4I14A 3A9TA 4NFHA 4XCXA 1GZUA 4Z1OA 2O2CA 5IULC 3GLGE 1J39A 1YRYE 1QOPB 4B81A 4Q48A 2EGUA 4QBIA 3SEAA 2AOVA 2W6PA 1IM8A 3N0WA 3UMSA 5F7JA 1XPJA 4QYTA 3PWKA 3EJ6A 2R68A 1JMKC 1KYQA 2V5AA 2VJQA 2VZ0A 1Q44A 2XB9A 3FPLA 3HJHA 5IMBA 3VDRA 1SXJC 1NVUQ 3RTBA 3UT6A 4NBTA 4L1KA 4ZTZB 4DTIA 1RABA 2PH1A 2RHMA 3PFIA 3IPLA 4HKTA 4RPJA 3DHVA 4FEGA 1DWQA 1EZ1A 2O2EA 4DSZA 1XNJA 1TPYA 4YWHA 1EX9A 3TW0A 1WDMA 1O9GA 2PKXA 4ZV7A 3HVRA 3T7RA 2WE8A 4DARA 2QTHA 1W0KA 4EK9A 4UMFA 2BGJA 1SQSA 2UU9B 3FFXA 4YI3A 4KZPA 1MFZA 4FN5A 3D64A 1G291 1JG6A 2P4UA 4FFPA 1GGNA 2ECFA 4LECA 4LZJA 3RS2A 4H7DA 3L92A 1Z5PA 2VSNA 3PNPA 1IK4A 1B73A 5DI3B 5JSZB 2W6MA 2IU4A 2Q3JA 2F43B 1GA1A 2O0HA 1RC1A 2Y1FA 1UEJA 4IQ0A 1BGWA 1L7EA 3DXFA 4W5RA 1IK6A 1F8FA 3NT4A 3WNVA 3AUKA 4KR7A 3NTUA 1TA9A 1ZGCA 3QV1A 5KJ6A 2J9GA 3CLSD 5BN3B 4RV4A 1SIOA 3N0VA 4PLZA 3HKCB 3DC7A 1ATIA 3I3SR 1ULHA 4DR3B 3AERA 2G8LA 1QG4A 1NXQA 2P77A 2XMSA 4GI1A 4M1KA 5LZ4A 1U2SA 2QLTA 3WNZA 1Z74A 5KX5F 3KIPA 2BM1A 3HC7A 5GPBA 3I0MA 2CEAA 2WFLB 3QBTA 5DOZA 5FPQA 3IB6A 1BE8A 2HLDA 2OBFA 2VH5R 1ZM9A 4Q4JA 1E2GA 5GONF 1H4VB 2CZGA 3IP9A 1YUNA 3I05A 4TSRA 1BTOA 2AFIE 1ZGJA 1WUYA 1U2TA 3OFKA 4WKCA 2NQ2C 4Y0VA 2C95A 3W6UA 2C7GA 5K0JA 3K1ZA 2D5AA 2PAAA 2YRFA 1XTRA 1ZD2P 4YMIA 4AT1A 4PCAA 1JPUA 1V71A 4ZI3A 1I7LA 4NHOA 1F3LA 1Q20A 1Z34A 3UHAA 3TG8A 1OCEA 4FN4A 4RY0A 1BKDR 2PZGA 3FIUA 2Z4TA 1BE6A 1UM9B 3LFUA 4EB3A 2NO1A 3UQYS 4ASUA 5LYJB 4LCJA 5HIJA 1BKSB 1PFGA 5KTSA 2XUFA 1HYGA 5LD2C 4C2UA 1A5BB 2JKZA 2RJ3A 4HGPA 4ERXA 4FMPA 5IUJC 1UFVA 1OQAA 1SN7A 4KGXA 1ISGA 3VR0A 2ZZMA 1AQ6A 1XZIA 2J45A 4RZ2A 1AQUA 4PSKA 1O0SA 1CSEE 1KGDA 1XVIA 4G0ZA 5AW3A 1QPGA 3BMNB 1SXJD 3TZ6A 4EJ6A 2HF2A 2ZI9A 2CCKA 3NT5A 3PE6A 1R0CA 3JVDA 3Q8LA 4TGLA 1LS1A 1N8SA 2PRYA 3FTQA 4PQRA 3NLLA 2IDZA 2JAOA 1DIHA 4K2AA 2HQ1A 3JRXA 1GPNA 2O0KA 4UHEA 2Y9PB 4MHOA 3REQA 3T41A 5I7HA 1T43A 2IS6A 1IOVA 1KKLA 1BH6A 4FFRA 4H7FA 4R1MA 2AEEA 2SBTA 2FETA 3CEMA 3O84A 1VKOA 5FUYA 3WHLA 4AJHA 2Y0CA 3HWSA 1I8TA 3NT2A 3F7OA 3H0KA 1NYTA 2LZ0A 4JK3A 2SICE 3BEDA 4LSWA 1Z0IA 5K0SA 3IILA 4ER5A 1GKUB 3AK4A 2EG9A 4XIJA 2NVOA 4DQ0A 4YMHA 1QB7A 4NBWA 3MMZA 4WOPA 2CCGA 4N3CA 1P45A 2EKDA 2HJGA 1UAAA 1YB2A 1W8DA 1JIUA 2NUAB 1UPUA 3W77A 4E88A 4A0FA 1U8AA 1VJ1A 2Z2KA 1L1QA 1T1JA 4WVLA 2BSAA 5C7IO 4H4CA 1PTKA 4KVZA 4BFXA 4R83A 4L2IB 1PFYA 3KKEA 2V5UA 4YH1A 1XRQA 2JW5A 1JKFA 5AH0A 5CA0F 2OFOA 2Y1KA 2AHOA 5KZMB 5E6SB 2AUMA 2P68A 2IPLA 4L75A 4KR2A 1FJXA 3UA4A 3NQ41 1F6DA 1AV7A 1U11A 2QX7A 3Q98A 4L5JA 5HNKA 1NATA 4OKIA 3EN0A 1X86B 1M6VA 2PQ0A 2RHHA 2DFLA 4PQFA 4WXRA 4AMUA 3JAWA 1V8PA 3ORSA 4OP2A 4ZCIA 1LI4A 1UBKS 1AURA 1GKLA 1DAPA 3T4EA 3R6DA 4I50B 4GDFA 2BZSA 1I6LA 3DHNA 1JECA 2IU3A 2XNCA 4PO8A 4KW7A 5F9FA 1A8UA 3KQLA 1FUEA 1EFPA 2PLNA 3ROKA 3VISA 1IPHA 3NVAA 3RSLA 1Y9JA 1U3TA 1ZA2A 3CLHA 3GH3A 3AM3A 4EMUA 5C18A 1K6EA 4FXOA 2FEWB 5EJGA 4MVJI 1RJWA 2V3WA 4P82A 4R2KA 3BJZA 4B2LA 5JI3E 1X6VA 3ABRB 3ADPA 3ITNA 4N0MA 2ZIXA 1VXOA 1D8AA 4JBNA 2NZXA 4CMGA 2FHPA 1P1KA 4XUGB 2I3AA 5BQOA 5BNIA 5SY6A 3SPXA 3UAGA 4AJKA 5EIAA 3MCAA 3FNHA 4RLQA 4UQLA 4ACBA 4OFBA 3VR6D 5K4AA 4DLXA 4W9MC 2FZVA 4BMXA 2YJZA 2PL3A 3SFTA 3PF9A 2X8BA 1H8EA 4J4TA 3VPDA 2LKDA 2W6JA 2WLTA 4NJEA 5FOVA 1L9KA 3G89A 3LQ2A 2XA2A 1YV9A 4ODIA 2ZXEA 2AZ4A 4RD6A 2IPNA 2JGDA 1XKLA 3PC7A 4NJMB 4X94A 4GIBA 1ORTA 2J6BA 4P7BA 5G0TA 3W0LB 4ME6A 4WJKB 3ZXUB 3B12A 3NJ4A 3KE8A 4NKRA 2QTVA 3AP1A 4KIFA 4LHYA 3OJXA 4HUQA 4N39A 4YRIA 4LVUA 2REQA 1Z6QA 2PWBA 4JI3B 2X5JO 1PQUA 1XMIA 3M0EA 4RHYA 1MVNA 4EA7A 4F5YA 2C9YA 1CEXA 4UAGA 3NBYC 4BMOB 1F20A 3DEAA 3RC9A 4AQYB 4KX5A 5C1PA 3M7IA 4M0DA 1D2RA 3UQZA 1A8HA 3FSGD 1IHOA 2BFBA 1G7SA 2OWDA 2I7DA 1E2HA 3GGGA 3AMVA 3N3AC 3NGMA 4EHBA 1SCKA 2CDCA 1TU0A 2PMKA 1XA3A 4FHFA 1U0LA 3ZNOA 4C0AC 3AW9A 4PF1A 3OPYB 1VJRA 1ZD9A 2EAUA 2Q99A 3AKCA 4QATA 2R00C 3V34A 4CR8A 7AT1A 1NE2A 3HCEA 3A6DA 4PN7A 5LB4A 5FJJA 5AKYA 3IAM1 2P8SA 2A7QA 4I6GA 4YLGA 1JHYA 3PHJA 5FQNA 4YK7A 3K72B 3C24A 5C4IA 3FTCA 2NPIA 5LQSA 1NWHA 5DX1A 3TRIA 2GSDA 3V9AA 4C7JA 2DPLA 3O9ZA 3E7FA 3KQUA 3C6XA 3I30X 3UW1A 4MNTA 2E4ZA 2IXDA 5COBA 3QHAA 1QFSA 2IDMA 1TTTA 4Q9AA 1NKSA 2Q3HA 3R9WA 3H8JA 3IUQA 1MB2A 1QSGA 3RU9A 3STYA 3M2PA 2YWRA 1XVAA 4DXAA 4LDZA 3ZX4A 3D3EA 3EVNA 3TSOA 2QZJA 1GVHA 2FSSA 1JWAB 4R1OA 4CM6A 4INPA 4F84A 1XXLA 4DT1A 5FUMA 3HYCA 2Q4EA 3I4FA 2ETXA 3TBFA 3B8HA 5IT5A 4D0GA 4QTUB 1NZFA 2YZGA 3ZCTA 2A0YA 5A6SB 3GYGA 1XHFA 2A7XA 3FKJA 1HKHA 4K8RB 4MCHA 2RBKA 4DLVA 5BRAA 1VE3A 5BURA 1DWPA 2DWUA 3QE9Y 4KBYA 3KTDA 2G8NA 1TO1E 2QORA 1Y8ZA 3PHGA 4EHKA 4V38A 1FDTA 2VPZA 4XQ9A 3MWFA 4P22A 1SU4A 3VOBA 3FGPA 2VT7A 1I14A 4HGQA 2JFHA 4Z9AA 2UKDA 2H1IA 1MAUA 4MVXA 1R6TA 1B6GA 1PLLA 5KYYA 1RWPA 1CWUA 1QH9A 2DG2A 4TWJA 3CRNA 3TIIA 4EHDA 2IXEA 1I4TD 2HPVA 1RP1A 4W1QA 1BGXT 1GDTA 2ZYDA 3TEJA 1XAHA 3BX1A 4C78A 3V8PA 4FFOA 4HDOB 1Q0TA 2ZYGA 4ISBA 3I2HA 4BNTA 4FEAA 2QUZA 2HN9A 3ZLUA 4IIJB 3O2NA 3OM1A 1CUDA 1IEXA 1UBTS 2V7PA 4YMSA 1MPXA 1PS0A 2COKA 2ZYUX 1P0PA 3CZPA 2VZ9A 3C41J 3JATB 3B3QA 3WADA 4Y6LA 5HCNA 5IHPA 1J7JA 2KBFA 3RTEA 4EGQA 3EXHA 4DJAA 1S02A 1W94A 1X1BA 4CTNA 4NS1A 3P4XA 3DULA 5JD6A 3CF2A 4IQ4A 1QYIA 2XE8A 1IAVA 1NX6A 2SKCA 3CB4A 3HU1A 4V0KA 1OYYA 1VLLA 2VQ3A 5EZYA 1Z6PA 5GWXA 5AIBA 3PF8A 4GLJA 4QBHA 2FWMX 3ZU5A 4Z9FA 4WEQA 4LZPA 4LTNA 3PFWO 3EFEA 1EWQA 3QLVC 3T7TA 2ZI5A 1SQGA 2QROA 1T3SA 3E0QA 4UUAA 1Q0ZA 4ZYUA 1GU1A 2O07A 2C3OA 2GZ3A 2YCLA 2QIPA 3ROPA 3FYUA 1LDGA 4O4IB 2P90A 5L7WA 2BEVA 1R6UA 4B3XA 2WYVA 3O4JA 4JQOA 3LDGA 3UF0A 4XDHA 2XAAA 5EHQA 2UUOA 3G0GA 4JR1A 4JX9A 4R05A 1Z5ZA 2PRSA 4ZODA 2XE6A 1K3TA 4RVHA 4RESA 3X2EA 3ZE9A 1AQJA 3DDCA 4QO7A 4E2XA 1Z4KA 3AYXB 4EATA 1US8A 3OOHA 2WIJA 1T2AA 2OHHA 4D8YA 2O7VA 3EX7C 2EBUA 1X1EA 2WTUA 4DCNA 1WXEA 4LHEA 2ZRPA 2QWXA 2KLHA 3PG5A 4CYMA 3IEIA 4XI9A 1E9FA 2CNOA 3A9RA 3L41A 5E1BA 4M9CA 4YPOA 2MR6A 4U6NA 1GAXA 3H5AA 4GC5A 3KQKA 4L0MA 4NPCA 4O4JF 3SJZA 3NHUA 5LXTF 5AVVA 2EBFX 1B7GO 4ZAGA 2VL7A 3OPNA 5GJWC 1GPYA 1ZK0A 2RHCA 1D0SA 5IAKA 1U2DC 2VP4A 4QTTB 3UXMA 1OPRA 1G2QA 3QJYA 2H5LA 2CB0A 1RJEA 4Q4AB 3GNQA 4BLSA 4E2WA 3QITA 4MCAA 4UU0A 1IDN1 3L1HA 1QK5A 3OUTA 1D5CA 1FXSA 1RTKA 3V8QA 5EMHA 4PZUA 1D0VA 5FBWB 3L4BC 4JI1B 2DHDA 4KPYA 1O58A 1Q21A 4K87A 4JFAA 2IEIA 2YW9A 3TRDA 4LF6B 3SM9A 2E1PA 4AMBA 1KVTA 4ARSA 3KYBA 3TQRA 2DBVO 4QOSA 2JAUA 4L08A 1SBZA 4RTLA 5CXQA 1JKIA 2OOSA 2R96A 3STWA 2GI4A 1H2YA 1YL5A 4ZRMA 2ACVA 2QR3A 4ZOEA 2VPXA 3DW3X 3NS7A 3OLYA 1KY2A 5D3MA 4DLSA 3NUZA 2GYVA 2XODA 2ZI7A 4P4SB 2PN1A 4DWJA 5KDOA 4L4ZA 1GSHA 2CFTA 4LCBA 5CCDA 3WAGA 2RD2A 1WF6A 2BGWA 5DGCA 2PS3A 3ESAA 3WP0A 2C2GA 5BN4A 5DNCA 3CF4G 1TYEB 1KA9H 2H7VA 4TROA 1D7AA 3KBOA 1E6EA 4TV9A 3HNPA 3EAQA 4X3OA 3ZJVA 5JZ9A 3FJOA 4IJQA 2WIKA 4NDZA 4P3PA 3UK7A 5JR3A 1TT5A 3GFGA 4OOFA 1SVLA 1LCIA 1AF7A 2D7JA 2VCEA 1XTVA 3DEHA 1KI2A 3GJYA 4MWEA 1RZUA 1AS3A 3AERB 5B4VA 3AZPA 2HBRA 2VH1A 3RUEA 1BMQA 3ZWVA 1XB2A 1AKNA 3A6EA 4FKBA 3FSRA 3OIGA 4NH0A 2QUHA 1OWMA 5GGYA 1PNVA 1A76A 1LB1B 1SVKA 1EFDN 2IIBA 4N03A 4X7MA 4ZVOA 2I3GA 1BXRA 3EH2A 4MQUA 1MEOA 1Z75A 3BN3A 1G3QA 2E0IA 2ZIAA 4Q4JB 2NO4A 1K8QA 1KJYA 3MSCA 1UKZA 1G5FA 4OXQA 2R7KA 5IVPA 1SKMA 1JBKA 1GEGA 5HIIA 3BYZA 2AEMA 1N4AA 4LF9B 2ZKLA 3PQ2A 1PGQA 3W78A 2VJMA 3W9BA 4BCBA 1IN1A 5B3JA 5TGDA 2B2CA 2VDMB 2PKCA 4AZVA 1CQWA 1MX1A 4YJ2B 4ZAVA 4Z5XA 3R5SA 1KQ3A 1P31A 1CKEA 4YIHA 3H87A 2OMKA 4QU0A 2P5TB 1R6BX 4DSNA 4Z3DA 4GOXA 4KXMA 1X7XB 5DN6A 3Q72A 4BX9A 4D4JA 5ALDA 1DAHA 4U7PB 3YASA 3EGXA 3HCOA 1RT9A 2ID9A 1L4FA 1LSUA 5NLLA 1QRUA 5KYWB 1LVUA 3JQQA 1N6IA 4GR5A 1NP3A 1XZJA 1XMPA 2I91A <