2MTAA

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2mtaA00
3ASOB 2YXWA 4YSQA 1KCWA 1SHWA 3AG3B 2BP0A 3SBPA 2I7SA 2FTAA 1J5DA 2UXTA 4YSDA 3OD3A 1J9TA 4FA7B 5TK4A 2H3XC 2P80D 1BXUA 1NWOA 4BXSV 3IN0A 6PCYA 2JXMA 2HZHA 4HHWA 4AKPA 3HEIB 3S3DB 2PP9A 3N55A 1JOIA 3AG4B 4DPCX 4HIPA 1HAUA 2VSKB 2BW5A 1AZCA 3UABA 4DP4X 2BWIA 4YSCA 4YVNA 2J57A 5F7AA 4YL4A 4ENZA 1E67A 3FU7B 1PZCA 1SNRA 2FT7A 5B1AB 4AKOA 3S8GB 3NSCA 3EH3B 1VLXA 1AS6A 4E9SA 1SFHA 4DPAX 1IC0A 3AG1B 1W8EA 3DKHA 4DP2X 1AG6A 2HXAA 1JZHA 4YSTA 1J9QA 1PMYA 2UXVA 4JHUA 1ZDSA 3DTUB 2I85A 3BQVA 3WG7B 4E9QA 2VW6A 4G72B 1X9UA 5B1BB 5I5JA 3ZDWA 1NIAA 2BP8B 3IN2A 3OMAB 2XXGA 1WS8A 1AANA 2IDUA 2BWDA 1J5CA 1KGYE 1NINA 1J9RA 1FWXA 2AFNA 4AZUA 2FWLB 3FYEB 2CJ3A 2IDSA 2MTAA 4DP1X 1SDDB 2BW4A 3NJGA 1OCCB 1KDJA 3ABGA 4A2EA 1QLEB 2IDTA 1JXDA 1NICA 3V9EA 2P80A 4A2GA 2H5UA 4YSAA 2PP7A 3ABLB 3WI9A 1BYPA 1PZAA 1IBZA 2UXFA 3N2JA 4X4KA 3UGEA 3X1BA 3FT0A 2XU9A 3KW7A 4E9RA 1IKOP 4P5RA 3OM3B 1EZLA 2AVFA 2OV0A 5I6KA 2A3TA 1MZZA 3QJVB 2ZOOA 3NYKA 1ILUA 4E9TA 2PLTA 1JXFA 4KNSA 1NTDA 2FJSA 1R1CA 3AW5A 4A67A 1AZBA 1KYAA 2YAEA 4NAJA 5I26A 1V10A 4NERA 4BWWA 1XMEB 3AG2B 1L9TA 2HX9A 4DP6X 2J56A 4TXVB 2YAMA 4HCGA 3PCYA 3FS9A 3NT0A 2RACA 4KNUA 1OE3A 5B3SB 2N0MA 1N70A 1OCZB 1PCSA 2BZ7A 2XXFA 2PPCA 3JT2A 5I5MA 1NPJA 3TBBA 4KO7A 5IY5B 2Y1AA 1QHQA 1YLBB 1F56A 3EF4A 3NP3A 3NJHA 4AI7A 5AFAA 1NDTA 3FU8A 1RZQA 5I6PA 1KCBA 2GC4C 1E65A 3CDZA 2HLEB 4HHGA 5B1JA 3UAAA 4A2FA 1ADWA 4G71B 4BWTA 1GS7A 3BVDB 4HALA 4HZ1A 4G7QB 5D4IA 2YAHA 4KOCA 2VM4A 2VSMB 1AS8A 1NZRA 3AZUA 2WO3B 2XUWA 4BDVA 1GS6X 2DWSA 4W1TA 2PPDA 5LDUA 3X1GA 1WS7A 3TASA 1ZIAA 2YAOA 1PAZA 1XB3A 3CVCA 4YSSA 2IWKA 3V9CA 2BHFA 1M56B 3FSVA 2PPFA 2EILB 3WIAA 1W6WA 1E5YA 2IH8A 1OE1A 2XYBA 4L0PB 2FQEA 2XV3A 4RH4A 4F7KA 3GXUB 3FPYA 1EHKB 4A2HA 5I6MA 2JFCA 3AY2A 3QQXA 4HAKA 1GY2A 4NB7A 2QDWA 4F2EA 2MRYA 5B7FA 4KO9A 3QJUB 3X1NA 1ET7A 1RKRA 1W6LA 3ERXA 1AZUA 1OCOB 5PCYA 1N68A 4GP4B 2PP8A 3JTBA 1HFUA 1XB8A 2ZONA 1MDAA 2DYSB 5E9NA 3X1EA 4BK5C 1FFTB 1KBVA 2CBPA 5ANHA 3FSAA 1JXGA 1QNIA 2X88A 3PAUA 1ILSA 1JERA 1PNCA 4UAHA 4QLWA 2PCYA 1CYWA 1DYZA 3D12B 1L9SA 3NJNA 4YSPA 3S3BB 4YSUA 1SHXA 2QPDB 2I7OA 2GHZA 2B3IA 4A66A 4A68A 1FA4A 3ABMB 1KDIA 2AANA 1L9QA 3OQRA 4GYBA 8PAZA 1TU2A 2DWTA 2HX7A 3WNIA 7PAZA 2EIJB 1NIBA 1ETJA 1PLAA 3EH4B 3FQYA 2R7EA 2TSAA 2DYRB 3H56A 4DP7X 1CC3A 3X2QB 3TA4D 1SF5A 2WO2B 3ABKB 3OMIB 1GS8A 4MFHA 3ZX1A 1JZIA 3X1FA 1BEXA 1MG3C 2FQFA 4GXFA 4KOBA 3FU7A 4K9JA 3T6ZA 1PZBA 2IDFA 5PAZA 5D4JA 2BP0B 3NSFA 3NJKA 3H4HA 3NP4A 1BAWA 2PPEA 1IUZA 1WA1X 4KNTA 4WKXA 1AS7A 1ASOA 3NJMA 4W9ZA 2IWFA 2TSBA 2YAPA 1E30A 3SBQA 1NIFA 2JKWA 1URIA 3PLYA 4HCFA 4QKTA 1J9SA 1JZEA 1CUOA 3TU6A 4UF7C 5I6OA 2GC7C 2BP8A 2XWZA 3S3CB 1KBWA 3CG8A 1IBYA 3IBOA 1T5KA 4BWUA 3G5WA 1ET5A 3CZUB 2HX8A 1BYOA 1NWPA 1A3ZA 1BQKA 3IEAA 3PAZA 4DPBX 5B1KA 3ZBMA 1A8ZA 4ZK8A 2LLNA 1MZYA 1AAJA 1RZPA 1AZNA 1OCRB 1SDDA 2XX0A 2OJ1A 1PNDA 4P5SA 3UACA 2EINB 4YSOA 3FU9A 2GI0A 2Q9OA 3QJSB 2XV0A 3T6XA 4YSRA 3OMNB 2CALA 1XB6A 3L45A 3FQ1A 2B08A 1ZV2A 5D4HA 3QJRB 2GIMA 1L9RA 2UX7A 5A7EA 1WAEA 1PF3A 1NPNA 1OF0A 1BQRA 3ZIYA 5I6NA 4KO6A 4YVUA 3NJIA 9PCYA 3NSDA 4M3HA 2FQGA 1MG2C 3GDCA 2UX6A 3QJTB 2WSDA 1SFDA 4F2FA 4WTQA 1GR7A 2UXGA 1B3IA 3FSZA 1TEGA 2GBAA 3T9WA 4BXVA 2FQDA 4DP9X 3PPSA 1V54B 1V55B 2R7EB 2OCCB 2XLLA 2PCFA 3ASNB 3DIVA 1L9OA 4GP8B 1NIDA 3T71A 2Q5BA 4E9YA 1TKWA 2GB2A 4GP5B 5EHFA 2J55A 3WNJA 1JZJA 3FSWA 2QDVA 7PCYA 3QJQB 1ASPA 2QPEB 1NIEA 3T6VA 2FT6A 1AIZA 3FYIB 4E9XA 2BZCA 2FNWA 3WKQA 1I53A 2VW7A 1ZIBA 1ASQA 3MX0B 4DP8X 4FAAB 2H47C 3FQ2A 2YARA 2VMJA 2XX1A 1GSKA 2ZXWB 3CVDA 1HAWA 4G7RB 3QPKA 1A4BA 3TBCA 4JHVA 3UADA 2PPAA 2Y69B 4N8UA 2ZWNA 5TK2A 2AZAA 1GYCA 1M9WA 2E86A 4E9VA 2YQBA 1GW0A 2HRHA 2IAAC 3NJLA 1SJMA 2XVBA 5FC9A 3PXLA 3MBWB 1GY1A 4G7SB 4Q89A 4Q8BA 3PAVA 1OOWA 2IWEA 1M57B 1X9RA 2AZUA 3H4FA 4PAZA 1E5ZA 1RCYA 5AKRA 5B7EA 5F7BA 5I6LA 3FPXA 4YSEA 2W88A 3IE9A 2GSMB 2CAKA 1BXAA 4CSZA 2IDQA 3CDZB 1AG0A 1ID2A 1UATA 4N4YB 2YAFA 4EF3A 1SF3A 2EIKB 5AZUA 1JVLA 4A2DA 5I28A 3GYRA 3UAEA 1JZGA 4BDVB 2EIMB 4DP0X 1AZRA 4CSPA 2CCWA 4M4RB 1CYXA 2IH9A 1AACA 4PCYA 1JVOA 2CUAA 3WKPA 1PLCA 2YAQA 1AQ8A 3NJJA 5B1JC 4DP5X 1KV7A 2VM3A 1A4AA 1L9PA 1WA0X 2DY2A 4JKNA 3T6WA 2J5WA 3NJFA 2NRDA 4AX3A 1BXVA 1A65A 1JZFA 1OV8A 5I5IA 5B7MA 1PLBA 4UANA 2VN3A 4E9WA 1AOZA 3RYMA 3NSYA 2VW4A 3U25A 2YXVA 2HRGA 4KO5A 3SBRA 1DZ0A 3C75A 1ET8A 3EHBB 1ZDQA 3HB3B 1TEFA 2XV2A 4HCIA 2FT8A 4AKQA 2W8CA 3SQRA 1CURA 1OE2A 2BO0A 4GY4A 2DV6A 2X87A 3CVBA 1BQ5A 1ZPUA 3S8FB 1WA2X 1A4CA 2QT6A 3EH5B 6PAZA 4G70B 1PY0A 1AR1B 3KW8A
chains in the Genus database with same CATH superfamily
3ULVC 5DMKA 1CF8L 5T1LB 1G1KA 1OO2A 3QEHB 1ONQA 3SBPA 3IMUA 2N01B 3TCTA 3N9GL 5FGCB 3RWGA 5EU5A 1HH9A 1J12A 3ZZSA 4ANKA 3OWRA 3NACH 2OL3L 3CXDL 1TU2B 1FL3A 1URZA 1FP5A 1PFCA 1I8LA 2EKJA 4A37A 4WNJA 2CGYA 4J1UB 4DCQB 5JHLL 1KIQA 6CGTA 2PP9A 4XI5C 1ZJAA 3ZOAA 4PQXA 4RZKA 3Q2WA 3MRIA 3L3IB 2IQAA 2X9XA 4YSCA 3T1FA 3KPRB 4NIYE 3F01A 3KXFA 3QWRA 1WZMA 4U3XA 4W9HC 3VFNB 1C12A 3HFMH 4HK3J 5I1CL 3P9MB 4X98A 4WCYH 4OFYD 1WTLA 5LGYA 1CLOH 1R0AL 1A7BA 1E6OL 5FKAB 3V7AE 4HZLB 4XB8A 1VGEL 2V6HA 3AG1B 4M8RA 3VFTB 4KZ0A 1T2QH 3RLSA 4NQCA 3ARFA 1AXIB 5K1JA 4ZOCA 2WYHA 3P2BA 3CN0A 3QFDB 2XVLA 1PZ5A 4O02A 4E9QA 4JFXA 2FB4L 1T7VA 1SHMA 4ZUUA 2Z93A 4IU2B 3RVVC 1V27A 3EOTL 3CZFB 4LARH 2YC1A 5F9AC 4RAVB 1RL1A 5E2UH 4IHOB 1PEWA 1T4WA 3SPIA 1JVKA 5EOQH 1G7QA 2P5WB 1WHOA 1K6QH 3T0WA 2PWFA 2EDFA 2WQ8A 1IAOA 4HIIB 2RB8A 4AEFA 3CFCH 2QJDA 3II3A 4QGYA 5AW1B 1QVOB 4MA3A 4NO2A 1L0PA 1JXDA 3OAYK 5JW3H 5ESQA 4P04A 2D9CA 4WI5A 4M6OL 2VDPH 3F64A 1EWHA 5BCAA 5K93A 4P5RA 3O45A 2AVFA 2C1OA 5DO2D 4NNXB 3HG1B 4DGYL 2PKDA 5E2WH 3QDGD 4UTCA 3ZHKA 4AEHL 3NIGE 1N3NA 4IMLB 3U9PH 3LKOA 1T0MA 1L7IH 4FG2A 5DD1L 4YLQT 1JXFA 2KH2B 1NTDA 1GMIA 2PXYA 4RGMB 3ZE0F 4WWPA 5E4OA 2N59A 2YAEA 1NGQL 3QS3A 3MBXH 3DDFA 2AKRB 1BFVH 4XNQB 4XXDB 1JK8A 4HCGA 3BKML 1Q94B 1KGIA 3NT0A 1G7HA 2EXTA 3B2UC 3OLEA 3WEMA 4OFPA 4G2AA 4UM8B 1M05B 1IKNC 1MHEB 1EERB 2PW1B 5IIEB 5GRXG 5K9OB 2GUOA 3KGUA 1QBMH 3FFCE 1QHQA 5D7IF 5FM4A 3WNOA 1MCFA 4BFJA 5BVJB 2EE6A 4OFDA 5DQJB 4D7PA 4HIJB 5E8OB 3BP4A 4UT6A 4N86A 3QPXL 3MNMA 1IAIM 2OTWB 3IMVA 1OY3B 4OLVH 5TF0A 1P5UB 4YJZL 3WY4A 1Y07A 1Z5HA 1YNKL 1K5NA 1SEQH 4P5TC 1ADWA 2A74B 2NZ9D 5EBWB 3NN8A 5T1KD 3K6SB 5DUPH 4G7QB 3WJJC 3BH8B 2C9VA 5J1AB 1IX2A 5BNXD 4KOCA 4XPGL 3UTZA 2IAND 2W60B 4OZ4A 5EC1A 4Y4HB 4MSWA 3LVTA 4RMQA 5DJ0B 4M6NL 2J6EH 2NX5B 3X1GA 2W0LA 2E7LA 3NPSC 2WK2A 4FLHA 2Q10A 1NC2D 5HHPA 2I9LA 4KY1H 3K91A 2Y6SC 4ENEC 4OI8A 2FECI 3KGRA 4H8WH 1VPOH 4XPFH 2C1PB 4B9YA 4E41D 5M94B 1TEYA 5BQDA 2I69A 3RB5A 1W6WA 2OR8A 2JCCF 1NOAA 4HIXH 5EU6D 3UBFA 2RHEA 3VFUB 5FOBB 2WBXA 5DRWB 4XRCA 3P0YL 1G4MA 2VJ8A 2D31B 1FRGL 5F3BA 3LQZB 2V17H 1SY6L 3B2VL 5INDA 3UTTD 3S7GA 2J5LC 4B5EA 4PGBA 2ROYA 3CIAA 4DEPC 2GY7B 3IRCA 4KDTA 3GIVA 3GJFA 4PWKA 3OGCB 3ZPDA 3L54A 5IVNA 3IFPB 2MQCA 4R5VA 1H3VA 4XX5A 4EO5A 5CF3A 3ZT5A 4YHKL 2ZZUT 4OFIA 3RX8A 1R3JA 2DD8H 5DYOB 1UWEH 2W38A 2ZWKA 3PL6B 3BVNB 3UOAB 2FH6A 3QWOA 4RNRA 2IBGA 2DL9A 1MJ8L 3CDGB 3K2KA 3O8XA 3RGVB 3RX5A 4QXVA 1QO3B 3FSAA 3R06B 5DJXA 1TFHA 3VH8A 4J3XA 4PW4A 3ZN6A 2OJEB 5JDSB 5I1HH 2VDMB 3KYKH 5D7EA 5C0BB 3VG0H 3QJFA 4KKRA 3N50A 2PCYA 4HDIB 1KTBA 4YSPA 3RNKA 3MLWH 5TDOB 4FYQA 3PWJB 3PIQB 4NT6A 3UDWA 3BIAX 2O5NA 1HINH 2ZWZA 3P4OB 4G7YH 3RKDC 3IDJA 4PWJA 2KMWA 2Q1EA 4PS8A 4L4VD 4JDTH 5AVYB 4FFYH 4FDWA 5CMAA 2OSLA 3K80A 1RXLA 3QDGE 5CCHE 2OMZB 3K81A 3MA7B 4GAJL 4WWOA 3ABKB 3OMIB 2IBBA 4GBXC 4HMEA 4YDJA 3QUYD 2K7QA 1I7TB 5DJDA 3TJEL 4P2OD 3L5WA 3QI9C 3U0WH 4AYGA 4P46B 2AP2A 4AMXA 1JAEA 5PAZA 2XKUA 4R97C 4YHMH 4WEMB 4PGCB 3KPPA 3HZKB 2X4NA 4PJDB 3ELAT 4PW3A 1I1YB 4OZHA 1D5ZA 1OWRM 1MFVA 1E30A 3TJHC 5IMLB 1CLCA 2A83B 1I9IH 1DEEB 1YCSA 3P73A 3NSXA 1MFNA 1XCWA 2IQ9H 4NBZB 4P49A 2CBOA 4P4KD 2P49B 3MLXH 3KMDA 1R3KB 1T5KA 3AWGA 2R59A 4N8PA 4BWUA 2EO7A 4WUKH 2E9GA 1NCJA 2C3VA 2WLIB 2GK0A 1OTUC 1TVDA 4Z76B 2XRAH 5DD3L 1KFGA 4QIRA 4TF4A 5I1AA 4PJAB 1VERA 1T03H 1TYEB 2LLNA 3OKOB 3TEXA 1AAJA 3LB6D 4TNVF 2P8LA 2X40A 3EJQA 4GKZA 3PHOA 3CXHK 4G6KH 4IHBA 5AWNL 5T1LD 2Q8AH 3SHSA 4AENA 4DO4A 4L3EA 3U7WL 2IANE 4I2XB 5IW1A 1R24B 1PLGL 2ICWB 2X70B 4X42A 3QJSB 3SCMB 4KITB 4XODA 3PGFH 1ZY9A 4EN3B 4QRBA 3NZ8B 3QHZH 4PJ9A 4IIQC 5ETUB 2E6QA 3RIFK 5J13C 5KVEE 2J43A 1IBBA 1JTTA 1MHCA 4WO4C 2Z8VC 4JPKL 4PREA 1ZHNB 2R39A 4WKZB 4X7TB 2CHZA 1ADQH 4E41E 4ZZKA 2FBJH 2VDMH 4NJ9L 1QTYT 3KPRD 5EZIL 5EU6E 9PCYA 4U0RB 4U1SB 5FGBA 1P7QD 5MEPB 3FUDA 3IFNL 4Q2ZB 1A7QH 1U3HA 3JWNE 4LAQL 4MXQD 4OLWH 4Z9KB 2FWUA 5GISH 4JM2A 4AOFA 1R3HB 5E00A 3ELQA 4X2UA 3B2MA 1MY5A 1XCQB 2F61A 4I1PA 4KI5C 4NBXB 5GGVL 3ZMRA 2YD5A 1NMBL 2J12B 3ZE1E 4XBPB 1U36A 3RI5F 3BXNB 3ORJA 1A6ZA 1G7IA 2A4CA 3E6HA 1N6QL 4LKCB 1NIDA 3L13A 3WFDH 1CICA 3CHPA 4GQ9L 1I7UB 5HVWA 1EX0A 2FO4A 4MJ2A 4HP5A 1ZS8B 3K71A 2JB6B 3FSWA 3AITA 3HAEA 4WHCA 4EZKA 1U8HA 2RFXA 4ELMA 2NT1A 1T1XB 1J1OH 2Y1ZA 4OZFG 1F5WA 4X4XB 1VSCA 5CN3A 5F1SA 3MV8A 4KXBA 3NTCH 4PLNC 1AO7B 2X1QA 2P5WD 3OHXA 4C56D 4I13B 5T5FL 5GQBA 3FQ2A 2XX1A 4JDVB 2EKSB 3TIDA 4MNGB 5D4QA 1HAWA 4G7RB 4A7VA 4OT1H 2CXKA 1EVTC 4JO1L 5FO9B 1FG9C 1RVFL 4NRYB 1MCWW 2OMTA 1MCJA 4PJEB 2AZAA 1G9MC 1XSJA 4Y19E 4L4VE 5IR1B 4P3DA 1F97A 1QBLH 2V2TB 3OLDA 2OYPA 3ABZA 4FL4B 2IWEA 5AD0B 8CGTA 4KFMA 2ZG2A 4NUQA 3KWWA 3RWEA 3E6FA 5AKRA 3DX8B 1ZV9A 4LCWB 4NXKA 2GKIA 2BCMA 3HJ0A 4LCVA 3ZGHA 1AC0A 2A73B 1I1AA 4OJFL 3HMXH 3ZRSA 4IJ3B 4N4YB 5L8JB 1U33A 3DOSA 3O6ML 3WKMH 1RK1A 3D39E 4IKIA 2XHNA 5HHNB 4O2EA 1HXYB 3HE6D 3R4DA 3CC5B 3VFOB 1RZIA 2BY3A 1WLHA 3JV4B 3QHFL 2VISB 3RNQB 1CYXA 3V6FA 4FG0A 3U4BH 3FUJA 1QRNB 5B1JC 5I17A 4HKXA 1F2XK 2FBRA 2ZSWA 5EBLA 3T0VA 3EOYG 4QRTB 4R0LC 1L9MA 4HXBH 5JLZA 3S36X 3W39A 4G80B 2YPKB 3OPZH 5D2NB 5EBMB 4RISL 5A7BA 2ZYIA 1SLUA 5I1EL 3SDDB 1RIHH 3NCMA 3CUPB 1DR9A 3BW9A 3V0JA 1I8LC 4LRNH 1IGIH 5FGCE 5LUMA 3O3BA 1MCLA 1SQMA 5CJBA 5J56B 2VDQB 1OZTG 4MXWL 2FT8A 4Y4HD 1KJMB 4V2BA 1WBYA 2QGCA 2XQYA 4P23D 2O5XL 4ISVB 1THAA 1QSEB 3HC4H 1LILA 3L08A 3WU1A 1D5XB 3DYOA 4OBSA 4UT9A 2WBJA 4G6JL 3WGVB 5EU3A 3TCLA 1T80A 5BQ7A 1ZPUA 1K8IB 4I48A 4KX7A 2Y72A 2OA9A 3VB9A 3PWPB 2FRGP 1RZKH 1UA6L 5T5NG 1DTUA 5J12B 3KPRE 2XZCH 2GJZA 4M62L 4JFEA 2YXWA 4UU9A 2Z65C 1UM5H 3APFA 3L95B 4K94C 2AEPL 3FN9A 1G9NH 2CDEA 3J7HA 3D0VB 3DVNB 4NQDD 3W56A 1S7TA 4MJ5B 1PZSA 1UFGA 4L1HA 4ZPTA 1MFBL 3KVQA 4GMTH 4MDJB 3QNXA 1ZGLP 2QBWA 1MHHB 5KYXB 1NKRA 3HPLB 2XTLA 2NY6B 3RWIB 3HEIB 3KLSA 4ZMNA 4FQCH 1AZVA 2CK0L 3FQNB 2FWOB 2NY5L 2Q87A 4DPCX 1N0XH 1TZGL 1JCVA 5BUGA 3C5XA 1JNLH 1CCZA 2H3KA 4AY0A 3CSFA 5DZVA 3ZGIA 1DUYB 2R1XA 4G59C 1HWGB 4WUUA 5I0YA 5AOLA 4FXLA 1F0LA 2CLZB 3PL6D 5BMFL 4TQ8A 4NPYA 5FKPA 1BOYA 5CZVL 4Z5RA 4OQ1A 3AY4A 1SNRA 3VGAB 5CCKH 2DQJH 4UZGA 4M48H 4XHQA 1AS6A 1YPZB 1FZMA 2P5WE 1UYWH 25C8L 3MCKA 4C56E 3RHWK 5C0BD 3RPIA 1CFNA 4XTRD 3BJ91 2BOBA 2ATKA 3DBXA 3CH1A 2ERJB 3S5ZA 3QYCA 3UC0L 3FUMA 3HBGA 2APSA 3LZLA 3SY0B 1MHPH 2JKTM 3ARGB 2PCPA 4A63A 3QCUH 4ONGH 3GMRB 4OZGE 1CDCA 5E9DA 3LRGA 4L23A 4YX2H 4WU7A 1NIAA 3HG1E 1A2YB 2Y7SA 2JKRM 1WS8A 2WQSA 3FH5A 2AK1H 5E8NB 3HG0A 1NBCA 2PO6A 3BZ4A 5IF0B 1WCBA 3SE8L 5C08B 2Y7OA 2AFNA 2JCWA 3WJMA 2PTUA 4X5WB 5TQ2L 5GGRB 1ZT4B 3EYVA 3FO1A 1CFVL 4G8FA 4DP1X 3ARDB 5FCUH 2OBGA 2IPTH 3SOBL 5IHZA 4A04A 5DUJA 2FIKA 1QWUA 2VRAA 4BYHA 1WWBX 5KVDH 5JNYA 1EO7A 1KYOJ 4EVNB 1T7XA 1U8IA 2WYZA 3N2JA 5FV2A 4ZW5A 5FECA 3RFRA 3FT0A 4LP8A 4FNQA 3DVGA 5I6KA 2A3TA 1IEAA 3HE7A 5F72S 5JUEL 5ERWA 4WJG3 4PLJD 4ALAL 4OM0H 1FCGA 5AG9A 2PLTA 4UQEA 2AGJH 1DN0B 3I6GA 1Z9NA 2X89D 3B7UX 1A66A 15C8L 2QMJA 3O2DH 3GBLA 3MX0A 2AJXH 4PJ7F 3GK8H 1FHNA 4B9ZA 1AXSA 2HX9A 3OJ2C 4ETQA 4N0YH 2YAMA 3UZEA 3BT2H 4QTFA 5CBAB 3WAJA 2QADC 4OM1H 4BRJA 2ADJB 1A6PA 2KDYA 4HMDA 4XBMA 1U8JA 4MX7B 2UZYA 1B4JH 2ZICA 1FLTX 2J4WL 3L3KB 1BLNB 3SCMD 2X38A 1WFUA 4DAGH 5C92A 2IF7A 4KO7A 1YNTF 3F04A 4FZEL 5IY5B 3WTSA 4XO8A 4F2MB 5CR8A 1WIPA 2CHDA 2DBLL 3GRWL 4RGMC 3BO8A 3FQTB 4I1RA 4XMZA 1MCOH 1LK3L 3GZKA 3SDAA 4ABQA 4CW1B 4AE0A 2P47B 1BQLL 4QHNB 1G7LA 3HC0A 5FLUA 1ANUA 3QW9A 3ZKXB 5JTWA 2X0WA 5T8IA 5IFJB 1AY1H 2P7TA 2XXMB 4K9EH 4G71B 4KDTC 4JLRB 4NQDE 5IQLA 1UWYA 1BZ9B 5CEYA 1IE4A 2X12A 1GS6X 3WO4C 4RETB 1BD2B 3VXTB 1LO4H 1ZLEA 4KQ4L 4M4RA 1SXBA 4F7TB 5A40E 3FF7A 1UM6L 1NCAL 1ZWIB 2W92A 5ITBH 3HUJA 3U2SB 4NAQA 2A74C 4M5TA 4DGVL 3CVCA 5ISZB 4BFNA 3QP3A 1THCA 4YSSA 1YEKH 2YEZB 3V9CA 4RCAA 1XIWB 1J8HB 1L0QA 1ZKAA 2BIIA 3DMMA 3LKQB 1UXWA 4G1EB 4U0QB 4U33A 4ZXBB 4A38A 2Q0ZX 4N9GB 3L5XH 1TCMA 3UDWC 3VXMD 1MQKH 1OF2A 1FH5H 1QEWB 2C9PA 3DJTA 4R5TA 4HLEA 5C0BE 4PGDB 4CU6A 5DMYA 3M8OL 3FB7B 3LZRA 2WWMD 1Q9KA 3F6IA 4U1GC 2EE9A 1KWKA 2FAUA 3GJFK 1ZLWH 4B9CA 1F41A 4IBVA 3B9AA 4UYPA 2QDWA 2XNAB 2Q2EB 3WN5C 5H35B 2DQMA 1M71A 2J21A 1H8SA 1D2PA 3KPLB 3ETBJ 3MLSL 1P0SE 1HOCB 5PCYA 1B0WA 1OGAD 4ZFZB 4QGTA 1MDTA 4RBPH 2JI2A 1ZTXL 4JRXA 4R7LA 2BH0A 4OB5L 2BVUA 4J3OC 3X1EA 3CSPA 4IS6B 3T77B 1EAOA 4YOKA 1LYQA 1HCVA 3ZL2A 1U92A 2HKAA 1T1YB 3FDWA 5AW3B 3RVWC 2OYKA 4FQLL 2DQ6A 4PRHB 2BMKB 5ALBH 4XNMB 1ZA3A 2QPUA 2O4EA 3NJNA 5B7MA 1ZLUH 1E2WA 2HT4C 2B3IA 4FP8L 2GVYA 5A3ID 3BPOB 3CNKA 3TTYA 2X1WL 4ZX5A 5IJDC 1CG9A 5LLIC 2HX7A 3L3GB 3MJWA 4JRYA 3RGVC 3ESVF 2CWRA 3NVQA 3T6QC 4Z8FH 3FQYA 4Z3EA 3IPFA 1EZVY 43CAA 1LO0H 2R7EA 1ZANL 4G6AD 4KXZH 1QRND 3PWLB 3QRGL 5FAAA 5EIIB 3BLKA 4QRRD 3L17A 4N25A 4ODWA 4FLOA 3MXWL 3OKEB 4LGPB 1KB9J 3H0TA 3ROOB 3NQKA 2FQFA 4KU1A 5HI3C 3GB7A 1H3GA 1A21A 2H0FA 5BZDA 3F00A 2BPBA 3X12A 4ZOBA 1H0DA 5CU9A 5HPOA 1WC7B 3BFOA 4LL9A 3NJKA 4M8VA 4TMPA 2X3BA 3DGCR 3NP4A 5AYUL 1RJYA 3OX8B 4NC0B 5CLXA 4L9LA 2EYRB 4BRVA 4CU7A 3DSNA 3MUUA 4I2XE 1E2VA 1FYTB 4N2BA 4H1LA 4RFOL 5AENA 1JF6A 1MRDH 3AAZA 4ZNEA 4NQVA 3L4XA 2DWEA 3ULVL 1JI1A 4IOFC 3ZKMC 4P46C 2JE8A 4UQ2A 4RWYL 4D7BA 4U4BA 4Z7VE 3HNTL 3DETD 3ULVF 3LAFA 4F24A 2XIDA 3IBOA 1U3HC 2AJSH 5CINH 1XSKA 3QE5A 4UDTB 3SKNA 5IROD 1EHXA 2R29H 4X6DF 3PWVA 4D0BA 5CBEB 1YA5A 2F54B 2V8LA 3FB8B 1GSMA 4JM2C 1TUPA 1BYOA 1A3ZA 3PS6A 2VXTH 5DHVA 1JZ7A 3BSZL 4LCYA 4TVUA 4JCMA 2XY2A 4X5RA 4PJHE 2X53A 4ANVA 4P57B 2EDDA 1HILB 1TYJA 4ZRGA 1CXLA 3OZ9H 2AW2A 3MUGA 4MDIA 2XV0A 1CICC 3F7VA 2FR4A 2BS71 3MC0A 1IAII 3Q13A 4EI6A 4FG4A 2FVNA 2B08A 2G3MA 5T1MA 2E3VA 2NY6D 1KCLA 2VDRB 3QJRB 5EO9A 3TCXA 2ZNWA 1MI5D 5DMGC 5E6YA 1C08A 2JF1A 5JR1H 3DLQR 4KXCA 4HWBH 1HQRB 4OI9A 1I85A 2ORBH 3T3PB 3OHXC 4PB0H 4HG4K 1JHKL 3SIKA 3VSVA 4A6YA 5HYSB 1BCIA 3MA9H 1O6SB 1Z3GH 3QXUA 1TVHA 1P7HL 5HBBA 3VXME 4PBVC 5AAWA 4D0CA 3MLYH 3DTXB 4GRWF 2G2RB 3NSDA 4EN3C 4LIQH 1A6VH 1KTLA 1AO7E 4L4TA 4OV5A 1H9DA 1KYDA 5J06A 4GW1A 4GUCA 1ITBB 1Q1JL 1MFAH 5E7FA 4MNGE 1FNEB 3VD9A 3X14A 3DRQB 5CJQL 5DEGB 4Q6IB 3G08B 1MCWM 2XLLA 1JHTA 1A6TB 4CGUB 2L7UA 1OGAE 3EXLA 4UZSA 1IGYB 2FJHB 5FR3A 5EUOE 3AU1A 4NKDB 3RURA 2YK1H 3JWOC 1OAYL 3NAAL 1SM3H 4Z7WE 3QJQB 3Q7JA 1NIEA 4N2FA 4W81A 4XMKH 5L7XH 3SDXB 1KNOB 4HC1A 5IKCB 1QABA 2DIAA 4X7CC 2JIXA 5C08D 4DKDC 4IOIB 4IRZH 2WM0A 3PDOA 4OD1L 1U8QA 3EGXA 5DDHA 5IEKA 3QUKB 2VC2B 4EJ1C 3ARDD 1YEHH 2ZXWB 3F7PC 3VXPB 4ECNA 1B2WH 3CXFA 4XB7A 2GT9B 1KELL 2FEEI 1ZLDA 4UINH 4K7FB 3SD2A 2BK8A 4PP1D 3VWKB 3W9EB 4EEEA 3RVXD 4AK2A 2Y69B 4LLQB 4NPKA 1J1PL 5TK2A 3VB8A 4AUJA 1KXTB 4DGIL 1N7ML 1GW0A 3LNEA 1PYWB 1S5HB 4OF5A 3GBNH 1QRNE 3U6XA 1GY1A 2KI6A 4L1DA 5C0EB 1RLWA 2CO6A 3G6DL 4XZUB 3MMEB 4AXWB 4ZZFA 1U58A 3QQ9C 1OWWA 3L3JA 4QRRE 5C9JB 4BBWA 5D2NE 2YIHA 2IV8A 4FTVD 3Q9PA 1DUZB 1V7NH 5I76B 1A9BB 1AI1H 4JO3L 1DSFH 5JYLA 2BY1A 4GLRI 1SF3A 4E42B 5F9OL 2X4SB 4XVSL 4U1MA 1E9QA 3ZDYE 5HD8C 4R3SA 4NNYB 4FL4C 2KZBA 2E27L 2VDRH 4UQAA 4KQ0A 3Q44A 1GGTA 2F08A 4U1IA 5KYUB 2A6DB 3EBHA 1BZ7A 3ZMEA 5H4ZA 2DMCA 1AQ8A 2QLVB 4E0RB 4DP5X 5KVDE 3GSWB 2LGNA 4FQXC 2X2YA 1A4AA 4YHYB 4EUPH 2PYEB 5SWSD 1OB1B 2BX5A 2VJ0A 3VMOA 3TO4B 4AX3A 1JK9B 1U8OA 1F4AA 3KGTA 1CBJA 3IGAB 4LLYA 4OAWB 4XHJC 4YGVA 3LKRB 1BZDA 1I82A 1HZLA 3NSYA 4JFDB 3BH9B 2VW4A 4NCC1 5C97A 4TM9A 4PB9L 2IEPA 3FMGL 2DM3A 5AB2A 4JPQA 4JO4L 4ZW3A 4ODXB 4OD2B 2XQYK 1ZDQA 4LT7A 4B6ZA 1NFDF 3LDBB 2UUDK 2H6PA 2UZPA 2WLLA 1T1ZB 3AB0B 1GGCL 2Y2WA 2F74B 1IGTA 4QDGA 1MI5E 1Z9SA 2BCKA 4LDEB 3SDDC 1BQ5A 2A0LD 4OGAD 2CGRL 3CFDB 1LK2B 3FF8A 5G4OA 4IOSA 3TNMA 1SRDA 4XNUH 3GI8H 4MMXC 4AYDC 3D25A 3GHEL 3OKMB 5ISZD 4OJCA 1NEZB 1MFDL 1VGKB 1MH5A 2WUCH 2VXQH 4WI0A 5K1VA 3WL9A 2VC2H 1O75A 3QISA 2ZKHL 1FGVL 2D3VA 4XP5H 3REVA 3VWJA 1SHWA 3C5ZB 1YPZE 3NCYP 1B0RB 2M2DA 4RMSA 4OCLC 2Z7ZA 2B8OT 4GEIA 3LZPA 3QCVL 2H3XC 1CIDA 1BXUA 2YBRB 2XQ0A 3FN3A 1X6NA 2OR7A 3CLEL 5JW5B 2X4OB 5TPWL 5AVZB 2QVMA 2ZCKH 2F7IA 2OJZH 2WLKA 1CQYA 2NY2B 3QARA 3IXTB 3UABA 2R0WH 4NC1C 5CD3A 4H5SA 3L2NA 2DOCA 1UXLA 3PXJA 3VGBA 3MCG1 4BHUI 1DVSA 2AAAA 2P3YA 3EYFB 4N5UA 5C08E 2E0PA 4ODUB 4NUPA 5L4MA 5L9DL 3MZGB 3MRRA 4OGZA 5BV7C 4OJDH 1N0LB 3CN1A 3UO1L 5J8OA 4M1DH 1VB9A 5AW4B 5G5DA 4AJ0A 4FFWD 4LHQB 3AM8A 4K3EH 3HE7C 1PMYA 1SEBB 2F2HA 3H9YA 4KKQA 1AJ7H 1ZT7B 3IDMB 3BQVA 3IJHA 5DEZA 5C6WH 3SJVB 3I6KB 2YMTA 2ZX6A 3O0LA 1CXFA 3Q6GL 3FFCA 4FE9A 3OMAB 3VQMA 3WELA 4PH8A 1FPTH 2ICWI 4ODSH 5IW6A 1TTCA 2BWDA 1J5CA 4G6MH 2HH0L 2C34A 3F8UB 4FTVE 2ERJC 2OX5A 1J9RA 3WY2A 3OPUA 1MCKA 3BQUB 3FYEB 1Q9WB 2CJ3A 2R2EA 3ARGC 4AM0B 2VMCA 1L7TL 3RIFF 2B4CC 5F7UA 4ZMAT 3PDDA 2WOYA 3H8NA 4KY2A 3TTSA 1E4WH 3WHE0 3RVTC 4I5BB 4OF7A 2R0KH 4X4KA 1FYTD 2UXFA 3PRZA 3L16A 1EFQA 1MFCL 2Y1VA 3K46A 3L7FB 4P2RA 3RL1B 4TV3A 1JD7A 2NY4B 1MVUB 1FORL 4F2ME 1A25A 1TVBA 5SWSE 4XXCA 1G7JB 3O11B 1MCRA 3SKJL 3NH7L 1E4HA 1XAUA 2ZOOA 2CUIA 2ZF9A 1ILUA 1INEH 3TBSA 2F54D 2BSBA 2JMRA 3QC5X 3TT3L 4OFYA 5INCA 3RWHA 1KMGA 2YGQA 3FUKA 3ZT7A 2J8UE 5I1JH 1XMEB 35C8L 3AG2B 5BZZA 1L3NA 3W11D 5CIPA 4C47A 1EO5A 3QXDA 3DUSB 1T20B 2RACA 5DC0A 4LPYA 4R4BB 1CDUA 1PCSA 4HK0B 3B3BA 2IG2L 5ID1B 2PCFB 1CTNA 3W9DB 3DMMC 3L7EB 1WEJL 3FQRA 4WENB 3OLGA 4LGRB 3S5LA 4ONFL 4AI7A 1YEDB 2HRLA 4WSKA 5ISZE 5AFAA 1H3UA 5E1AB 3UTSB 3VXSB 1IILE 1J8HE 3CSTA 5TE4H 3NIDF 3AT9A 2F58L 4KZDL 4F93B 1B6DA 3BAEH 1N4XH 4KI5F 4Z95H 4P2YA 3N1FC 5CZRA 4GG6F 3HZMB 4HALA 2WB1A 2MFNA 5B3NA 5D4IA 2NXZD 4YK4C 3DX4A 2VM4A 1G4RA 1NZRA 3CDYA 3GSOB 3MRGA 1IL1A 2XUWA 5EZJA 2AEOA 1EEYA 1GHFH 1S2EA 4AIZA 1MF2H 2GCYA 2X28A 3WFBH 4LSPL 1P2CA 4NP4H 3ZRCC 2VQ1B 2TRYA 5I9QB 5E99H 1HYSC 3QDGA 2FO1A 5FO7B 4QPEA 4ZFOB 5EF3A 1WZ1L 4PEEA 2AVGA 1G9ML 1E5YA 2IH8A 5KBDA 5DUML 1O7DE 3GSNB 5I1GH 2BRRH 1IVLA 2GK2A 1RJZA 2XV3A 2CBTA 1LD9A 5C0IB 1M7IA 3RUGB 2F1BA 4WU5A 1MWAL 5I6MA 3DYPA 2JFCA 4MJIB 4LIQE 3CE1A 4XMWA 3QQDA 1FNSH 1BBDL 1XIWC 4ZXBC 1JDDA 1J5OH 5HHXH 3ML8A 4GRLC 4PJBF 2Y5QA 2J8HA 1FCCA 2YPLB 5TDNA 5HYJA 1TOXA 1Y0LB 1AMYA 4AV0A 1MDAA 2BDNH 1F02I 1VEPA 4H0GA 2EC9T 3HBPA 3VXNB 4MCYA 1UXSB 2BC4B 5CSGA 5FO2A 2E47A 1A6WH 5A2FA 2V2XA 5T1KA 1QG3A 2C26A 2EH8H 3TYGL 1C7TA 1JPFB 1CN4A 2IANA 4GW5B 5MI0C 4GYBA 4KKLC 4Z1PA 1HXKA 4DK5A 1FYTE 3G5VA 1OSZA 2EIJB 3O3AB 3QULA 4F8OA 4HS3A 1T2QL 3I9GH 4KXDA 4JR9H 3CZLA 2HVJB 1GJIA 1O7DC 5L2JA 3ESPA 2WZ5A 2Q7NA 2Y7QA 1A4KA 2BSSB 3OF6D 1NC2A 1FFOB 5T3XH 2PYED 1KJ2B 5GJTH 2R69L 4UMSA 1DBJH 3SE9L 4E41A 2O6PA 4MFHA 3TO4D 4BE5A 3BPOC 2F54E 2BIMA 1DQKA 2AF2A 2EDRA 2GAZB 2BP3A 3CAFA 3FU7A 4KKZA 5IQ9B 5EU6A 3O3EA 2IDFA 1UJ3C 4G6FB 4JFDD 3V4VB 5HPMB 3H4HA 1AVAA 3HHSB 4WIQA 1BAWA 4ZFGL 3F7YB 2C9RA 5EOQL 2XPGB 4KJPD 3UTTA 1PY4A 3HS0A 1RUKH 5GZOD 1NBQA 1LMIA 3NG5A 2LFEA 4YWGL 5FA3B 3M17B 3QJZA 4PJ8A 1G6RB 2MNJB 1R5IB 4K94L 2CNZA 5DHYB 3RHWF 3WNMA 3ILPA 3K4DA 1T22A 4Q56A 5D70H 3VFPA 1NFAA 1E27A 2BJMH 3C8KB 3W0WD 2E76C 3T0EB 3T3PE 3GSNH 4DFHA 1AHMA 2X7LB 2DB8A 1ET5A 2E59A 1BQKA 2OMUB 2UZXB 4TLSA 3ZU8A 1L6ZA 1A8ZA 4YHNB 2NYZA 1E3FA 1BAFL 1XGYH 1J1XH 1S9VB 4HX1B 3OAWA 4MBOA 3UZVB 2Q9OA 3U7YH 4BUQA 1ULVA 4LEOB 5DXWA 3D69B 1AKJB 1DBBH 4QOKB 2WIIB 5IB2A 4B95C 3TBYB 3GZOA 1UM4L 43C9B 4L4VA 3HIZA 4TYUA 1I4FA 4KX9A 4PCKA 2XWJB 3KM2A 1NPNA 1U93A 5IVZA 2XN0A 1NEPA 3REWA 3IAGC 1BPVA 2VN5A 4Z77B 3QUYA 2WWOA 1ZLVK 5DJAA 3T0BA 3VD3A 3KZ8A 3Q3GA 3SDXE 4P2OA 3VFVA 5CLWA 5JDJA 3I9IA 4K0OA 1MG2C 3RU8H 5BRZB 4Z0BH 2XFXA 3LPOA 3INUL 4NN5B 1Z5LB 3OB0K 1CXEA 4H26B 5C7XL 3LHPH 1P84K 4CSSA 2PTTA 3U83A 3IFLH 3FCTB 1KCRH 1MPAL 4S2SB 4DN3L 4ZX4A 5F6HI 4OBRA 1L9OA 4NAMA 2DDQH 1U8KA 5DD0H 5EOTA 5F21B 1TKWA 3AACA 1BM7A 2X42A 3FQ4A 1XF4A 1WPCA 1CFQA 3NUKA 7PCYA 1ZVYA 3BZFB 4B97A 4YDNA 2EVHA 3WKQA 1NL0H 1IAIL 3BQUD 1VPOL 3RWFA 4WW2B 4TUOB 3SKOB 1B2YA 3RAJH 2H47C 2WZAA 2XTJB 3LSOA 2VMJA 5I19H 4OCNC 3FT3A 2RTTA 1KN2H 1A4BA 1OAXH 4JHVA 5K39A 4Q0XL 5J6HA 3S88H 5FYLH 1F1AA 3CFBB 4EZJA 5B39A 2ZP0T 4N8UA 1FZJB 4JEGB 3TPUB 3QRBA 2DQGL 1IM9B 1K2DB 2IAAC 1QPXA 3LZFH 3MYZA 3N43B 4Y9EA 4TSBH 1VFUA 2NY4D 5KSAB 3G6JE 3ZQWA 2PYEE 2DIJA 2AZUA 4NO3B 1KZQA 4ZS7H 5H94A 4LP4A 5EWIH 1UGNA 1RCYA 4Z7UB 5ESVA 5IVXF 4B9FA 3FPXA 4BFEA 4YSEA 2VITA 2GSMB 1JWSA 3VWKC 2VXUH 3VI3B 3BKCH 1P7QA 1AOHA 3WD5H 4JFDE 5I24A 1XF2B 1A5FL 1OIOA 4JB9H 2O61A 3VI4F 1F6LL 3EJZD 2KLRA 1QZ1A 3WEBA 2N56A 3WS6C 2DJMA 3MOAH 5AVUB 2X6MA 2BSED 1Z9PA 5GZNA 2ZOTA 4TNGA 4UT7H 2WXKA 1YEGH 1L9PA 3CHRA 3QUMA 4XBGB 4YR6A 4UDUB 4TQEH 4F9LA 2KUTA 3I2CH 5BOJA 4IU2A 1YUKB 3JZYA 4U1NB 1JZFA 3EGSB 4HKZB 5JOFA 2JNZA 4JDTL 4KMTL 3UTSD 5I5IA 3FTZA 5T3XD 3GTNA 1JN6A 1YUHA 3GMPB 2HYMA 1HKLH 2YKKA 4XE5B 4R90L 4C56A 5ICZA 3WY3A 4HIIA 1A3QA 3N5AA 5KYWA 4JO8A 4LDLB 4YHYC 3U0WL 4Z7QB 3LN4B 3MRJA 1SJXA 3HB3B 2GBUA 1W8OA 5F88B 3B43A 4F27A 2CJUH 5TFSH 4OZFB 1EA9C 4X9YA 4PJIA 1AIFB 4A2LA 3WTWA 1OW0C 1UZ6F 2CKBA 4Y2DB 2Y06H 4NQSB 5AW8B 4D8PA 1E8ZA 4OZGA 4JW3A 3U1PA 3BWUF 2FO8A 1R46A 1IRAY 4FQ2H 4NNXA 3EH5B 4I77L 5CLZA 4GOSA 1OP4A 1YEEL 4NZTL 1I9IL 4BFBD 5GGTA 1KJ3L 1CBVL 1PY0A 2OXHA 1S46A 3AM8C 3N1QC 1FFNB 4FERA 2NLJB 2AQNA 3TP4A 3MKGA 3MJ9L 2ZXEB 3I02A 4RGOH 1LO3H 4DWHA 4NKIL 1IGJA 3UJTL 4YDKH 1J9TA 3MLUH 2XRAL 3SE3C 2NY3B 3H6JA 1AGEA 3HE6A 4MJID 4G6KL 1JXKA 5DEFB 3RZCB 3DTDA 3PXHA 5JA8B 3GT6A 4UM8A 5LQBH 4NKMB 5AALA 4ZTOH 2JWYA 4GS7C 4XO5A 4AW7A 2P5PA 4DT2A 4N0CD 4YHIA 1HK6A 3C5ZC 4OZHF 4JK0D 1E9PB 1FO0L 3FULA 4M00A 1AQHA 4DP4X 3IDXH 5AZ2H 1ZGLB 2A77H 1MAMH 2AC0A 3IDYC 2P8PB 3AXHA 2X0UA 4OZIA 2Q7AA 4RIRA 1PZCA 3HS9A 3UROR 1P5UA 2EO1A 4FFYA 1VLXA 1ADQL 1O9ZA 3NGBB 2Y5TB 2VDML 4J3SA 2XWBB 1ZEAL 3DKHA 3D3VB 4WI9A 4FKKA 2HXAA 2NY2C 4UILH 2AXFA 1AGCB 1GZPB 1A7QL 3MXVL 3OKNB 3P2TA 4XXCC 1E8WA 2EIZB 5AVRB 2PR4L 2QSCH 1T4KA 3GXTA 3QZWA 4MA7H 4P23A 3WG7B 3U46B 5ILTL 4CC4C 3P4LA 5L0QB 3PG2A 3L4WA 4GUPB 1RURL 2O6FA 3CFIC 3GHPA 4MQTB 1HYRC 2WXGA 5AUMB 5F9DC 5TQ0L 4PY7A 3MV7B 2C1PA 1JP5A 3WFDL 2WXPA 4YDMA 5DJ8A 3V0AC 1IBGH 2VUKA 5KS9B 3A24A 4MD0B 4ETYA 5FOBA 1H8OA 3C9NA 3EJYD 3FOLB 4OZFH 1QLEB 4XMPL 1J1OL 4W6XB 4K3HA 4NQDA 5FUOL 1IBHA 2D31A 4NENB 3G9AB 3LQZA 1NSNL 1BHGA 4LLDA 3ABLB 1ZPLA 2G5UA 2DMHA 1KCVH 1NDMB 4PJDF 4JM2F 4W9FC 3VO0A 3S4SB 4BV1A 3WS3A 3UC2A 1ZGLM 4Z0XB 4XPHH 5FYLD 4CVUA 2QQNL 3QJHB 4Y5YA 2EDWA 4KVNH 4V1DA 4OIIH 2H26B 4DQOH 4D9LL 2CO7A 1T0NA 1W72H 3T0ED 3HRZB 3UTSE 1NUFA 2DH3A 3UJJH 3DO4A 4FG6D 1UG9A 5T3XE 4UTBH 1BQHB 3R4RA 3IE4A 3MSPA 1JGUL 3R06A 4HPYH 4NERA 2GUYA 1PZ2A 5C0BA 1XX9C 1U4EA 4ELMF 4F5CA 1N5YH 2FHBA 4J3UA 2OCJA 1VENA 4Z3JA 3FS9A 4FJYA 3TZVB 4RAUB 2JLPA 5A16B 2DLTA 5CUSH 2QLYA 1AKJD 1BDYA 4QOKD 3HI5H 5E5MA 4RRPA 5IFAH 3R8QA 4X5PA 4XVUD 4K3DH 4M93C 5CWSB 1F4YL 5TDPA 4Z78B 3MA7A 1AR1D 1X5ZA 2FE0A 5LBSH 1T1WB 3A4EA 1CDBA 3K1KC 2HG5B 3IJEB 3VD2A 4O4YH 3F05A 3CHSA 4OLZH 4YUEH 2WCSA 3H7BB 1QQDA 4Q97A 3I9AA 3MHZA 4FCHA 1BIIB 3JWOL 3RUGE 5C0AD 3B8YA 3LNIA 4QRPB 3ZDZB 2JVUA 1SN2A 4MJIE 4RSVA 4XCEA 1NPUA 4HF5H 5SV4A 5ICYB 1FC1A 3BDYH 1SDAB 4BHUA 2Z0UA 2E6PA 4Y8AA 5F6IC 1SXZA 4D3CL 1KJVB 2N0KA 4UIMB 3ES6B 5C2BH 4FFTA 2BHFA 1JIBA 1W2KT 1A7OL 2F8IA 1QLEH 5DWUL 1QA9A 2X89A 4LLMB 5JMOC 1F8TH 4LLVB 3PWNA 4U1LA 5ITFB 1CFMA 2FNBA 3GXUB 3KJ6H 3EW3B 4ZMLA 4OJYA 4ZNCD 5C07D 3FL7A 3S37H 5I9QC 3GMQB 4GT0A 3RL2B 4MMZB 4I2XA 5FYKU 3KPOB 4PU2A 4TSAL 2QTEA 2HFGH 1GH7A 2QVTA 2X70A 2WXRA 4Y16B 5CILL 1W6LA 1SXAA 4JFVA 5D7HA 3KBFA 3P02A 4M5ZH 4PBWD 1IM9D 3JVGC 4KJYA 1SJEA 4AV4A 5KSAD 4Z7VA 1AQKL 2M83A 3I75B 1BIHA 1HFUA 2ZONA 1DLFL 4OCYH 1FJ1A 4HH9A 3JTSA 4X7TA 4BK5C 1OCWH 1N0XL 4YDVA 5GHWH 4NPJA 3V0DA 5IG7A 3BE1H 4UAHA 4RMRA 5HSFA 1UGKA 4MS6A 4U1SA 1LDPH 4FQQA 4PJHA 4LQFH 4MKMA 2BIQA 3FU3A 4PJ8C 2DQJL 4KTYA 4M48L 4DK3A 3K0WA 8PAZA 2XG4A 3AMKA 2ATPB 4JUSA 2NSMA 1GJUA 1S6NA 2LFGA 4O51A 3EIFA 2COVD 5LXVA 1JS4A 2ZSVA 4XBPA 1HEZB 5G55A 3QNYA 5FYLE 4XCCH 3WXVH 4IRSD 5D8JL 1MHPL 2ZCHH 2CIIB 4LKCA 4X4YB 3BN9D 3BLBA 1YY9C 2O6CA 1KXVC 2ADIA 2G75B 3QCUL 3FHQA 3TWCL 3T0EE 2KLSA 2A1WH 2D03H 1JZIA 4PTUB 3KH4A 1R5WB 2A4EA 1XSOA 4I3SL 5IUCA 4H25B 4WGWB 3VXMA 1T1XA 5IMMB 3QYMA 2AK1L 1PX8A 4NX0A 4F7CA 3MLRH 1QKZL 3RWJA 5FHBH 1NEUA 3LH2H 1XBDA 5FM5O 1LNUA 1OQXA 3QZPA 3WIFB 5J6GB 5KBLA 1ASOA 3LVEA 4OFVA 2VDQL 2TSBA 4NDMB 5FO9A 2DIEA 5DQDH 2NUPB 1HZHH 3GZQA 4J12A 4QOKE 2QR0A 5KVDL 3BAWA 4Y2DD 2Y1YA 1OGAA 2DKMA 3ILEA 3FONA 2YLKA 4K71B 2K9UA 4ZTPH 2HG0A 1RK0A 5EUOA 1A4JA 4N90E 3EO1A 1XTMA 2IGLA 1CL7H 3NBNA 3BAIA 3MNDA 4XNAA 1RUPL 4Z7WA 1INQB 3RBGA 4LP5A 3II2A 1XGPB 2XBDA 2CLRA 5DJ2B 2H1PL 4OM0L 4Z7NE 1TMQA 4Y7OC 3EG9B 1QYGH 2AGJL 2OW6A 4UM9D 4MJJA 4NRXA 4YSOA 5C0AE 2B2XL 5F93C 3UP1A 4P2QA 4GRMA 3LXCA 2NY3D 5DHEA 2CALA 4MWFB 3SZ6A 4AZ8B 4HSCX 4JDZB 1JBJA 4N0YL 2GIMA 3MNZA 3QXVA 4X7SH 5BV7L 3GMNA 1G0YR 3DC0A 1PG7W 5F7DB 2R0LH 1Q0YL 4JQIA 2IOOA 4DAGL 5EU7E 4RZCB 1FUNA 2VTFA 4QRRA 4PLKC 1GPOL 4NUJB 3X3GH 2WINB 3KL5A 4FZ8L 5J9PB 3VU1A 1MCOL 3CFJB 1TETH 2YOCA 3P11H 4M3HA 5C1MB 1MCSA 1QFOA 4HJ0D 2P4AB 1CR9H 3GSXA 4F2FA 1MREH 3CUPA 4IMKC 3IDNA 3D3VD 5I16A 2VDOH 2ITFA 4J6RH 4O58H 3HNVL 2WQRA 3T9WA 2G60H 2VIRA 3ZIMA 2HUEA 1W0VA 3PQYB 3FRUB 1CO1A 5H8DA 4UTAH 3VNZA 2OMWA 4TQIA 3V5HA 2YKLL 3BISA 3ZQ9A 2B4CL 1BVNT 3JUYA 1KPVA 3MNVB 1XGQB 1BVLB 1DBAH 4E9LA 5CEXB 5C09D 1D5XA 3GD1C 4QY8B 1K8IA 1F42A 4NN5C 3WNJA 4NZDA 2LHAA 1ASPA 4XP9H 4LKXB 1J0JA 3K1DA 1CJYA 3FYIB 4E9XA 3MV7D 5DJZA 2Q6WA 1T7ZA 3VI3E 2AXGB 4L8SB 1YEKL 2OP4L 3I50H 1NMCB 2ADFL 1YDPB 2J72A 4HQQH 3C87A 1MCEA 4UI2A 5GZNC 3UJIH 1INDH 1WGOA 1DSYA 5J6SA 5E6SB 2O5ZH 4Y9CA 3O2DA 1G0XA 2AK4D 3IU4H 3M1BB 4BSWB 4MDJA 4I18A 5JIIA 1QEXA 2W59A 1DQMH 3ZDXF 4XP6H 3V4UH 3WO3B 2CRZA 2XVBA 1BV8A 1MI5A 5D96B 4Q89A 3FQNA 1JE6A 4UQ9A 2W9DH 2HMIC 2XTJC 4ZW8A 3F6LA 1BREA 3E8UL 1ORQB 1GC1H 1X5AA 2XWCA 5F89B 1BFOA 3IDGA 2DQFA 5L4IA 2UWEB 3HUJF 2PABA 5IHUH 5L6YL 4PMFA 3CSYA 1XMWA 1DDHB 3NCFB 4JMNA 5I1DB 1RZJH 3MKKA 4JM4L 4A2DA 4X0KB 2ISDA 3OJDA 1AGFA 4D9QD 1QUPA 1S78D 3TESA 4BH7A 2HJLA 3TZVD 1EJ6A 2NNFA 2R0ZH 1HU8A 4IDJL 1EGJL 3OSVA 5AVTB 4AJYV 4CSPA 4MZ3A 2I07B 1RH8A 3ZE2F 1E50A 1N5AB 1YC8A 3ME0B 3UBHA 5D1QC 4BE6A 2C3GA 3FCUB 1UC6A 3R7RA 2NNAB 2DY2A 4NGHH 5F1IA 4JKPL 4N8VB 4ZW7A 3ZJAA 4YLBA 1YQVL 3TV3L 4HOZA 3PV6A 4PI0A 3LCYA 4OR1A 2HFFA 3SEPA 2R83A 5CP3H 4N2NA 3LEXA 1I1FA 5GRVK 4GKNB 3VXQB 3CCHA 1DJGA 1JYXA 3CPUA 1ZT4A 1P5VA 2ETWA 3U4EA 3NZSA 3MRLB 3NABH 4KK8D 5JHAA 3TF7C 1MCNA 2YBGA 2YUVA 1T2XA 4LHUG 4QRQA 5HHOB 1EO8L 4PRPD 1OE2A 4NKOB 4UAOB 2AQRA 4EVNA 1ROWA 4GY4A 4A7GA 4LBAA 4X9HA 2G5BB 3TXAA 1MRDL 1WA2X 4LVHB 3GSVA 2X4UB 4LEXL 4XNXL 4WHYG 5DHXB 3MJ7A 4NCC2 4MHHI 5HI5C 2B15A 3CFEB 3HB3C 3O4OB 4KHTH 4PUBH 4AUYA 4FTVA 4J8RA 1GZQA 2R1YB 5BO0D 2H9GB 4UCFA 3FJTA 5GSRB 1K4CB 2FLRT 2GJ6B 3UPCA 1RUAL 3AG3B 2VKWA 1YYLH 4J27A 3N42F 5SWQB 4LSUH 3D3VE 4R96A 1TJHL 2AQPA 3BZEB 5KSVB 2NW2B 5D5MB 1WH0A 3LRHA 5TF1L 3WUWG 1ETZB 2V33A 1BLNA 1LEIA 4QXWA 4Y16D 3U79A 3W3BA 1JOIA 2AQ2A 2DQEL 2B9AA 5C09E 2KS0A 3FN0H 1OARL 1PX3A 4L3AA 4MB1A 3SZKC 2R8SL 4HPOL 1N59A 5SWSA 3KPQA 4YVNA 4HJIA 4H44C 5ABAA 4BQBA 5KWYC 2NR6D 3L1GA 5K9KB 3UZQA 3MV7E 5IHLB 3MRNB 3F5WB 4WW1A 2ORBL 3CBKB 3RZCC 4L18A 5IFJA 5KS9E 2A5UA 1OPGH 2H2SD 3DUUB 3FSOA 4JQXC 4PHZA 2I25N 4B9JA 5I15H 3D85D 1VA9A 2J8UA 5I8KH 4ZQKA 3QO1B 3MLYL 4W9IC 5D9SA 4YC2B 4POZD 5DRNA 3U36B 2AK4E 2ENSA 3UBXB 2IH1B 1L9NA 3VCLB 4G43B 1XGTB 2R27A 5EPMB 2IGFH 1MFAL 1D5IH 4HD9A 1QUNB 2HTLD 4NWTL 1SJHA 5I5JA 1TZHA 2IH3A 1II4E 4EOWH 4FHKA 5DMJB 2Z8RA 1AHKA 3NFNB 2P44B 4DH2A 4L5FH 1FVCB 3QFJB 5E08L 2AEQH 4MCZA 5MEQB 1ETB1 3LNHA 1D5BB 2AMGA 3NJGA 1I3GH 1EBAA 2R29A 5D7JB 3PNRB 5E8EB 3MO1B 1T0PB 1VADB 4PGDA 3IVKA 3NCXA 4D9QE 1UWGH 1K4DA 3ATDA 1U91B 3MLZL 3TONA 1NBYA 2Z31B 4AQZA 4CC0A 1YEHL 3C12A 3D87B 1BXXA 3VGEA 4HA1A 4PJXA 1KBGH 3UXFA 4M7ZB 3BPLB 5CP7B 1DL7L 4HKJB 3S6CA 4BH8A 2XWTB 2A4ZA 3VGHA 4MA1B 4WEUD 1F2QA 4E9TA 1KBPA 2HLAA 3VFSA 4Z7OF 1ZT1B 2CRYA 4HWBA 5I26A 5J11C 3CFKB 1JXJA 1OTTC 3EOAA 2EZ0C 2G3XA 4GXVL 2KC0A 2N3JA 2AABH 1Q1PA 4FNPA 5AVSB 3QRLA 4XNYH 2BZ7A 5E03A 2GIYA 4PRPE 1D6EA 4LO9A 4LOUD 2PWGA 4PJFF 1R6VA 2ZD0A 4DTGH 2X4RA 4WWKB 2VJXA 3ZE0B 4GUOA 5B38G 1CF8H 5FB8A 4EDXA 1TT6A 3EF4A 2G9HB 2A6IA 3BGFB 5TH2B 3RA7L 3N9GH 3PV7A 5DRXA 3FU8A 4MNQD 3CXDH 5F9WB 4JX0A 3TZVC 2XXCB 3CDZA 3ENEA 4M7JL 2MPAL 3IJSB 4BZ1L 5GS1B 4JFQB 2ZXDA 4LSRL 3ILDA 4OCSL 3K8KA 3A6BH 5ENWB 3VNYA 3AZUA 1RU9L 5D7IB 3ARWA 4R26L 4BQ6A 2HT3D 1T5XA 3RPBA 4ZFFA 4IRZA 3MBEB 1FGNH 3OKKA 5I1CH 4MMYA 1HHHB 5EIVA 1R0AH 1UTDA 1UWFA 3N1PC 4AQ8A 3IBEA 4W93A 2H1XA 1VGEH 4EIUA 1J9CT 2D0FA 2O1AA 4EZMA 2H4EA 2EILB 4L8CB 3O6FD 1KN4H 5C0ND 3E2HB 3B83A 3DPBB 5E56A 1QLFB 5CBEA 4JY6A 3HC2A 3KEDA 4F7KA 3MACH 4FI7A 1LWRA 2FB4H 2VC2L 4YBQD 1EHKB 3PREA 4W6YB 1EZUA 2ALWA 3QQXA 5ABZA 1SZNA 3EOTH 4NB7A 1IGMH 4WJ5B 4PWEA 2ITCB 4LCUB 4A7SA 1A0QL 4B3VA 2H6UA 2OS7A 2JCCB 5C3TA 4ZMZA 2HPOA 1CLYL 2JK5A 4JKLA 1YJDC 1XSIA 3HCVB 5LAXB 1FV1A 5TE6H 1N8ZA 2DM7A 5G4MA 2ZCKL 3BP7A 1JGIA 4BFFA 1JXGA 4M6OH 3WY1A 4EUPA 1G9EA 1ILSA 1JERA 5FO8B 3WJLA 1UB6A 3X3FL 3VRJB 5D6DC 4DGYH 5CR1A 2IALA 1UQSB 4WK4B 5A6MA 4AEHH 3QEQB 2DKSA 4IKLA 5AAMA 4HU8A 1BBJA 4QRSA 2R23A 3LKPA 2WO4A 1Q72H 3CVHL 4AYFA 3WLWC 5T1DL 3G08A 3S2CA 3K4AA 2FJFB 2TSAA 2EIEA 2X5PA 3RFZB 3SQBB 4CGTA 2H2SC 1CD1A 1NGQH 2X4QB 3H56A 5H37G 4JFSA 4OLXL 3S96A 4NKDA 1X4XA 2EC8A 3BKMH 3IRZA 4PFEA 3SO3B 4POZC 3IAPA 2PMZA 4U3SB 4KJQD 3ZL4L 3UO8B 5ESAA 1YAZA 4OW6A 5C8JA 4BFOA 2DQDL 2BP0B 4G6ML 4HVBA 3NIGF 5AOIA 3V0VB 3KPMA 2K1MA 3WLBA 2VXQA 1UD3A 4JZJA 1ZTMA 4DESA 2WLHA 2X3CA 5DK3A 3QPXH 4NIKB 4MNHA 5FWRA 1QSFB 3IMWA 4LLQA 3V10A 2F8VA 1KTDA 2DYPD 3Q8CA 2OMNA 2OULB 2QGBA 2R0KL 4QXTB 2BP8A 4TRPL 5FGSA 2CO1A 3MFFB 3CZNA 4Q52A 1CFSB 5ANME 4P4RA 3UG5A 5C0EA 3EBAA 4XPGH 3MMEA 4KZEL 3PNWA 4MNQE 4GIAA 1NWPA 1AHWB 1A7RL 3IEAA 4XPTL 2AXJA 5JQ6L 1LXMA 3QDMB 5L2KB 4M6NH 5MEOA 2ED6A 2EYSB 2JKLA 1FFQA 2OJ1A 1W0WB 4IU3A 4HYTB 1INEL 4BZ2A 3EYQC 1PVHA 5DU7A 2K9FB 4E42A 4UV7L 5DVNA 4BSVB 1BF2A 4X9BA 3IGFA 3B1UA 5I0DA 5GGSA 1WBXB 4BFIA 2BSTA 1FL5A 1MUJA 3WXWL 1PG7H 4WWNA 5MENA 1LO5A 1PL3A 2ED7A 4E0RA 3OF6A 3P0YH 3G6JA 1P4LB 3QIBA 2CRMA 2PYEA 2YUZA 1FI8C 1OB1A 1SY6H 3T1WA 3VGDA 5I1KL 4HUVA 1WZKA 1NFIB 4PRIA 3IS0X 3IGAA 3ZKNC 4OGYH 5HYQB 3SOTA 2UX6A 1I7RA 1E0OB 4I18C 4JFDA 1XEDA 4KROD 4I0CC 5KVGL 3ML9A 1YY8A 3T08A 5IMOB 4YHKH 4HV8A 1AGBB 2I9TB 5C0DB 4OD2A 5GZOA 3NCWA 2FQDA 3OLIA 4YAQB 3TBVA 2IJ0C 5LN4A 3K72B 1MJ8H 3CX5K 4EIBA 1J05B 2VQUA 3SYQA 5DUBB 1GHFL 1A3RL 2EDEA 3ARVA 1FNGB 1DVFB 4HFWB 1QLRA 3DJZA 2GTWA 2SEBB 3KE0A 3ARTA 3EKCA 3W0WA 1NH6A 4NP4L 1DE4A 4B50A 3ESMA 3UG3A 3EYOB 3TFKC 1HL5A 3MN8A 2ICES 1LEKB 4XVTL 1I53A 3QFJD 3SGDI 1PKOA 4OLEA 3T3ME 5DURB 4X6EB 4PGJA 1B0RA 5D7JD 4K23L 4DKTA 5KYYB 1NAMB 3LH9A 5E1GA 3RDTB 3HTLX 5AW0B 4B27A 2P5EB 4GAJH 1EIBA 5GPRA 1USZA 4Y9GA 3FQWB 3KDMB 2FEDC 2Z31D 3B7RL 4N28A 3TJEH 3V5KB 1KLFB 1U30A 3PABB 3U30C 4JJ5B 3DSFL 2X4OA 3MJ8B 4TKWA 9CGTA 3JWDC 4L8SC 1NC4B 4CVZA 1FNSL 4B60A 1X9RA 1NMCC 1J5OL 2C3HA 5HHXL 2DQHL 2IMNA 5BS0B 3CTTA 3VGGA 2X4TA 4AGMA 4J5VA 2GSGB 1H6EA 5JZ7D 5KEZA 1M1XA 4WDIB 3KG5A 1OTSD 4AITA 1CVRA 3UFIA 3EAKA 4RGNB 3KCWA 4X6FB 2JB5L 1ZXQA 1P9MC 2B5IB 4L5FE 1A9VA 2IDCA 4QAWA 2A9CA 2ZXCA 3UYPB 5K59E 2JJSA 2YD4A 4PYHA 3SGJC 3BHBB 1LGVA 3FTSA 3K6DA 3QNZA 5FPIA 4HOWA 1NDGA 2EH8L 4HGWA 2CUAA 4WFFE 1L6PA 4FXKA 4J3OG 2QSTA 4FS0A 2R9HD 4WWKD 1IIIA 1EEUA 3JSSA 3EZ8A 3U7WH 4HWUA 3DIFB 1I3VA 3HHMA 4YFLF 2CU9A 1PLGH 5KJRL 3M7OA 1JPEA 2E4FA 3MJGX 5B4MD 3B3IB 1Y6KR 4U6XA 5F7KC 3BQUA 3VSTA 1DBJL 2B1AL 4JFPA 1T21A 2F53B 5SX4H 4EXPX 1ET8A 2D7NA 4BQ8A 3WHXB 4P05A 2YOAA 3KD4A 3WEXA 3X13B 2EP6A 2DQCL 3ESUF 4FNUA 1CURA 2EADA 5D5ME 3MBED 2HFEB 4ZOAA 1GYAA 2OMVA 1C8PA 1JMZA 5EZIH 4APQB 3P4NB 1F1GA 4H2AA 3IFNH 4IEFA 5H4YA 3RL1A 3ZT6A 4JG9A 4LAQH 3U4KA 1MVUA 4MGXA 1MIML 1GW6A 5I8OL 1TFPA 1G7PB 4M3JA 5J57B 4ZFOL 4UB0H 5FFGA 5JW4Q 4IBYA 2V4LA 4MS8D 3TEUA 3KW8A 5GGVH 3G6AB 3VD1A 1NMBH 1PTZA 1OALA 1QI5A 1PKQA 3BP5A 4NQEB 1NAMH 4PD4J 3A67L 5D1ZB 1FSKC 3GSNL 3KJ4B 4TNEA 4H13C 4UAOC 4Y5XB 3KYOB 1J5DA 5IT2L 1N6QH 4L1TA 1IEBB 2HVKA 2HJFB 2P80D 4LVHC 4GQ9H 3GXDA 6PCYA 2EC9U 5JYMA 1T20A 3UIZA 1MJ7H 2BSEA 4L2YA 2IBZY 2X4PB 3W9DA 3O2VH 4HIPA 1LE5A 2H8PB 3L7EA 4FCAA 4GO8A 5T5FH 5EC2A 5F7AA 2ITDA 1E2ZA 2XIIA 3QUZA 3UTOA 3LV3A 3VXUB 3ZE1F 4JHWH 1QOKA 2B59A 4JO1H 2F68X 3UTSA 1S7SA 2FT7A 1RVFH 5CHNB 3QFJE 3T4YA 1MNUL 3C09C 4XP4L 5K9QI 1XR8B 4BJLA 4DPAX 5L4FA 2Z7YA 4FQIL 1B9KA 2OI9B 4K3JL 1X5LA 2FD6L 4OKDA 1M7DB 1WE5A 1J9QA 2DJSA 4YEFA 3QEQD 5DVPA 3U9UB 3BRFA 1WUNT 1AYRA 1NLBH 2RGSA 4LBEA 5FA4B 2VWEE 4OJFH 3UPRB 4Y1SA 1G7MB 1JGVH 3O6MH 4M3KB 5FK9B 2BLFA 1KJ2L 2WN2A 3T2QA 2HJKA 2ICWJ 2FX9L 5D1XD 5F8RC 5FO7A 2V2WB 4X80L 3AQXA 4Y2OA 4AZUA 1XL6A 2WY3B 5I74B 3CZJA 3M7FB 3V4VL 1BX2B 1KFAH 1OK8A 4MAUL 3E8VA 2V7NA 3RY6A 4HUCA 2XZZA 4OUOA 3WI9A 1IBZA 4LZKA 3D34A 3HMWL 4NQXB 2XU9A 4RISH 5IJCC 3ZXAC 2WWNA 1KN2L 1QSFD 1G6RL 5I1EH 1N9PA 2FSEB 1OAXL 2Y22A 3PWUB 5J0BA 5GIRB 2PYFB 2KL6A 3ZE0E 5J1SC 1M3JA 1S7RB 3LIZA 1TDQA 1USQA 1WHPA 2JELH 2OZ4L 4RA3A 2VYRE 1Y0LA 3KWVA 3QO0B 3MGOA 5BRQA 1KXQA 2QHRH 3QA3B 2EUVA 2CDGB 2O6EA 2WW8A 1VCBC 4L8BB 1AZBA 3BMWA 2VLRB 2HFTA 1LDSA 4M7LT 1DEDA 2O5XH 3L1FA 3QDMD 5DS2A 5L2KD 5KAQF 4ES9A 1NGYB 2BC4A 2UY6B 2VSDA 4RX4D 2VAAA 1L9TA 4XAWL 4X99A 4ADGA 5LNGA 2F7OA 4IRJB 3NESA 2Q8BL 4ANUA 2QVFB 1U8CA 3VD0A 2ARJB 4P9ML 4HAFA 3CPLB 4XNDA 2QTVA 1UA6H 2PWHA 2NY1D 5IMKB 1JGDA 5TGBA 2EEBA 4F7EB 1H5BB 4M62H 5HI4D 5IK3B 2Y1AA 4F37K 3MBWA 1HHIA 1TSRA 3MOAL 4WV1C 5C0FB 5ID0B 4MD5B 3MI6A 4PJ7B 1U2HA 1FZOB 2OXGB 2TAAA 3EJRA 3PP3H 4P2CG 3ZTJH 7CGTA 3D0AA 1CMOA 2W65B 5C2UB 3QEUB 4UT7L 5F0LB 2GTZB 1YEGL 2NCEA 5CAYB 4OGXL 1XFPA 4PR5B 1IC7L 3FTGB 3DBSA 2GAZA 4JZNA 1YNTB 1A9EB 2CK0H 4ORGA 5G2NA 1IKFH 2NY5H 3BUQA 1AS8A 1L5GB 4LLUA 5DQ9B 3GPEA 3T8XB 4QJ5B 3F7YA 4ZJ9A 1S7QA 1HKLL 2MWCA 4BUGA 3Q0HA 5BMFH 2GI7A 1DBML 2K6YA 5CZVH 5LB1A 2ICEB 2WTRB 1AR2A 2DTSA 5GS1C 3UIYA 4RVBA 2JCCE 25C8H 3LEVH 5TFSL 1WAAA 2BNRA 2NXYB 4X8XA 3TO2B 1KYUA 5IEHB 4Z6AT 2WHVA 4PG2A 1DVFD 2Y9RT 3QUML 2AQTA 4QHUB 2IAMA 2PPFA 3T0EA 4B96A 4R7NA 4X5XA 4L1SA 1OE1A 5HGBA 4AGOA 2APVA 4FQ2L 1AD9B 1MJUL 1OAZL 2UZXA 2Z9TA 3BFWA 3H9SB 2FATL 4YHNA 4AJWA 5DURD 3FPYA 5EMYA 1S9VA 5GRVL 4ADJA 3RDTD 3QEQE 3CJJA 1CZ8L 5GSVA 2X10A 5IB4A 1FC2D 3ARBB 4MAYD 3SE8H 4F3FB 4ZO6A 2WXMA 1HSAB 2EDOA 4G8AC 1N68A 1AKJA 3HPJB 5TQ2H 3G5ZA 1CFVH 2VOTA 4G8EB 4K15A 43C9A 1NC4D 1XB8A 3SOBH 1M2OA 1JV2A 4PJIF 2AJYL 4CBPA 5IHWA 4QRUB 3WTTA 4U6YA 3GMMA 4JZJC 2DEYX 3KLAA 4OZGF 3VMNA 4Z77A 4JZOA 5JO5B 2A77L 4HKBA 3PGDA 2M1KA 5GJSL 1EEZB 4NQQA 3D12B 3KPNB 4WI7A 3BVTA 3D6GA 2GHZA 2J88L 4A66A 1KDIA 1OAUL 4LPXA 4QUOA 5C0AA 4YHPA 1QHPA 5JHDD 5KG9A 3R1GL 3FO0L 3AROA 3MREB 4JS7A 4ALAH 2DM4A 1TITA 1YECH 5KBMA 1QSZA 3V5DB 3F6JA 3MROB 1QSFE 4S2SA 1F1DA 4UILL 3FUFA 4OQTA 1IQDA 5FUCE 5C7ZA 5DK0A 4M5YL 1E9OB 3QORC 3UGUA 5IOPB 4F20A 4PWFA 1SF5A 2LU3A 2P1YA 5CGYC 2YFNA 1OK0A 2PCXA 3BEWA 3CFUA 1I75A 4FQHB 1KTJA 2CUMA 4E5XB 3VYNA 1DQIA 2F7PA 2XN1A 4FXGA 4AL8C 5I18L 2FGZA 2J4WH 5DCCA 4ZUTB 1EDYA 4HS8L 4C4BA 3QDME 5L2KE 3FU5A 4J4PC 4I9WD 4QO1B 4FZEH 4U1KA 2ZOLB 1ZSDA 4TUOA 1U8NA 2DBLH 3GRWH 3L4CA 1UT1A 1WBZB 4Q6YA 4OZIF 1YNLL 4KK6D 3LQMA 2EE0A 1LK3H 2VL5B 4L3FA 5C07A 4K3GA 4WKXA 3NJMA 1TQTA 4A7TA 2MIZA 4D0DB 1BQLH 3QIBC 5B22A 4ICXA 2H32B 4DKEL 1PQZA 1UA7A 1URIA 4RMUA 4KRPB 4QKTA 1GGBL 3SDCB 2KBGA 2X9YA 4DUWA 3FB5B 3L48A 1QPPA 2ZX9A 3BPNC 2WN3A 4YDLB 4QHMB 2UYLB 1T04A 5KSAA 1COBA 4YPGA 1J8KA 4UNTA 1KCVL 3BCDA 5IV2B 4NO3A 3UBXI 1C7SA 4P07A 1UENA 4W9CC 3BUYB 1F6AB 4KQ4H 2WJ7A 1JDCA 1AZNA 3VI3A 4DQOL 4NQED 4WTWA 5ABDE 2Y7MA 3EH2A 4ZUVA 4TTGA 1UM6H 1R5VB 1NCAH 4UQBA 3T4AA 1HHKB 2XKNB 3MR9B 4JFOA 3IDIB 4YSRA 3G5YB 4U1HB 4X6DB 1JZDC 5D4HA 1AHWC 3VFRA 2YLHA 1VZIA 1U3NA 1IM3A 5A7EA 1SVZA 4ZAKD 1H3XA 1QFPA 4IRSA 3LRSA 3VJ6A 2MHAB 3M8OH 4G9DA 2C7UA 3NDYE 5CUSL 4GW4B 3TIEA 1KIUB 3FT2B 3NEEA 3VXUD 3ZTDC 2WAQA 4U1NA 1YN7B 3FT4B 1X5GA 2QQLL 5KSBA 4FFZA 3MLSH 4X7EC 1KCSH 5IJKA 5E6IC 4ZMTA 3ZHNA 1EDQA 2JQZA 3ARED 4TNFA 4OB5H 5LGJA 1JTOA 1JWUB 4LNRA 4N0RA 3ISYA 4OZFA 1MXDA 1IQWL 5HHVL 5F6HJ 5CJ8A 4GAAA 1S8DB 2Q5BA 3LYRA 3NRPA 4FQLH 4GRWB 4OSUL 4Y2DA 4DGWC 1WISA 2GB2A 5EHFA 2EDLA 3QXAB 1UA3A 1DVQA 5E2JA 1TO5A 5EF1A 3F12B 1JZJA 2Y24A 4FP8H 5BS0E 3H3BC 4HUXB 3HG2A 3AXIA 1NJ9A 1TNMA 2FHFA 3NMEA 3P0GB 4Y5VA 1CIUA 3EJPA 1ZIBA 5GGUA 3KYMB 4PRDA 1YN6A 5EN3A 3FZUC 4YLCA 3LQAC 3VA2C 2NLJA 3FT9A 1SYSB 1W72A 1ZANH 4PM1A 4UM9A 2H32H 5JHDE 3QRGH 2PWDA 4FXKC 4UTBA 3DWTA 3FUIA 4LASL 2Q3ZA 4KUCF 1TTUA 3MXWH 4FOMA 3DHMA 5D6CB 5CZXC 2W0PA 4R83A 5ACZA 3GKWL 5DJYA 4QNPF 4R4FL 4GSXA 3GXFA 5AYUH 2N1TE 4PAZA 1DANT 4POUB 2HT2D 1QR1A 2OK0H 4PW9A 2RJMA 3HNSL 1NBZB 2NNCA 3DGGB 1U95B 2H0PA 5LCVA 4AVIA 2DLFL 3DURB 4EDWL 1WWCA 3CH8A 2XICA 1P1ZB 4RFOH 2IDQA 5CCGE 4L3CB 5DTFB 1JNHB 3ARRA 4LEEA 5DFVD 5EZOL 3ULVH 4I9WE 4GAGL 3QIWA 1OCWL 2Y5TA 1JVLA 4X8JB 4M61A 2DN7A 2BNQD 2OPCA 2YSSA 5I28A 1NANH 3D3VA 1IGCL 1CD9B 2F19L 3GINA 4IRJD 4PJ5B 1JV5B 4GEJA 4F57L 1GZHC 3H2PA 1Z66A 1LDPL 1AGCA 5B8CC 2ZP9A 4J39A 1HT6A 4LQFL 5E8PA 2R2BB 4AH2B 4XNZC 5F7WC 1PLCA 4ZS6D 1E5AA 5BPPA 2DRUA 4N87A 3BSZH 4S0SD 3M46A 3OKLB 2NYYC 5C09A 4RGNC 1I8MB 4XE0A 3K0YA 4M1CD 2B5IC 3KWUA 1CD0A 1A65A 1OV8A 2DWDB 2YRZA 4UOZA 3P2DA 3WXVL 4W4NA 1HCFX 4Z7VF 5EO1B 3Q05A 4LU5L 4NQEE 2KHAA 3GBEA 3QJOA 2D03L 3OAYH 1WT5C 3VRIB 2D0HA 5DR5L 3V4PB 1WGVA 5I5RA 3BVUA 5SWZB 2E75C 3B9DA 4GRWH 1JUFA 5I8EA 3SQRA 2AK4A 3MLRL 3D2TA 2CRIA 4PJHF 2BO0A 3BGMB 2DV6A 4PVLA 4ZI8A 1WG3A 2XV6B 3ECWA 2C9XA 3L9RB 4KX8A 2E7CA 4EXKA 3KAAA 1BVNP 3GM0A 2IPUG 5AQ0A 5GRZA 1HZHL 1T83C 1SXNA 1BF8A 1G87A 3VXUE 3O9WD 1NFDB 2H26A 3LKNA 4PBXA 3HRZA 5KVFL 1C16B 3MDJA 1I3UA 2ODIA 4JJHA 5C86A 1YJDL 5IB3B 5HY9A 1FG2B 1SYVB 4APQC 5EIIG 3H9SD 3D2UA 2Z92A 4N2LA 3OKDB 4M8QB 1KG0A 2EYTA 1U21A 1W0YT 1GVIA 3NAAH 1QYGL 4JGMA 1QASA 4RAUA 2QSVA 3ARBD 2AERT 4F8NA 4ZYKB 2D7MA 1WP6A 4OD1H 2Q86A 4G82A 5D1ZC 3KJ4C 1FE8L 4Y5XC 2NSQA 5JA9A 1HH6A 1UACL 2EE2A 2UVFA 4ZMPA 1QFUH 1XH3A 4J3BA 2GBVA 3IFOB 1KELH 5DHDA 1J0ZA 3ZKQD 4G42B 3Q6FA 2R0LL 3GC3A 4XCFL 5JXEC 3KYAA 4EI5B 3UAFA 1J1PH 3AXLB 4E9SA 1SFHA 5EUOF 4P5MB 2CQVA 3OAZK 1N7MH 2EABA 3IJEA 4KKCD 1XCTA 3X3GL 4ELKB 3MRQB 1B4LA 3C8HA 1CU4L 2J6WA 4Z7WF 4ZMXA 3DIDA 3G6DH 2DEXX 1FZKB 1D7DA 3P11L 3FCSA 4U2YA 3F58L 3F85A 1DCEA 5JOEA 3WUZA 1KGCD 3PFQA 2W0FA 1MREL 3B5HA 4PRPA 5HYFA 2IBZX 1TCRA 1O5PA 5DYFA 2VW6A 5B21A 4J6RL 4CAGA 3BP6A 4LRIA 4JO3H 4TUJA 4HJ1A 5D2LA 2G60L 2YGVA 2W80C 4RDQF 2Z8WC 4XVSH 3KCPB 4P5KA 3GLZA 3VFMA 1UB5A 3AS1A 4TL5A 1XR9B 1DBAL 1NINA 1U8PB 2Q3XA 1FF5A 2O93L 2BSDA 4HEPG 5E94B 4PGZA 2OFQA 1SDDB 1HNFA 1XL4A 4MQSB 4GBXB 1DJYA 1EHNA 2BNQE 4X4MA 3STZB 4JAMA 5HYSG 1ZA6B 4NFDA 1A1NB 2ZUQB 1LEGB 3BDXA 4GAYA 2EDJA 3S2AA 4A2GA 2X2JA 3X1BA 1QWHA 5J3HD 2KZKA 3GMQA 1TQWA 3P4MB 4HIHA 5BJTB 1ED3A 1E3ZA 2P52A 3OM3B 4Y16A 5I74C 2AJ3A 4KZCA 2OLDA 5DT1L 3KVPA 3IU4L 1X5JA 3C6LC 3IAQA 4PB9H 1DQML 2UV3A 3FMGH 5HVFB 2BOLA 3ALWA 4PJ7E 4JO4H 4F7PA 1TLMA 5SX4I 3LD8B 5EFIB 3HN5A 5DFWH 3TBWA 1EFXB 2W9DL 1EAPA 1GGCH 2A6KB 3QJXA 4NAJA 4N2HA 4BWWA 5A2AA 3EHBD 1HXMB 1ZLSL 2CGRH 3D85A 2MQGA 2YD6A 4V11A 4Y4FA 4NZFA 4H8QA 2RCSL 3GHEH 5KSUA 5C0CD 3ULVD 3IF1B 4J8QA 1MFDH 4PG2C 1ZVSB 3VXOA 2C9AA 1H6TA 3RJQB 4WHTA 3SGKA 4OU3A 5DRZB 4FC3E 5AOZA 1YLBB 1FGVH 1OSEA 2DW5A 2AQ1A 3B9KA 4XN4A 1HHJA 4DVRL 3QCVH 5BW7A 2BVQA 2N7AA 3QXWA 3BVWA 5I6PA 2QKIA 3RPKA 2WV3A 4XI5D 2MTPA 4WO4B 4N2OA 3CLEH 1T5WA 5GS0C 1BA9A 3RP1A 4H25A 1RAMA 1GOFA 3T04D 1H5BC 1KPRA 1P7KB 5F7NC 3H9SE 1M2VB 5IMMA 5AW6B 3FCBA 4Z3IA 1GL4B 2AMUA 2IXQB 3UAJC 2WMPA 3DV6A 5CLTA 1YMMB 5EF2A 1ND0A 5LDUA 4FKEA 4EN2A 4N0UB 1A14L 5FHAL 3LKSA 5EEUA 4M8UA 3SPJA 2ILLA 5DSCB 3NIDB 1E43A 4UQ3B 3MRFA 4WFED 4L29B 1HQ4B 4KKAC 3EYUL 1TZIA 3JTTA 3LZNA 5AW9B 5L9DH 4GG6B 2QEJA 3UO1H 3FFDB 5IP4A 2J2ZA 1IAKA 2HKFL 3TA3B 1VKXB 4WHYH 5BXFA