2MTAA

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2mtaA00
4TXVB 3QJTB 5E9NA 4KO6A 5A7EA 1BYOA 2NRDA 1UATA 2VM4A 3L45A 1KDIA 2QPEB 1NPNA 2FTAA 2PCYA 1GS6X 1T5KA 3AW5A 1BQRA 3C75A 1NIDA 1AOZA 1JERA 3NJGA 4AZUA 5B1JC 4DP2X 5I28A 3UABA 5B7EA 2XV3A 1OE2A 5B7FA 2CCWA 2GC4C 1NINA 4DP1X 1AZNA 4JKNA 1A4BA 1V10A 2HLEB 2IDQA 2ZXWB 1J9RA 2YQBA 1JXFA 2IDFA 3NT0A 1JOIA 1AIZA 1AZBA 3S3CB 4P5RA 3CG8A 1CYWA 4YSPA 3X1FA 3EHBB 1E5ZA 4W9ZA 2WO3B 1NWOA 2FT7A 4YSRA 1QLEB 4GXFA 5AKRA 2DY2A 2HRGA 5AZUA 3FYIB 1NIEA 4GP8B 3SBRA 1L9RA 3NJMA 1M56B 1SDDA 1NWPA 3IN0A 3ZIYA 2BO0A 4AX3A 4E9XA 3ZBMA 3WNIA 2XXGA 4A2HA 1JZFA 3V9EA 1SFDA 4G70B 3WI9A 1E67A 3BQVA 1AQ8A 4GP5B 8PAZA 3T6XA 3JT2A 3D12B 3NSYA 2EILB 1JZGA 2XYBA 1PLBA 1ASQA 1L9OA 3SBPA 3FYEB 1L9SA 2HX9A 1XB8A 4AKPA 3OQRA 1YLBB 3NJIA 2PP8A 2UXTA 2XLLA 3CZUB 2PPFA 1A65A 2UXVA 1OE1A 4GP4B 2YARA 1EHKB 3T71A 2HZHA 2DV6A 2YAEA 1SJMA 2YAPA 1QHQA 2VW4A 3FQ1A 1OF0A 2PCFA 3UAEA 1CURA 1SNRA 2BZCA 4HZ1A 1HFUA 3ZDWA 2GHZA 3BVDB 1W6WA 1ET8A 2YAOA 4W1TA 2PPDA 1AZCA 2AFNA 3AZUA 3S8FB 2PPEA 2IH8A 2YXWA 3IN2A 1OCRB 2E86A 2DYRB 2H3XC 7PAZA 2VW6A 1TU2A 2HX7A 4A66A 4BWWA 2J56A 2W88A 4YVUA 5D4IA 3GXUB 2J55A 5ANHA 1GYCA 1AG6A 4M3HA 3UADA 4YSAA 1AZRA 3NSCA 3U25A 1KGYE 4YSQA 1B3IA 1KBVA 4DPCX 2FQEA 1WS8A 4YVNA 2N0MA 1KYAA 3EH4B 3T6WA 4HCIA 5I6OA 3FSWA 1JVLA 5I26A 4WTQA 5I5IA 3H4FA 4PAZA 2CAKA 3SBQA 1CC3A 1SHWA 1QNIA 1AACA 2CJ3A 1PF3A 3ASOB 4BWUA 3OMNB 2CALA 1OE3A 4PCYA 2BP8A 2IDSA 4UF7C 5I6LA 3NJLA 1PLAA 1NPJA 7PCYA 3EH5B 3WKQA 1MZZA 1PAZA 3ABGA 3T6ZA 5TK2A 3TBBA 1SDDB 2EINB 2OJ1A 5EHFA 1VLXA 2PPCA 1NDTA 3WNJA 2XWZA 4EF3A 2HXAA 1DZ0A 4FA7B 3NJHA 4DP7X 2VSKB 1ADWA 2JKWA 3X1BA 3NP3A 4A2DA 2IWKA 4BXSV 1JXDA 2UXFA 1PNDA 1XB3A 1ILSA 4A67A 4G71B 2BWDA 5F7BA 2GI0A 4HAKA 2QDVA 4KNSA 2Q9OA 1WA0X 2RACA 1ASOA 2X88A 2TSAA 3QJUB 3PXLA 5B1AB 4A2EA 2CUAA 4BXVA 5B3SB 4A2GA 2EIKB 4KO9A 4YSEA 2DYSB 4NAJA 4KOBA 2FT8A 1X9RA 1PNCA 1WA1X 3ZX1A 4YSUA 4DP8X 3AG2B 2VN3A 2CBPA 4YSCA 2BP8B 3CVCA 3NP4A 3AY2A 1V55B 4HHGA 4DPBX 2HRHA 3PAUA 1W8EA 4KO7A 4CSPA 2VSMB 2DWTA 1SF3A 4YSTA 1PCSA 2HX8A 4G7QB 3V9CA 3N55A 4YL4A 2PP7A 3NJNA 1EZLA 1ET5A 2MRYA 4RH4A 5I6PA 4X4KA 3X2QB 9PCYA 4BDVA 2GB2A 1PZAA 3CVBA 3FSZA 4DP9X 3FU7B 1A4AA 2AZAA 3DIVA 2GSMB 3KW8A 1NIBA 1R1CA 2GC7C 4ZK8A 3FSVA 1NICA 1ASPA 1OCZB 2W8CA 2BP0A 2FJSA 2VMJA 3ABKB 5IY5B 1XB6A 3QQXA 3WIAA 1I53A 3S8GB 2EIMB 1N68A 1RKRA 1CUOA 4E9TA 3NSFA 4UAHA 1N70A 4A2FA 3AG3B 1TEGA 2YAMA 1J9TA 1NZRA 3OD3A 4N8UA 5FC9A 3ABMB 4F2FA 2J57A 4YSSA 3IEAA 1M57B 2AVFA 1ZIAA 3N2JA 4CSZA 2UX6A 3PLYA 1ETJA 3EH3B 3QJVB 2R7EB 2PLTA 2B08A 4YSOA 2FQDA 4G72B 1BYPA 2BW4A 3CDZA 3UAAA 3S3BB 2OCCB 2YXVA 4KOCA 4M4RB 2IDTA 1OV8A 1KCWA 4HCGA 1BQ5A 1KV7A 3PAZA 3OM3B 4JHUA 5B1BB 2OV0A 3IBOA 1CYXA 2BW5A 1TKWA 3AG4B 3H56A 4DP4X 4L0PB 1RZPA 4GY4A 1JZJA 1ZDSA 2TSBA 2IAAC 1KBWA 1IKOP 2BWIA 1JXGA 1AG0A 1ZIBA 1AANA 2GBAA 3IE9A 2LLNA 4Q8BA 1BQKA 1MZYA 2P80A 2IWFA 1PZCA 6PCYA 1AAJA 6PAZA 1IC0A 5PAZA 2FWLB 5B7MA 2AZUA 1XMEB 1ZDQA 1BAWA 1MG2C 1ZV2A 1FFTB 1BXUA 1PY0A 1E30A 2XVBA 2I7OA 3SQRA 2ZONA 4KO5A 4QKTA 2WO2B 1MG3C 1OOWA 3ABLB 1JVOA 1JZEA 1AS7A 3H4HA 1TEFA 1J5CA 1GY1A 2A3TA 2ZOOA 5I5JA 3WG7B 2WSDA 2VM3A 2QPDB 1BXVA 1OCOB 1IUZA 1RCYA 1F56A 1W6LA 2MTAA 2YAHA 4G7RB 3TASA 1AS6A 5B1JA 3G5WA 3HB3B 5PCYA 1J9QA 3WKPA 4E9RA 1WS7A 1L9TA 2JFCA 4DPAX 4P5SA 1HAWA 1JZHA 4E9YA 2B3IA 5F7AA 3QJQB 2VW7A 3GYRA 2XX0A 1SFHA 4AKOA 4BWTA 1PLCA 2PP9A 2H5UA 3FU8A 2H47C 5B1KA 3DTUB 1BXAA 3QPKA 3MX0B 1BEXA 1SHXA 2X87A 3DKHA 5D4JA 1GR7A 4BK5C 3NJFA 2FQGA 4WKXA 3MBWB 1URIA 1L9PA 3EF4A 1A3ZA 3CVDA 4NERA 1A8ZA 2R7EA 3AG1B 1ET7A 4E9WA 2XV0A 1WAEA 4FAAB 4ENZA 3PAVA 3UGEA 1FWXA 2XU9A 1IBYA 4DP5X 3FT0A 1GSKA 2I85A 2IH9A 4AKQA 1NTDA 4G7SB 2JXMA 2DWSA 4AI7A 1DYZA 1SF5A 4E9VA 1ZPUA 1M9WA 1NIAA 3FQ2A 4K9JA 1GS7A 2ZWNA 5I6NA 3X1NA 1RZQA 2Y69B 3FPXA 2QT6A 3QJSB 4MFHA 3GDCA 1IBZA 1HAUA 1PZBA 3S3DB 2I7SA 3FPYA 3X1EA 1AZUA 4Q89A 3TA4D 1KDJA 3FSAA 3TU6A 3ASNB 5AFAA 3KW7A 2J5WA 2UXGA 4F7KA 4BDVB 1J9SA 3RYMA 1NIFA 2XUWA 3X1GA 5LDUA 3UACA 2PPAA 2BZ7A 4HHWA 1ID2A 2XV2A 2Y1AA 5TK4A 1E65A 2IWEA 1V54B 1A4CA 1FA4A 4HCFA 4UANA 2XXFA 2YAQA 1X9UA 2BHFA 1L9QA 3CDZB 3QJRB 4F2EA 3PCYA 3FU7A 4E9QA 1PMYA 3OMAB 3OMIB 3NJKA 4NB7A 4GYBA 3HEIB 1AR1B 3TBCA 1WA2X 1MDAA 2QDWA 3NJJA 4KNUA 4E9SA 2BP0B 2XX1A 1AS8A 2P80D 2FQFA 1JZIA 1OCCB 1ILUA 3PPSA 2UX7A 3T9WA 5I6KA 3NYKA 3FQYA 4JHVA 5I6MA 4DP6X 2Q5BA 2GIMA 3FU9A 2IDUA 4KNTA 4YSDA 5D4HA 2AANA 4DP0X 1J5DA 1KCBA 3JTBA 4A68A 1E5YA 4QLWA 5I5MA 3ERXA 2YAFA 4HALA 1GW0A 2FNWA 1GS8A 2EIJB 3T6VA 2FT6A 4HIPA 3NSDA 4N4YB 3FS9A 1GY2A
chains in the Genus database with same CATH superfamily
3RWCB 1F6FB 3B9KA 5E9NA 3UBGA 3H85A 2OTWB 4DEWA 1DBAL 3RAJL 5HYEA 5DJ8B 3DX3A 1F6LL 1VFAB 4I5BA 4U6TA 3ZHNA 1EZSA 4UQAA 2EYTA 1GS6X 3IAPA 3PJSB 4K5LA 4Y8AA 3QSKB 2K3HA 4PJHB 5HDWA 5B1JC 3PYCA 4JFFA 4ZX5A 2ENSA 1UQSA 2PR9A 4F9LC 3SEPA 1J18A 3FONB 4NRZB 3NEXA 5IIEA 1AZNA 4OZGF 1N2RB 1USQA 2YPVH 2BMKA 3N41B 4FQJH 1JXFA 3GSUA 1C12A 4WU5B 2ZSVB 1WHPA 4FKHA 3IMWA 1UZ8A 2ETWA 2OMZB 3GBLA 4WFEE 4AK2A 1NAKL 2XA8L 1FNGA 3QUXA 2F54A 5FR3A 3QIWC 1ZLSH 2HRGA 4Y8DC 1U4FA 9CGTA 2F7IA 4F9LA 3CFQA 4HLJA 4GAJH 4KRPC 2J2ZB 2RB8A 1IC1A 4NWUL 4HWZA 4NM8H 3PJSA 5ACLA 4FFVC 3PQYA 4PRHE 1T89A 3SOBH 4KMTH 3MVSA 4V11A 3MBXH 3WI9A 4YXKH 3EYFA 3ULSB 1PY9A 4JHWH 3TYGL 2WP3T 3VXSE 4A37A 5J5EA 5EC1A 1YEDA 5F7UA 4MZ3A 4Q6YA 4WUUB 4GH7B 4FXKC 2EILB 4AC4A 2GSIA 1M6UA 3L4WA 1JZGA 1M7IA 3QIBB 5LB1A 4UMGA 4HG4J 4FFWC 1N8ZB 4JO2H 4XXWA 4GRLC 3SSGA 3UZVB 5I73B 3GLZA 1KCVH 4O5LL 5D70L 5KBKA 2EE9A 2YPLD 4HWBA 1ZKAA 2PP8A 4J3OD 4UV4L 2PYEE 1KGWA 2R9HC 1K85A 5J6SA 4LCWD 4M6OL 1OE1A 1JMZA 1XGQA 1TVBA 5HJ3B 3AXLA 2X1OA 1U41A 3OKEA 3KPQB 3QC6X 2XWBA 1UB6B 4GG6E 2CIIB 3SE9L 3QUZA 5DLMH 5GGVL 1CG9B 1HYRC 5MI0C 4QJ3B 2OXHB 15C8L 1OK0A 4QRSB 4JL1A 4ANXA 2NX5B 1YPZA 1AZCA 1DSFL 1THCA 3BAWA 4OCLC 1WITA 2EIEA 4WEEA 5EIQA 1TQUA 3FB8B 1HHIA 2YXWA 3GJFA 2H3XC 2JF1A 3FF8A 4G8FA 1TU2A 2VR9A 4PJ5B 4OBSA 2CDEB 1IQDB 5ELIA 4NUGH 4Z7WB 4WJKB 4OKDA 5MP6L 2R9HD 5AENA 1ZHLB 4IJ3B 4PMFA 5INDB 4K55A 4GRLD 3X11A 4XNYH 1IGIL 1XR9A 4OUUB 3UP6A 3PS6A 1U42A 5K9KB 1KULA 4NQUA 4Y9FA 5G4NA 5D2LB 1A6ZB 5CBEA 1U0QA 1BX2B 4XCNB 4YUEH 2JJTA 2GJ6A 4LLMB 2R29A 2O6FA 2N0MA 3VYNA 5J11C 2P5WE 3IJSB 5JW4N 1XH3A 3RVVD 4U3SA 4P46A 2IGFH 1MW2A 4NBXB 4J3BA 4O4YL 3VQ1C 4G8IB 3FFCD 3C5ZC 3G04A 2X6VA 1D5ZB 4P5TD 2QSVA 1FNSL 3KZ8A 4GQZA 1I7TA 3OPZH 2VSCA 3KBEA 4NO0A 4YDJB 1RURL 5EHFA 4R7LA 1T6WA 1SQMA 1GOFA 2F5AH 3VACA 2WKOF 4IK7A 4QHPA 1G9MC 4BSVA 4HJEA 4I9WD 2WN2A 4M1CC 5E6SB 1KCLA 2XTJB 3BAEH 1RZFL 2R56H 4OM0H 3U9PL 2IWKA 4NGHL 5FHBL 4H25B 3RFRA 1AO7D 1EMTH 1QQDB 3WJJC 3F58L 3T6QC 1B4JL 3O6FB 1J0JA 2NYYD 4IRZA 3NH7H 2LAGB 3UDWC 4WDIA 1KC5L 1F45A 1OTUD 5GHWL 4HBCH 1DVYA 1GJWA 2QQKL 4GKOA 2H0EA 2VDQB 5I9QB 3U0PA 3K3QA 2XWJB 3GWJA 1T7VA 3ZL1A 5FYJL 3VXQA 4N9OB 5IOPB 2EIZB 2GJ6D 2DYSB 3EJYD 3OJVC 4WZ9A 4M7LT 5CSBA 5IHUH 3QO1A 4ZMQA 1WA1X 3GSWB 1DJYA 2HN7B 4HWNA 1EEYA 2IFFL 4KPHL 4TL5A 1MHPH 1UT9A 2KDGA 4FA8A 1MHHA 1MPAL 4WW2A 3D51A 4H25A 2WMPB 4FQXC 2J6WA 5AEAA 5IREA 1U8OB 3D0VA 4X4ME 2DIBA 3X13B 2APSA 1ITBB 3O3EA 3PWUB 3RWFA 5CILH 1G0XA 2GAZA 3U0WH 2OMNA 4MXQD 1E4WL 4JFDA 3L7EA 4XB3A 3MLVH 1NCGA 4N2IA 4ZZFA 2A9AA 4O2EA 2HVBA 2OYMA 4XP4L 5HYSA 4FQLH 4IHOA 1NMCB 5E1AB 5I1HH 2IOIA 2BY2A 4Y4KA 1ASPA 4H88H 5IBUG 1QSFA 4OB5H 4LKCB 2WYIA 3CH1B 3MCYA 4K5OA 5B4MC 4JLRA 5DU7A 1T5WB 4HX1A 4MLSA 1XGPA 2YAMA 4HCRH 1KXHA 4XOAA 4B9ZA 3LZRA 5FC9A 4PJHF 2BS71 2AVFA 1QBLH 3FB7A 4N2KA 4KHTL 3U7WL 2LQRA 5K9KA 5L88H 3GDBA 3ESUF 1EWHA 3ULUC 1CXHA 1DL7H 1ETJA 3EH3B 4KKNA 4OF5A 5E2TL 5I2IA 4XWOC 2OMYB 5GGVY 4DGIH 3ARFB 3HHSA 4Y4FC 4G72B 4O2FB 2BIIA 4MNQB 3SCMD 3T5WA 1WG3A 2IVFC 3L3HB 2NDFA 3MUUA 4E5XB 1P6FA 4AM0B 1JSYA 1J8SA 4AQ1A 1NEZB 3DV4B 5J13B 3TL5A 2J72A 2MPAL 3GXTA 2JTDA 3CFCH 3QEHA 2C1OB 2H0PA 3QQ9C 3IF1A 4NENB 2R1XA 4S10A 4PLJD 3VI3E 4XCYB 4X4YA 4HP5A 3RIAF 2GY7B 4LK4A 1H3PH 1HHHB 1RUKL 3OGCB 1IFRA 1MWOA 1TZ8A 4L3EB 4Y4FA 4JFDD 1QFWI 3AVEA 4PJGF 1RK1A 1JGLL 1AANA 2EDHA 4Y1AE 3NFPB 1BZ9A 1T66D 5JPMA 2XWBB 1ND0B 5AW9B 3T0ED 3VXSA 4O2CA 4F7EB 3V4VA 1CGVA 3MRRB 2A2QT 1A6TA 5LAXA 1AAJA 3FUHA 1Y0LB 3FUDA 2FJHA 4Y5VB 4ZAKB 1HK6A 2ZAIA 1BDYA 4NUMA 1Q90A 2A6JA 3RZCB 3TXAA 4JMNA 4ALAC 1BD2E 1ZS8B 4APQD 1OO2A 2VERN 4UV7L 4KK8D 1PD0A 1ZSDA 5K9JH 1IBBA 5K9OA 5JUEL 3O2DH 1J8HE 4DVBB 4Y4HD 3T1FA 1G7PB 1OAZL 2E6PA 1FGNL 4UNIA 4A7GA 1P4LB 2CR6A 1N59B 1ZHBB 3DTDA 4XN5A 4IGBA 3FQRA 3K0YA 3GEFA 3IWUA 3VFUA 4ZXBD 4RMRA 3WKPA 1OSZA 3FUNA 2Y7QA 3EBHA 4YHNA 2NLJA 4KK6D 4W93A 5F7AA 4N2HA 3KAAA 3NOIA 2ZAGA 4L8SC 2YN5A 1G9NL 3QUXB 3MV7A 2BCMA 4KKCD 5ESAB 4EDWH 1P4LA 1NANI 5D1XB 3S5LA 4PRIB 4XCEB 3FQWB 5DMKA 4Q6IC 3NFSH 2J1ZA 5C0GA 5CBAB 1I8LC 4XNDA 3GBMH 4K7PL 2DQJH 2J8UB 5FM4A 1J10A 3WGVB 3WLWD 4WO4A 4GXUN 5F96H 1KTDB 5H2BB 1C8PA 1ZS8A 4Y2DD 3ESNA 5ACMA 2VB5A 1BQHB 2Z8RA 4S1RL 2C3VA 2Y36H 1RP9A 2P5WA 3BT2L 4G7SB 3MTRA 4Y7MA 4HUNB 4H5SB 5AVVB 1UHVA 1I8LA 1D5XB 5F3BB 4IU2A 3V4VB 2VMDA 2VLJB 2J21A 4XMKH 1JV5A 5I1LA 2O5YL 2V9TA 4QHUB 4NZRH 1KZYA 3I6KB 3TOPA 3SYOA 1YEHL 2PYEA 2EDYA 4AGMA 3FU5A 3DVFA 4S1SL 3WJMB 1E27B 5HHXH 4CSTA 5TF1L 1CI5A 2UXGA 3KBHE 3GHPA 4K2UL 2BFGA 1WT5C 1ACXA 5FOJA 4J28A 4ICWA 4WV1A 1NFDE 3IFLL 4PBWD 3GHBL 4P2RE 5DQDL 1SHSA 1FBIL 2GABA 3BQUC 4K94C 4LHUB 5FECB 3HB3C 4JO1L 4LRNL 1S78C 3QZOA 4ZUVB 5DD0H 1FA4A 1ETZA 2P4AB 4QMEA 2X70A 3ZE1B 1U8QB 1TJIL 3B7YA 4F2EA 1RUQL 5IBLD 3MRQB 2H32A 4BUGA 1GW6A 1FVEA 3W9EB 4XCCL 4F7PB 1CE1H 3NDZE 3S5LG 2BVPA 1Y6MR 5HBBA 2AGJL 3MRIA 4GUOA 5DRZA 2ED7A 3VA6A 1FGVL 2XQ0A 4P4KC 5E2UH 2PETA 1KGIA 4FADA 2FR4A 3PIQB 4TUOA 3JV4B 2WWKT 2E59A 4NQDD 3QDMD 2MQCA 3IDMA 1GZHA 4NIKB 2VE6B 2YD0A 4R7DA 3TFKD 3US0A 3W38A 2EDDA 1QSFB 3N44F 3NCJH 1FFNA 1GMEA 4J39A 1FZMA 1SDYA 1DCEA 5C0JA 4JDTH 2XQYG 3RUGE 3MLRL 4J3UA 3MGTB 5AW7B 5HI3C 4EI5C 7FABH 1HSAB 4GKSB 4NO5B 2ARJA 3DHJA 1UZ6E 4FJYA 3QNYA 2PWFA 2DMBA 2H7WA 3JXAA 4LAQH 2XG4A 2OYPA 5AVWB 3BAJA 2XWRA 2XTLA 4ISVA 5E7FA 3DECA 4HIEB 4ABQA 4XN7A 4ZYKA 5F1NB 4D0CB 3CZSA 1JHLL 3VI3A 1MHHB 1GC1H 4EI5A 1ZLEA 4N2GA 4HETA 1BF8A 4AIOA 3G5ZA 5DJ2B 3JWOH 1I75A 4IIQC 4Y2DA 5AKVA 5FCUL 1SBSH 3RZWA 3OKNA 4ZSOA 1PJWA 1ZLDA 4YBHA 5GGQL 3GSRA 2J3SA 4YHLH 1S7XB 3NESA 1BD2D 2CCWA 1SMDA 4G6FB 2VJXA 3PWVB 3ARDD 2E7CA 1F3RB 1DUZB 1J9RA 1VPOH 4O2FA 3MJ9L 4NM4L 3O6FA 4X7FC 2FO4A 4JFEE 2NR6D 4KKCC 1CYWA 3RY4A 5JXAH 1FI8C 3LS5H 4I18B 1M4KA 2FJUB 5AKRA 5D7IF 2Z65C 3FT4A 4LCWE 4P4RA 5E4OA 3V0GA 2AK4D 4F2MB 3B3IB 5BRZE 4EKXA 5KVDL 3NA4A 5EF0A 1RLWA 3O6FC 4AX3A 1T20A 4LLAA 4XO9A 3RU8H 4YOKA 1YNLL 3C5XA 1ZLUH 3BKJH 4UB0H 4Y88A 2OMBA 1CLYL 5DD5L 1AYOA 3TM6A 2Z31C 2A77L 4AH2A 2QADD 3ARDB 2DPKA 5IF0A 2R29H 1P6WA 2GAZB 3BRGC 1RLBA 3NJIA 4IS6A 4FFVD 1OM3L 4UZGA 2AEQL 3KPLB 3C5ZB 4ELMF 3VFTB 5LWYL 5C0BA 1FNEB 2W91A 2K7QA 4GMSL 3ZKMD 4G5ZH 3MBWA 4BQ6A 5DC2A 1S6NA 4JHZA 2WZPD 4MMZB 5E6IB 3BDYL 1OT4A 2VW4A 1NPUA 2F0CA 4ZPTB 1ET8A 1BQLH 1RZKH 4JPSA 2NX5D 4LRIC 2PPDA 3CN3A 3QR0A 4BZ1L 3U0PB 2XN9D 4O58H 3AADB 2I60H 3LKQB 2CRIA 3CX5J 4CJ0A 5ALCH 5G2NA 4Y9EA 4Z3GA 5CZRA 4JM4L 3NAAL 2E86A 1DHKA 4QWWD 2GFBA 3MAWA 4TQEH 1KELH 5FGSA 3EH1A 2J56A 4P5TC 4HJTA 1UWXK 3F05A 1A3QA 5D4IA 3VRIB 3WE1A 4PJ9D 5D1QD 4ELME 1AZRA 1QBAA 3MOBH 5FYJU 1TVBB 3EFFB 3T4YB 4IRSB 5E08H 4YO0B 1SN2A 3ZLQC 4JFOA 5DMGD 4FQXA 3BYTA 3MLXL 1UFUA 2PN5A 1LO0H 2VXUH 2EDWA 3C9NA 5FYJH 3G6AB 5A3IC 2ODHA 2XQBL 3D50A 1JGVL 1B6UA 1KYAA 5EUOA 3NTCH 1T6VN 2VCOA 5DD6B 2DYPA 4XNZB 5IW6B 5GHWH 3ORJA 1S7QB 3ZK0A 1GH7A 3KR3H 2AJUH 4ZFZB 1PF3A 5BPPA 3KPMA 4FNSA 4IW4C 3TN0A 1YNKL 5SWZB 1YY8A 3KVPA 2Y25A 3ULVD 1QFUL 4HIEA 4W9FC 1IM9D 1GGBH 3VD1A 5DO8A 2IH3A 4XO4A 1YZZA 2LHAA 1TTCA 4IMLA 2M26A 4LSUH 1FZKB 1EZVY 5C0CD 3D69B 3HE6C 1PKOA 4FRWA 1KPVA 2EKJA 2MCPH 3IMTA 4IRJB 3FU3A 5DI8B 2APTA 1P7QA 4P4KB 1PU0A 3CSFA 3QZNA 4ZTPH 3A0OA 4TUKL 3VDCA 2AEIT 4GUCA 4QT5A 3CSYA 4WSKA 2W65B 4JFVA 4A2DA 1WBXA 4OCRL 2C9AA 5D7LB 3QNZA 5ERWA 1AHMA 4W6WB 1RHHA 1I8KA 4NQEA 2OR9L 2NSQA 3QUMB 1GOGA 1KN2L 3EYUL 4IMKA 4NRZA 2IBZX 2X4SA 1E3ZA 1EHLH 4A1RA 1SPDA 5HI3D 3GMOA 1HZHL 4LCIH 3CFJB 4HKBB 2CUAA 1WAAA 1CL7I 3BAIA 4JFYB 2C3GA 4A2GA 1PZSA 3TO4D 3GJFK 4ODHH 1I8IA 2RD0A 2K78A 4NAJA 2BFVH 5AW4B 5JORA 1ZVSA 3CAFA 3BKYL 3NGBC 1VKXA 3Q2LA 3UC2A 1UB6A 4TVPD 2X3AA 2DJUA 1F2XK 4A63A 3IVKA 4M8QB 3GUFA 1ETZB 4Y19B 3KPTA 3PWLB 4TUJA 5A6LA 5CFHA 1NC4D 3C09C 1A7OH 1R3JA 5DC9B 3RI5F 3RUGA 32C2A 2MSPA 3IGUA 1VF5C 2XTJC 1ITCA 1MLBA 1NOFA 2IALB 2WNKA 1A6AA 3N55A 5IVXA 3I9GH 4M7ZB 3BOVA 5I6PA 3TH4T 1BJ8A 4N2FA 4X7EC 1X7QB 3LKOA 4UZSA 4M56A 1UWYA 2Y5TA 3B9VA 4AYGA 4PLKC 1F5WA 3D3VB 4NFBA 3T0EB 2Z34A 4QEGA 4J1UB 3S48A 3OG4B 4N2MA 1PCXA 4QHUA 3VM7A 2D3LA 3MX0A 3ZSSA 1DBKL 1EXUB 1G43A 2IPTL 3ABKB 3QXVA 4AQZA 4C59B 3FO9B 3CQQA 1X5ZA 4YHKH 1CICA 2X4TA 3QJFA 5EU5A 4LDCA 5E56A 2P5WB 1J48A 5BZWA 2R0WL 5IHWA 3W37A 3ECBB 5D1ZD 4IGBC 4UV4H 3OJDA 3LPFA 1YMHB 4LSRL 1KCVL 4J12A 4P3WA 4YSSA 5K39A 1M57B 5C09B 3GMOB 1RIHL 3VMPA 1UD6A 2C9XA 4WFFD 4R90H 4YWGH 5FYLL 1CFNA 1JWSB 3TT3H 1IFHH 2VQUA 1T21A 4DK5A 1WWAX 2AI0H 2V8MA 4NQEB 5CGMA 1U3HC 3V7MA 4EVNB 1N9PA 3TCXA 3RIFF 2VRKA 4MJJA 5DJDB 3FTXA 4CUCA 3EFOA 1T2QL 1E5UI 3CNKA 4H1LA 2DQDH 3QRBA 4LL4A 3LKNB 4EAEA 2WOBA 1A21A 4P2CG 1RMFL 4EBQL 3D69A 4ADGA 5DVOA 3ECBA 4KJWD 4JJ5B 3S96A 4QKXB 2Y7QB 1MFBL 2VDPL 4KJQD 3QR1A 1CICB 5J12C 5C0AD 1Q72L 3ESVF 4K07A 1Z2KA 1YA5A 1CFQA 2EDJA 2VDKH 5DUBB 1N19A 1VGEH 4UZUA 3BEWA 3S5YA 3H9SA 3K6FA 2CIKA 2Z64C 4PJ9C 3VD5A 5T5FL 4LF3A 3FUJA 3PPEA 3VX0A 5F89B 2EDNA 4TPRL 6PCYA 5IK3B 3GSXB 5K93A 43CAA 3BWAB 5BZXA 1E7UA 1SYSB 3D87B 4NSKA 4LCCC 1BZEA 1AGEA 1XMEB 5FB8A 2GJJA 1MG2C 1WAAE 2JJUA 2EC9T 1A9EB 4MKMA 4FNQA 1HXYA 5AVSB 3LVTA 4ZW7A 4GS7B 4M29A 3WAJA 2WPGA 4JHAH 4F7TB 1W9XA 1OOWA 5JOPD 4WI2A 4PRPA 5KAQG 4OJFL 2BOBB 1FFPB 1U92A 2K4WA 2X4OA 3H4HA 3FQUA 1G5GA 1TEFA 2CSPA 1I9EA 1NC4A 2BXYA 3QZBA 2ESVA 1OCWL 4MNGA 5DD1H 4OVVA 5ESQA 2R29L 4Z5RA 2X2UA 3K4AA 2FBRA 3OAYH 5FYKE 2OPCA 4Z0BL 1DSWA 1L9TA 2HKFL 3OXRA 1U8KB 4QRQA 4ZOEA 3SKMA 4OLYH 3C6LA 3UX9B 4UU9B 2KUTA 3SE8H 2X4SB 3WFZA 5MEPA 1SFHA 4G7VL 3UGUA 1EDYA 4RFOL 4DGUA 1OLLA 2IADB 3UO8B 5D4JA 2NNFA 2ADYA 1GR7A 1B4RA 4JKPH 4RRPM 3STZB 3MBWB 2X4NA 3NZHL 1TETH 4OAWB 1B88A 2YPLB 3IDNA 5C0BB 2O6PA 3L95B 3P4MB 3VWKA 2DKSA 3D1MC 2P8MB 1YN7A 4QYOB 1UKSA 4IKLA 3H42L 3U2SA 1FZKA 2B3RA 4B9JA 1M53A 4NM4H 4I48B 2H2SD 3D85A 4TNWK 4WNSA 2GCYB 1MIEL 2YJLA 2P8PA 1NIAA 4ELDA 1A4JA 1JF1B 1WZKA 2C7FA 4LQFL 1R0AH 4PRPD 3ZHKA 4AIEA 1JPGB 1TNMA 4QHLB 4LHQB 2VDNH 2AF2A 1IBZA 3O3DA 3S3DB 1BZ8A 3OL2A 3WJJA 4DF9A 1Q9LB 2VO5A 5GRWA 3PL6A 2AQRA 1K2DA 4JCMA 4QO1A 2NXYD 3HI5H 4JPVH 3LEVH 4HUUA 3UFIA 2CBOA 2CK0L 3VFRA 1UWEL 5JXED 4PEEA 4MNHB 3O2VL 3G7TA 1DQDL 3QHTC 4WNJA 5C0AA 2ZKMX 3V52H 4HHWA 1ID2A 3HI5L 1I9JH 1VENA 1HE7A 1YYLL 2H41A 3PU7A 3EJPA 3MRHB 2YQ2A 5TE7L 3UTSE 4Y5XA 3SYCA 1J5OH 3Q05A 5KSAD 1SJHA 3B56A 3QJRB 5CGBA 3BQUB 3EYOB 4M93C 2YKKA 2V2WB 2XTJE 4PJAA 5KBLA 2DLEA 5D6DC 4MSWB 5E4EB 1BG9A 1KBPA 1PQZB 1PJ9A 4NN7C 4OZHB 4M5YH 1MNUH 1SXCA 3AS2A 1S9KC 4LGRB 3KJ6H 4K71C 4RQQA 1A3RL 3PABB 1N3NA 3KHOA 2G3NA 1OAQH 1AO7E 3H42H 5HY9B 2QFPA 3SQOL 1WA2X 2X9WA 4MMZA 3VGAB 2HJFB 2QFRA 4WFHE 4IKKA 3TGXA 1FVCB 3BW9A 2XIBA 2JK5A 2DEYX 2VXQH 4XNXH 2Y7LA 5D7KE 1IAKB 3VFPA 3BWUF 2F9BT 2BCKB 1NLBL 1ZTXH 2RIKA 2WLMA 2Q5BA 4MCMA 2RTTA 1JJUA 4NXKA 4G7VH 4I48A 2QMJA 5C2BH 2NY3C 3VGGA 5ESVA 4UTAH 4KKRA 5D1XE 2GJ6E 4NO0B 1MFCL 2YGNA 3F7YB 4LOFA 1HSAA 4GKSA 3NCBB 1VJSA 4LGSB 4ZTOH 4HOWA 5LNDA 5MENA 2QGCA 3APNA 2G9KA 3CV5A 1BYOA 3HRZA 4TNEA 1F4AA 7TAAA 4FXGB 1I8MB 2FTAA 3IDXH 1ODAA 2VDLH 3IRPX 3VWKD 2ZX9A 2EKSA 4FDWA 5FO9B 5IUSA 2ZP9A 4Z8FL 5HTSA 1X4XA 3QFJA 4AZUA 3MV9A 5CGYD 1KCSH 3UZEA 3K0WA 4DP2X 2O5YH 3UABA 1SVBA 3WMSA 3GHEH 4RESB 2YMXL 2KERA 1SY6H 1F86A 2CJUH 3ZVVA 1U3JA 2XY2A 1G1OA 4A2LA 4APQC 3PUCA 4NCC1 5FXCH 2H45A 1AIZA 1AZBA 2ZUQB 4LVOB 1AVAA 2VXSL 5I8OL 1JXKA 1G9NC 2WO3B 4GQPH 1BCIA 3S6CA 1LLAA 4HH9A 4JRXA 4U3HA 1EQWA 2VDPH 3QB7C 1RZIA 3RZCC 1IO4C 3SBRA 4Y5VC 4ZAKC 2Z35B 3NRFA 3DROA 4QI3A 4F24A 1ZLWH 3L3GA 4G59C 5CMAA 5EU6D 5I73C 3EDDA 1OTSD 2W07B 3CN0A 4OLWH 2W60A 1TENA 3ZYZA 3WXWL 3LHAA 4G70B 2JKRM 3SODB 5AOKA 1JV5B 2YRZA 1AP2A 4PH8A 1AHKA 4Q4IA 3FCUB 3IDGA 2MIZA 1NMAH 2X44D 3ARBD 1BQHG 2DQEH 3FQ4A 2K4AA 1CIUA 1Q0YH 3PUUA 4EUPB 3CC5B 3O45B 1TVHB 2I32A 3H3PL 1TZOA 4KRPB 3VB8A 4WO4B 4DSYA 3ZXAC 3TBSB 4PRHD 1DJIA 1R75A 2WW8A 5JIHA 2VDOH 2F5BH 5CLXA 5HGBA 1XH2A 2FB4H 2DV6A 5DS8B 2KZKA 4XODA 5DHMC 5LG1A 5BCAA 2VZOA 1KPUB 4NKIH 1QBBA 1OY3B 2AJVL 4FZEH 3BVDB 3NJXA 5C9JB 2BRQA 1NCUA 3FTSA 4FQQA 1EAPB 1IIIA 1YJDL 3VH8A 2Q1EA 5E2VL 1G7LA 1BZ7A 1XR8B 2EXWD 2NZ9D 2VW6A 3W0WD 3ZT7A 1EVTC 4BFJA 3TPKA 2OMZA 1U8QA 5AD0B 5JPNA 1KFAL 4H2AA 3MGAA 1O9ZA 4JM2B 1CZ8L 4P57A 4HZAA 4F57L 2K7PA 1KGYE 2V5SA 1ZGLM 5A6IA 1D9KA 4E36A 2ZKHL 5L6YH 3P9LA 2EH8H 3IKCB 3WIFA 2CR3A 2P49B 1WRFA 4NC1C 3DLQR 2BK8A 1E5AA 2C5DC 4OGYL 3QH3B 4XT1C 1KF9B 3EH4B 4M7KL 3VVVA 4AENA 5KSBB 1I1AA 5F9JB 1EHLL 2CKNA 3H4FA 1A6TB 5LAXB 5CJOH 3SDCC 5EB9A 1QO3B 5FUZL 2OR9H 2FGWL 3KYKL 4UINH 3OLEA 1OE3A 4N0YH 3ZR6A 3LZLA 5L2KD 1ZHNB 4GBXC 4V1DA 4IDLA 2CCLA 2W60B 1VIWA 3E6FA 3FTGA 4ACPA 1MRDH 1GL4B 5BMFL 4XNUH 1U58A 3AITA 3ETBJ 3QP3A 5DA4A 3ABGA 4X5WB 4H0GA 4ZO8A 3MOAH 2EINB 3II3A 4XOBA 1VLXA 5FW8A 4XNQA 1KIPB 1ZVYA 5I1HL 1UKTA 4RFEA 2W5PA 2XZQL 3OLDA 1D6VL 1DFXA 5T1KA 4XOCA 1HQ4B 4LB8A 2LR4A 5GS0L 2BHYA 4JM2A 4NUQA 3EUUA 3DYOA 4JG1L 5F7YC 4P2QE 5D7JC 3P2BA 2A6DB 3MO1B 4HUXB 3ARFA 1K8IA 4IOIA 4KNSA 4F33B 3HMXA 1SUHA 5BRPA 3D09A 2N56A 5JIKA 4FTVB 4XR8C 5KW9H 4YLBA 2WXOA 1F4HA 2ZCKL 3PXLA 4OF6A 4TLUA 1B4LA 2AXHA 3LZPA 3VH8G 5IMMB 1T3FA 2XQBH 1ACCA 2P9RA 5FYKH 3TS8A 4Q14A 4MXQC 2F58L 4EIZC 1L5GA 1AI1H 4LP8A 5DZLA 2X2HA 3D4ZA 3G5XB 3D4GA 3F64A 4HCRA 4YSUA 4DP8X 1CFTB 2R4RH 3HZKB 4Z0XA 5DQ9A 2DQCH 2P42B 3I9AA 3GKZA 2CJTA 2GUOA 4M48H 5IQ9B 1C5CH 2A1WH 2NY0C 2W38A 4WJ5A 1NGQH 5FLUA 1W8EA 2F19H 4LO9A 3NQIA 4UOW1 5EUKB 1YAZA 4KKBD 5GISL 2CO1A 4JFDB 5KANG 2L7QA 3K2IA 2WGXA 1OQOA 3G6AA 4FA6A 1XCQB 4WUKH 3D0LB 3F58H 3KPSB 3LNGA 4BZ1H 3PGDA 3O3EB 4UOQA 1CL7L 1H5BC 1O5DT 3D2UD 4Q97A 2OJZL 2OSXA 1EHNA 2D9CA 4FNRA 2GSMB 4IOSA 1NIBA 1AC0A 1WD9A 3UBXI 4NDMB 5EEUA 3ROOB 3NVQA 5DRWA 1X5GA 1EEZB 4OCSL 1FC1A 1S7UA 2F54D 1I1YA 4GMSH 3U1SL 1CLVA 3OR7A 3L3GB 3OPZL 2ZP0T 3PHQA 3UEQA 5BS0A 1HYSC 4PP2A 1U33A 4X4YB 4UDUB 1CDYA 2PKDA 3QDGA 1YN6A 4LDOB 4MQTB 1IMHC 1ZVNA 4UILL 2FGWH 3TEWA 3FT3A 4JR9H 1K6QL 2BXZA 4M4RA 3RIFK 5EU3A 1PTZA 1HCVA 4P5TB 4TF4A 5I0VA 2B08A 2FQDA 2DM2A 5LNGA 4OCXL 5AUMB 1IKNC 4HK0A 3ZZLA 2E27H 4FFWD 4KZDH 2VO8A 1KY6A 1G7IB 3D5OF 3BPLB 2PWEA 3DWTA 4XPHL 1IGIH 3Q9PA 4F80A 1MLCB 3L16A 3SPJA 1BZOA 5GJSL 2WQ8A 3QDHA 1P5VA 3B8SA 1CE6A 1CZ8H 2VXVH 5TE7H 3D2TA 3ZL2A 2Z8WC 2DYPD 3AT0A 4MMZC 4W4OA 4DGYL 1RIUL 4N9GB 1EGJL 2FAUA 3LXBA 3ZDYF 2BWIA 2FIKB 3H2QA 2ZXQA 4PGCB 3ZKXC 1YJDH 5JXAL 1GPOL 5T1LD 4YDKL 1U8IA 4MZ2A 2QBWA 1DSFH 3ARED 4XE5B 4JPVL 2OYLA 4HS8L 2JJSA 2NY7L 3RGHA 3RKDC 2ISDA 1KYFA 2F61A 1DEEB 2VSDA 4PGEB 4QRPB 1KBKA 2CH8A 5ESVB 3EJRA 3L4UA 3QIWB 1MY7A 3D8MA 3L7FB 3N41F 4U6VH 5EMYA 4DERA 1NUFA 1T7YA 4LPTA 1G7JB 1Z7JA 2J43A 3SQRA 3TVMD 3OLGA 4A7QA 4ADJA 3HRZC 4OUUA 3FT9A 4PCKA 3PWNB 3ABLB 1MCPH 1P4BL 3GZOA 5E4EC 1Q94B 3QI9D 4JPIA 4IJTA 5D7HA 2ZCLH 1FE8H 3SPHA 3TF7C 1Q0YL 1IV8A 1I85A 2OFQA 1A6UH 5E99H 1E6OL 1F56A 4K5PA 3D33A 2V9UA 1TU2B 2WWKO 5HY9A 4AYBA 1J9QA 4POZD 5C7XH 2YIHA 3LXUX 4YXKL 5J57B 4LAQL 4XVTL 3BE1H 2NYKA 4MA8L 3OKDB 3OZ9L 4KMTL 4QTFA 3HI6L 2F7QA 1X5AA 1U8JA 3DHMA 2H5UA 5FUOH 3QVAA 3FQXB 2WXJA 2K6ZA 1BEXA 3ARRA 1XAKA 2AEWA 1YQVH 2ZKXA 1JYNA 1FDLH 4L2YA 3GTVA 4EN3D 5ICYB 3SGEI 5CCKH 1DLHA 5IBUB 1QA9B 1WTGT 3GLEA 5F9JA 5DWUH 3DTXA 3QDGD 2P24B 3L4TA 5FX3A 4ALAL 4WFED 1FO0H 3FT0A 5DEJA 4R96A 5DSCA 4AG4H 1NCCL 4H0IA 4RGOL 5I1EH 1XCWA 1DE4B 2LLGA 2XZCL 5DVPA 3K5SA 2VZUA 5ILTL 1MH5A 2ZSWB 3VFVA 3TNNA 1URZA 3S9DB 3Q0HA 3GHEL 2AVGA 1XZWA 4MZRA 5D7JD 2ADFH 1BVNT 1V7MH 3DK0A 1A64A 4WTZG 1OP5K 2NY1C 5FDWA 5C70A 5JPNB 2IPUG 5MEQA 1E9OA 1WICA 3NSJA 3WNNA 4I1PA 5EORL 1FO0L 3KW7A 4AG4L 5EU4B 5TF0A 3QAQA 5I6XC 4PSPA 1S9WA 5C09D 1HI6B 2N0KA 4P0DA 1I31A 4G8GA 4N6RB 5I76B 2YFNA 1M7DA 2NMSA 3ML8A 3GSQB 3JYBA 1TQCC 4LCYA 4GEIA 5CCKL 3HW7A 3DETD 3CZFB 4OSUH 4XPAH 5CEZE 7CGTA 1LO4H 2H32B 1E65A 4NNYA 3QZLA 4NBYB 3HJEA 3MRCB 1DO5A 3FO1A 1IEBA 4WU5A 4R4BB 1KSRA 3QWRA 5C2BL 3M07A 5JMOC 1FIGH 1KCUH 3QUZD 4FFYL 2RFXA 5IROD 1XCXA 3MUGB 3V0AC 4UOW0 1OGTB 4JPQA 4RGNE 3KDPB 1BBDL 3CQPA 5JHDD 3ZO9A 3B2VH 4X8GA 4CMMA 1E27A 3Q13A 4XX5A 3GJEA 1YNTA 4LP5A 5TE6L 1MJ7L 2J71A 3FTGB 1RIHH 3NJJA 1I7ZB 1PLGH 3CPUA 4NWTL 1ZAGA 3MJGX 4P05A 5AW3B 4EZLA 1T1XB 4YXHL 1CGSL 1CI3M 3NFSL 2ZKWA 3TIEA 1HHKA 1OCCB 3B9KB 2GT9B 1ILUA 1MNUL 1FZOA 3VFSB 1RJLA 1PZ3A 4RVBA 2CA3A 4TSCL 3FQYA 5I6MA 3H9HA 2Z6FA 1XL4A 3K6IA 3UYRH 4OI7A 1CICC 4Y19E 4DJMA 1N8ZA 2AANA 2V17H 3T3PF 5DHDA 4R3SA 2ADJA 1JZ7A 2AQSA 3DX9A 4RBPH 3U6RB 1A5FL 1QPPA 4KROC 2V3DA 1M42A 1MSPA 3I9GL 2FK9A 1OSYA 4UQ9A 2CK0H 3QORA 5F7DB 1CB4A 1WBZA 3SJVA 4H20L 3DUUB 3U0TA 1A7OL 1HNYA 5LBSH 3DVNA 3UG4A 4MRCA 4ZW6A 5IM7B 4UV7H 2OMUB 3GMMA 3QDJE 4H8WC 1WEJH 3Q06A 1WH0A 3MU3A 4JE0A 2Q8AL 1PD1A 2J6EA 2ZXGA 1FAKT 4PM1A 2EDOA 3SZ6A 5KZCD 2UWEE 3MUZ1 1LQBC 5DC4B 3IDJB 3KJ4B 1RFDH 1Z9SB 4ZJ9A 2ZYHA 4QHKI 4OV5B 1EERB 1UCBL 4U2YA 4ILDA 1WAAF 3T0DA 2DQMA 5IIEB 1VA9A 1MFAH 2DQFA 3DMMA 4YSRA 1UVQB 3UJTH 4P4KA 4Z7VE 1QLEB 5I1KL 3NA9L 2L4OA 1H3PL 4U4BA 1NIEA 1P2CB 1V7NL 5CZKA 3WS6A 4HS6A 1COBA 4JZJC 3ZKNC 4AT6B 4KI1A 1NWPA 4POUB 4R0LB 5EBMB 1GCYA 2KLTA 4GSUA 3U1SH 3A47A 3ZTDC 2ZX8A 3QS2A 1I8AA 3BH9B 4BKTC 1VFAA 2WTRB 4H8HA 4I5BB 2N1KA 1G87A 5IQLA 4S0SD 1JRHI 4GIAA 2I5YL 1YECL 3TA3A 5ABDE 2YUWA 2HKFH 4IGBD 5HHPB 2R2CA 3L1OH 4QIRA 5F3HA 4DGVL 4R4FH 4PR5B 4U33A 3K2UL 1ASQA 3GSNA 3B5GA 2XNAB 3GIZL 2IMNA 4PLJC 4WUKL 3P3TA 3FUFA 5CD5C 3IK2A 5BRZD 3AUVA 4K73A 2P8LB 4LT7A 4JCLA 4XHJD 3CZUB 5IEKB 4LCUA 4IRSA 1E8WA 4U6XA 2B8OT 5E94A 2DN7A 5SV3A 2WCSA 1VFBB 3LH2H 1QUPA 3HHSB 2VXUL 3S0PA 1NCAH 5HYSG 2NQ3A 3M86A 4X50A 4XXDB 1QHQA 4ZZKA 3M1BA 3CPLA 1OSPL 1AQHA 4XP4H 2YO3A 3I02A 1PIFA 3MOBL 1HHJB 2VDRL 1AMYA 1KG0B 5T5FH 2YD4A 1YQ2A 2WZ6A 2ICES 2OZ4A 2HAZA 5E8DL 4CGUB 5KW9L 3S8FB 2YEZA 2G5UA 4QO1B 1QRNA 4FFTA 5FW6A 1AXTH 2UYLA 1QSVA 1HHGA 1MFBH 3LKPA 4X6FB 4CVXB 1HSBA 4CBZA 4FQIH 4GI9A 4NQCE 4PV9B 3BP6A 3X17A 1FL5B 1AG6A 1RZKL 4M3HA 2UVFA 3HS0B 3JUZA 3EOAA 4AXWB 1EZVX 3MDJA 2AAAA 1OGSA 3B37A 4YBQD 3L7EB 4DPCX 4HXBL 2K70A 1IT9L 4FG2A 2YZ1A 4DEPB 1WBYA 1CXFA 3TV3L 1K4CA 1TYEB 8CGTA 2AI0L 3BCDA 2X12A 4L8DB 4ORZC 3DOIA 4GSRA 4KJQC 1S7RB 4YWGL 1U6AH 2AQPA 1DR9A 4G80A 3PWJB 2XG5A 2JLLA 3WTXA 5D71L 1KENL 1KY7A 4NAQA 3KYKH 2CHWA 5D9SB 1B4JH 1NGXA 2X10A 3LV3B 4JGMA 4UMSA 1LJMA 4QXUL 1OPGH 4FQCH 4KWUA 2E56A 2PXYA 5D1QE 1LE5B 2EIZA 5I30L 3QZPA 4U1IA 1CLYH 5DD5H 5E00A 1FLRH 1DBKH 2X5PA 2OJ1A 3B3IA 1OXYA 4ABWA 2WYZA 1GSMA 3FFDA 5JNYA 1OGPA 3MNWB 3S37X 1I8UA 4EF3A 4LL9A 4D9LL 4XBEL 2A9NH 1O7DE 4L4VE 4PJAB 4X6DA 3QYMA 1G7IA 1KIQA 3J8F7 2JKWA 3UBXA 2UXFA 2XETA 1XB3A 4N87A 5FM5M 2DB8A 2DQ6A 2OLDA 3BEVB 1GIGH 2O30A 3F7PC 3IJ8A 2Q9OA 2NR6A 2H8PA 3RWGB 3LYRA 4Q2ZA 4OJYA 3KS0J 3CN4A 2I27N 3CZLA 3WHXB 4PS7A 3JSSA 1EANA 4HZLB 3VFRB 2Z93A 3MODH 4ODTH 1HIMH 3UTSD 2EEAA 4BFIB 1K2DB 3EADA 3D7PA 5HXMA 2BFVL 2I69A 3HUJE 3E9UA 3NPSB 4FNLH 2ILLA 5D9SA 3L6FB 3MV7D 4H8PA 1HZKA 4YE4L 4B9GA 5GZNC 4W9EC 1MREH 3U4AA 4X9HA 1D3CA 1F4XL 2XG5B 2MPVA 3F3HA 3VRLE 1RZJC 2YSTA 4BE5A 2QKIC 4MAYB 4NI3A 4YMPA 1H8NA 4HKXA 1A14L 1CDGA 3TWCL 3UROR 1K4CB 3BH8A 1PCSA 3V9CA 1IAOA 1NGWB 3BPCB 4U1MB 2AJSL 3DRTB 4U1JB 2EEBA 1NMAL 5LAPA 4BDVA 2EEXA 3VFNB 5D7KD 3BZDA 4WI0A 3GXDA 1MCSA 2KH2B 3T3PB 3V4VH 3WFDH 4TRPL 4AMKH 3QI9C 1ZHLA 5INDA 2MCPL 1OCZB 4MLIA 3DX6A 4ODSL 4CW1A 2CKBB 2HSIA 3BKMH 3G5VB 5EIVA 1QSEE 2WWOA 3HZKA 4W6XB 3QXWA 4L3EE 5DFTA 4M6OH 4G6AD 3RURA 1IAMA 3GBEA 2EACA 1NZRA 4B5ZA 1RL1A 2CLRB 2WO4A 1DJZA 1EAJA 3IEAA 1DUYB 1MWAA 3WFEH 3NCFB 4LSSL 5HPOA 3C5SB 2V33A 2XVLA 4YSOA 3Q2WA 4ZS7H 4M7JH 2P48B 3MO1A 3ASWA 4NUJA 2P45B 5FUCC 1KWKA 5KOVC 1SXAA 4X4XA 1S7TB 3VXME 3MUY1 2PXYD 2OCCB 2WSKA 1BECA 4A6YA 2XWXA 2AGJH 2X2YA 1HQ4A 4U1GC 4QHKJ 3RX7A 5SV4A 4PJ7F 1NBVL 4EE2A 1JIBA 1TEYA 2ZPKH 4FP8H 5CJXC 3V6OE 2E7LC 2YLHA 4JN1L 1E2WA 4N24A 4OGAC 4FQXD 1VEMA 1ULVA 1AMXA 5DHXB 5IB3B 2WBXA 1RZPA 5KEZA 3KPSD 3SDAC 2DWYA 3MKGA 5CKAA 2OK0L 5I17A 1YEFH 4M6MH 5GS2D 5DJXA 1YEDB 5HDOA 2NTFB 3WJMA 2JLPA 1HNGA 2LV4A 4HJJH 1A6PA 4Y19A 1ICTA 5DK3A 4A2MA 2EUZA 2ICWI 4I89A 4O58L 5K9QG 1IU1A 5I1LB 4GEJA 3I9PA 4ATTA 3RE0A 3PQYB 1ZCRA 1VRSA 3DI3B 4CMMB 4UTAL 3IKKA 1G6RH 2DJ4A 1ZDQA 3L3JB 1J0YA 1O6SB 3KWVA 3APCA 4LNVA 2AJYH 2COQA 5I1JL 1KXTB 4HHAB 4PWHA 5C0JB 1PBYA 4OIIH 3CZKA 3E8UH 1PZ2A 4PV1C 3VI4F 3ZDXE 3BUTA 2BNRE 4KY1H 4PRIA 1JWSA 2WSDA 4XAWL 4XCEA 5DMKB 3VE0A 4OZIB 2CUHA 5C2UB 3LQZA 1KTLB 1ADQH 3HB3B 4CC1A 4N1CA 4E9RA 1BP3B 4K3HA 3DYMA 4I85A 4E9YA 2DIEA 3CX2A 3ILPB 3P0YH 3NRPA 4PWEA 1AGFB 4ACTA 3FU8A 3TJHC 1XCTB 3R19A 3DTUB 1BXAA 1A02N 1VHPA 1BEYL 4G9DB 5ITBL 5BQDA 3OAWA 5GS1A 1NFKA 3TN0B 1A7RH 4I8DA 2FEDD 2NTFA 3KM1A 5HJBA 4JKKA 1O0VA 4AQ8C 2Z31D 4HAFA 2JV6A 4JQVA 1Z3RA 4X6DE 1KB9K 4JFED 4R4ND 1UWEH 1UH3A 4Y9CA 3D52A 3V5HB 2XU9A 4MJHA 3O6LH 1O9WA 5J89A 3ZE1E 2F7OA 1P9MC 4YHYC 4EUPA 1DYZA 3CHSA 1CD9B 4M5ZH 4TMPA 1R34A 1K8DA 1MHEB 3IDGB 1G4RA 4Z77B 3FQ2A 4K9JA 3B5TA 2WVUA 4MQ7A 4GQ9L 1Z9MA 1OT2A 4LQFH 3VXSB 4N2OA 5BOJA 1R0AL 3C8KA 1QP1A 1MF2L 2GTZA 2NZ9C 4Z3IA 3G6JF 1ZA6A 3HPLA 1RK1B 1AZUA 1VGKB 2HTKD 5CMAB 1VAHA 2P28B 2YC1A 4LVHB 4HGMA 1KJVB 2J5WA 4AUJA 3H8NA 4ZMVA 4WNQB 3MA9L 2SODB 1Q9WB 1MNNA 1M2OA 1TKWB 2NY2D 1KUMA 5KUKA 1L6ZA 5KJRH 5EOCH 3JUYA 2QJDA 3NZHH 2R2BB 2DQTH 4G9FE 4MBRA 4PJGA 4X6DF 2EE0A 2WAHA 4J6RL 2G5RA 1JDAA 2IWEA 4E5XA 5CWSA 3CCHA 3QAZC 3ZMEA 4HS3A 3M17A 4OCYL 4ODXB 1I1FB 2Y2TA 1L9QA 1X6NA 4H26A 3S4SA 3K80A 2PWGA 2FECL 4YHOL 2OSLA 3UO1L 1LEKB 1PMYA 3MLRH 1AFVH 3MRFB 4WEMB 3ZY7A 3KMDA 2Y1VA 1BVLB 5DHEA 5J9PB 2BM3A 3GK8L 1RZ8B 4JFEA 4LL1A 2ZOUA 4OIBA 4WWKB 1AR1B 1TJHL 1WZ1L 1QW9A 2VLRD 1FZJB 2ZE0A 4KHTH 5DD1L 5FGBC 5BNXD 3NEOA 3O81A 2EKSB 1ZGLA 4R2GC 1QKZL 2CPCA 5FDWB 3O6KL 3SGEH 4JRFA 4JQIH 3SDYL 2XX1A 1AS8A 1UENA 4PY8J 1NCBL 3VFVB 4LHJB 4ZUSB 3ZW3A 3HFML 3STLB 1O6VA 4AVKA 4FE9A 4PJ9A 3OXSA 2V5TA 5AAMC 2APFA 1QI3A 3EIFA 3TLRA 4K9EL 1INEH 2IDUA 5EO9A 2C4XA 1PFCA 4L1HA 5A40E 3FT4B 1VADA 1ETB1 1QWNA 1ZT1B 4P46C 3D0VB 3S2CA 3T6VA 4E42A 5JR1H 4D0BA 2Q3AA 5DQDH 1LHZA 4XMLL 2Y3NA 3SGKC 4FG6D 2IAMC 5DD3L 2ZUXA 3QIUC 4A7GF 4XBGA 2FGZA 4Y4FB 3Q5YA 1E28B 2PCYA 4ZDHB 3WFHA 3GSWA 3MRPB 4AE1A 3ZDYE 1JERA 2JCWA 1CFBA 1C8QA 2X3CA 4LARL 1Q9KA 2H6UA 3RVWC 5JIIA 3LAFA 1YN6B 4I7ZC 2DTMH 1R3LA 4C4KT 1NJ9B 1T22B 3TP4A 2Q8BL 2D7OA 2R1WB 5CINL 1G5AA 4ONFH 4J2XA 5C0CE 4ZD3L 1V10A 5CD3A 3GRWH 3M1OA 5DRWB 3TEZA 3CG8A 3WO4C 3KPRD 4GW4A 4Y1SA 4ZQKA 4KDTC 4ZYKB 3UXFA 2NW2B 1HS6A 5T1DL 1AGDA 3U4EA 8FABA 3L7FA 3PHOA 5SWQB 5KWYC 4H8WH 1WCBA 3NJMA 1JZ6A 2ENJA 4TSBL 2SEBA 3ZIYA 2BHZA 3RY5A 5H8DA 3V4UH 2IPTH 3Q8CA 2JIXB 2R2EB 1I7RB 1AQ8A 2EDRA 4UCFA 4JFPB 5T3ZL 4GP5B 5GS3A 1JUFA 4JM0A 1NUNB 1XF5A 1YEJH 2QGBA 4DIXA 4PW4A 4HULB 4R7DB 2GCYA 3JT2A 3BWSA 3Q6GH 5B4MD 4LSSH 1WLHA 2H4EA 2JB6A 2QSCH 3KNBB 1XEDA 4O4YH 5CGYC 5K1JA 1TOXA 2R69L 5L0QB 3JZ7A 1CE6B 4P5KA 2FR4B 4TSAL 4JFEB 1Q38A 3VB9A 5IW3A 5FHAL 4R6UA 2E3VA 2XWTA 3ARUA 3NK4A 3O2DL 4R7NB 3ZYJA 5I19L 2CHXA 2B4CH 4OAWA 2EUVA 4NQXB 3B9AA 2AXGB 2YQGA 1FVEB 4BFOA 3IS0X 5JTWA 4Q9QL 1NGPH 3LHPL 3D34A 4UOZA 4P5TA 5KBPA 3NN8A 3BSGA 4KMQA 2YAPA 1PKQB 4PS4L 2PCFA 5A43C 1SNRA 2X4UB 4RMTA 3TEUA 3J07A 3ZDWA 3PP3K 2YAOA 5GZOA 2YWYA 5DJ6A 5DK2B 3AZUA 5JQHC 3MRMB 2K0RA 4MA1C 2GK0B 4MD5A 3TWCH 3S37H 3Q48A 4C58B 1CU4H 4GRWB 3FTUA 3I6KA 3WEBA 1ZHKA 5KS9E 1MREL 3PV6A 1FFPA 1U92B 3WU1A 1PDKA 4X99A 1ZK9A 2CGZA 3GXNA 1T7ZA 5CJXA 4WO4D 3KVQA 4ONHB 1QG3A 1OHZA 1QPKA 4AGPA 4CADA 3QCUL 2QVFB 5EU7E 4C56D 4LSUL 5J11B 2H3KA 5D7LE 4Q9QH 1BXXA 2QELA 3QRGL 1AGEB 5FB8B 5GGTL 4NKOB 2IANE 3KDMA 4QXGH 5DZAA 4WSGA 1JVLA 3CZNA 1MRFH 3GSXA 4QCIB 4PAZA 1NAML 4KK6C 1D6EB 3RL1B 5AG9A 5KSAA 5EZIH 3IXAA 1GIGL 2OCJA 4JANB 4CILA 4LMQI 1JPFA 3GB7A 5J1AA 5AD0A 1SVZA 4FQHB 3WCYA 1KGXA 1LK3L 2FZ3A 1UWFA 4HIIA 4JQIA 4AJ0A 4B9IA 5IB2B 3WKQA 1MZZA 1PAZA 2IG2H 5HGDA 5HGGS 2QHRL 2A9NL 3B34A 3IM1A 2JQAA 3FN9A 3SDXA 1SDDB 1RZ8A 2DI8A 3NDYE 1LO0L 5CJ8A 3JVGA 3DX7A 2X1WL 3OKYA 1AD9B 5EZJA 3UPRB 1UA7A 4WWKC 4ZT1A 3WNJA 1UD5A 4WHYH 2ITDA 5LCVH 2DI9A 3IBEA 5A2FA 3WMPA 4HWBH 5JW5B 1ADWA 5GIRB 5FF6A 5J6GB 1LO5A 4UQ2B 4GAJL 1I1FA 4LLDA 1XV8A 4ZSOE 2CO2A 4OFYA 3VXRE 2XT1B 3U36A 4D94A 5D2LF 1KELL 2FX9L 6CGTA 4I2XE 3ULUF 2RQEA 4RAHA 4JM4H 1NAKH 2X9ZA 2JJWA 4TQHA 3SKNA 1EHXA 4DZ8B 3MRGA 1JZ5A 4NKOA 1BOGB 3CDGA 4Y16B 1OGAD 4BXVA 3RWIB 3QW9A 4X9BA 1MHPL 1IIKA 1U3HD 4MD4A 2J4WH 3HPLB 2FE0A 3JVFC 5E6RB 2J7LA 3QIBC 4AQEB 3FDWA 2DTML 1FPTL 1ORSB 2APVA 3AS1A 3AY2A 5BQ7B 1MUJA 3BAYA 4DPBX 3V4LA 1DLFH 3NFPA 5C0AE 5JPMB 2YGOA 3ZZSA 4AGLA 3N91A 4WKZA 4UM9A 2W07A 5DDHB 2N1TE 4TQIA 4A39A 2KQNA 3GSOB 1ORQA 3B2DC 2ROYA 4K3DL 4PD4J 4ZBJA 5HYQA 1SF3A 1A7QL 2FLRT 3OHXA 3OMZA 4KKPA 1OGTA 4G3YL 5J13C 5DK2A 3QGVA 1LMKA 4LZKA 3MYJA 3LKSA 4NENA 3WIFB 3SZKC 1IBHA 4DP9X 4JS7A 2J8UA 5GPRA 1J1XH 2N4IA 3H7BB 3EYFB 3ULSA 1UTDA 4TUJB 4MA3B 2O61B 1HEHC 1E6JL 1NSNH 3O8XA 2HTLD 1QLFB 5JW5A 2Z9TA 1AQKL 5F8RC 4OFIA 3QQXA 1YCSA 3A4DA 1YEGL 3ILPA 2V7NA 3R4DA 3FK3A 2C9RA 4P49A 3HFMH 4X83A 4NNXA 4RIRB 1AD9A 1MFUA 3MBEC 5DGRA 4BRVA 1DVSA 4BKLB 1Z9LA 1EDQA 4WEBH 1U4EA 1HJBC 4YNYB 5HGAB 2VTFA 4TLSA 3GEWB 5EZIL 5JA8B 3L1FA 1T5WA 1EK3A 4HX1B 5D93B 1QZ1A 4CVZB 4JJOA 1UA3A 1F3DJ 3KLKA 2W81C 4L8SA 3QO0B 4QXGL 1KLGB 1NFDF 2ZSVA 3IU3A 4JANA 2B9BA 4I0PD 4LEXH 3QDJD 2V3FA 1CTNA 1CDCA 1A22B 4LDLB 3GI9H 4KUZL 4PLKD 5GGRB 3R0NA 3WS3A 1BPVA 3GNML 3O3UN 1T1YB 4L37A 3CSYB 3DOHA 1JCKA 5BZZA 1G1CA 3TF4A 5AKTA 1BQ5A 2YBRB 1Q0EA 4S0TD 4ZUWB 2AV1A 3RGVB 2OV0A 4Z3TA 4R97B 1OVZA 3SYQA 3H56A 2P24A 3JWOL 2NXYB 2CXGA 1E50A 3FO0L 5HI5C 3HNSL 4JREB 4PRHA 4MJ6A 1JHLH 1DQLH 1BQKA 3SCMC 3SGDH 2ZUWA 1UCBH 3DHUA 4PJIB 2BOCB 2EUWA 1GGCL 4OZ4B 4LPVA 3VW3H 4QHNA 3JZYA 5IW6A 4XP9H 3WL9B 1OZUA 1DVZA 5E8NA 4PS4H 4LASH 2XKSA 2C1OA 1SXSA 1S9YA 4J6IA 4P2AA 5D7EA 1BPLB 2FH8A 2LVEA 2BIMA 2IAMA 1NBYB 3QIUA 1JZEA 5E6UB 4MNQA 1AS7A 3O6LL 4FLSA 4O5LH 1GGUA 1BBJB 4UM9D 4LQ1A 2VMCA 3BSZL 2VDLB 5KG9A 1FF5A 4OGAD 3ECWA 5ADPL 4NO3A 3FQTA 1BMWA 3OWEA 1CVSC 1FL6B 1AJ7L 1NL0L 5CN3A 4XHQA 2YPKB 4HA1A 1SGKA 4X7TB 1MFMA 2WBJA 1WFJA 2EE3A 5ISZA 3RNKA 1ECZA 1W16A 4OZFB 4X7CC 2GK2A 3NSXA 5EO0B 3NRQA 1J1OH 4RAUA 4OQTH 1Q9LA 2IANB 4L8BA 5HJDA 1E42A 3OGOE 3SDXF 4R83A 4A7VA 2ZUVA 3DJSA 5KYWA 1L9PA 1JF1A 4PWKA 1ET7A 1SVCP 1WAEA 3QFDA 5F9DC 3KVDD 3VXOA 4TLKA 1BFTA 1E90A 3F7YA 2FNBA 4RAVA 3EJYC 1BZDA 2ZXDA 3L3OA 4ORGA 1RJZA 1IAOB 1NGWA 2RCSL 4R7XA 4MB4A 4NQDA 1J1PL 1MIMH 5TTRA 3SD5A 2YPVL 1BVLA 4NQQA 1OGAE 2WWNA 4POZC 3X13A 5IJBC 2AJYL 2X4QA 4TUUA 1YEHH 1PZ5B 1N4XL 4P3CH 1KCUL 2HWZL 3S4SG 2J88L 2OSLB 4M3KB 4CN6A 2JKNA 4XMKL 3RNQB 3L4CA 5F8QC 2QKIB 3I75A 4ZX6A 1G6RL 3BP6B 5CD3B 1D5IL 3FPXA 4J5VA 3CCHB 1HAUA 1PZBA 4LARH 1H6FA 2H3NB 3KM2A 4MZIA 4RAUB 3CIAA 4XPAL 1J1PH 1MIML 3AJ7A 4JFXB 4Z9KB 3Q7JA 3FUMA 1IC7L 3IS1X 3SDXE 3DO4A 1QUNB 5T3XE 3U9UB 3RYMA 3NACH 4F2MA 5EA0L 1JK9B 4LEBA 4E41E 5BW7C 1I3VA 5ECJE 4F1ZA 2WQWA 2V8LA 2YC1B 1NEUA 2B1AH 2OXHA 3ZRCC 2ZWZA 3M1BB 3VU1A 1TPXB 4A55A 5F1IB 1EEZA 5FEBA 5HP5A 1ECYA 1ZA6B 5E8OA 4UANA 4XWGH 2IMMA 3MROB 1BIIB 2A74C 5EC2B 3TYFA 5HJ3A 4WJG3 4WW2C 4E9QA 1UB5B 3OMAB 3PNWA 3OMIB 1FV1A 5IEKA 4HSAC 1UWGH 1KGCE 4PWIA 2KQMA 2VLKD 1NCCH 2APXA 4FXKB 3V5HA 3R7RA 3UAJA 3O41A 2WM0A 4L4VD 3VM5A 1QSZA 1XBRA 3WFEL 3EO0A 1U8HA 4KNUA 2YKLL 5HHPA 1QR1A 2EDXA 1UXSA 1AR2A 1ED3A 1N6UA 2RA1A 2OTUA 3E80A 3NZSA 3T3MB 2NY5C 4GLRH 3T9WA 1IGCL 1Q1PA 5J1TC 1D9KD 4RDQF 2FH6A 1QFOA 4FYRA 3STBA 1BX2A 1DEDA 2PUQT 3DSNB 4XCNA 4JJ5A 1KJ2L 4QLWA 5E8EA 3P0VL 1SRDA 2R27A 2ICWA 2CKBH 4K8RD 4M03A 1GW0A 3O4LE 4JRYA 3P2TA 2DQTL 4UAOC 4KVPA 3HTLX 1I3UA 5F2FA 4RMVA 5DEFA 4TXVB 5E99L 1DQLL 2Z7UA 1IQWL 4W9DC 5KVEH 2EJ1A 2YD8A 3KCWA 4HIXH 1NUGA 4PJCB 2ZCLL 5I1DA 1DQJB 1CCZA 1AR1D 2WXRA 2XFXA 1HHIB 1CO1A 1MCLA 1SJVA 3T2OA 4K3JH 1LNUA 4P5MB 4IEFB 1O6SA 3OXRB 4QRQB 5DMYA 4KKLC 1BJ1J 1ML0A 2X6BA 3WBDA 1FH2A 4X5WA 4YDMA 4QOKA 4XPGH 4XH2A 2KKQA 1HWWA 3PE9A 4MMYB 1BJ1H 3QUKA 1QEWB 3ESPA 1DVQA 2B0SH 3MLWH 3AREA 3TZVC 3C8KB 3B7TA 1CXEA 1HH6B 4BCZA 2XACC 3L3DA 5C97A 2WKGA 2LU7A 5E2TH 1DL7L 2BNQD 5JPMC 1K8DB 1MHEA 2B2XL 1TSHA 2DLFL 4GUPA 1BVKB 4FYTA 3X1FA 2EIBA 2ZF8A 4E2OA 3D3VA 5FYJE 2P8LA 1MCFA 1F8TL 4LKXB 4WI5A 4MX7A 3LNHA 4D3CL 4PP1C 3KYAA 1A1OB 1LD9B 3B1UA 4OM1H 4PR5A 4PJFF 1K5NA 1OPOA 5GJSH 4ZXBC 1ES0B 3VJ6A 3WFCH 2NY5L 1IC4H 5GRXG 3BISA 4E9XA 4AITA 4XN2A 4J4PD 3LDBB 4A2HA 5DURB 4N8CH 4DVRH 3CE1A 35C8H 3AT9A 4UQCA 2RHEA 4FQLL 1DSYA 4H2CA 2H6OA 1E8YA 1L3WA 1Y18A 4H5SA 5E2WL 3SDAB 1OAJA 1QEWA 4DTGH 4L8CB 4J3WA 3L2MA 1JGIA 4WY7H 1FIEA 1L9OA 3DJTA 2C3VB 3GGWA 4PWFA 1QFWM 2Y24A 3OQRA 4M9PA 1SHMA 1P2CA 3RTQD 4XVJH 4XVSH 1GC1C 1YEEL 3T04D 3DMMB 4X4ZA 4JZJB 4Z23A 1E4XH 3FO2B 5L8LB 1V27A 1A65A 3VE0B 1F1AA 1T03L 1EHKB 3POHA 2ICEA 2ED6A 4EN2A 5KS9B 1PEZA 5B39A 3KLLA 4OCSH 1ZVHA 1KYOJ 1KPRB 1GZPA 1MFEL 2VL4A 3LZQA 2UZXB 4YH6A 3T3PE 5IWLA 1HEZB 1INDH 2GJZA 2LFGA 2X7LA 2BZCA 2WQSA 4FI6A 3K6NA 4NN5B 3LRKA 3GXMA 4DKAA 2HVKA 2XN9B 3HBQA 4JFFB 3H9SE 1YUHB 4FQIL 3I74A 1OTSC 4X5XB 5J3HD 5IM7A 1IAIM 1KC5H 1UGKA 2PTUA 7PAZA 3QWOA 3LQAH 3AWFA 2FZ3B 5FGCB 1NGQL 5EFIB 1OTTC 2VITA 4NGHH 2J55A 4NJAL 1T80A 1V3MA 4F2ME 2E75C 4IIZA 1AO7A 4FD0A 4LLUB 3OAZK 3Q6FA 5LCVL 3C60B 4PGBA 1NGYB 4U1NA 3RTQC 4ABUA 1WFMA 3D05A 3C2AL 1IJ9A 3KPOB 1G7MB 1HOCB 2V9QA 3G3LA 4M9OA 1TMQA 4LBEA 3EZJB 1RSYA 1Y1UA 3AU0A 4JDEA 5L9DL 2RJMA 2W1NA 4HH9B 4JRXB 4I3GA 3VXRD 5G55A 3CFEB 2EDLA 2DWXA 3D4YA 3PWLA 4XVSL 1CC3A 2IPKA 3T8XB 2BSED 1L7TH 3ASOB 4E41B 1GGIL 4X99B 2BNQA 2CALA 4E68A 1HH6A 4OLXH 3BN3B 3MROA 5EC2A 2IDSA 4FNUA 1PLAA 3B9KC 1AY1L 4XN1A 3TV8A 1Q1JH 3UBXB 4MMYA 2DF3A 4Q6KA 3W11D 1L3NA 3EGXB 5IHZB 2IXQA 3F83A 3TBBA 4Z7QE 1MWAH 2XN1A 5HHMD 4ODSH 4MHHG 2BSBA 5TQ2L 3GS7A 5TDNB 4MCNA 3RPIA 3MOAL 4HT1L 2XFXB 4ZPTA 2FUQA 3BN9C 3TC9A 3N0AA 1L6XA 5FO9A 1CN4A 3NJHA 3ZGIA 1I8KB 1UM5H 4YHZL 3VFMB 5ID0A 4RA3A 4D3CH 1X5JA 3EOTH 4WW1B 1GKOA 5F7BA 1Y07A 3RNQA 3NA9H 4PHXA 3CBJB 4XZ4A 3GO1H 1UEMA 3ELAT 2VLME 1MCEA 1NFAA 2IGTA 5DI8A 1YPZF 3HZMB 4WWOA 3DMMC 2XVKA 4XC1L 2IBBA 1RJZB 2DKMA 4BSWB 2B0SL 3JT0A 3B2MA 2EIKB 2YD1A 5DRXB 3WLWC 1GJIA 4PJXE 2NQCA 3UJJL 3V0WL 1CGWA 1E9OB 3CDYA 1HQRB 2VDQH 3ETTA 4TVUA 3QWNA 4R5TA 4UQBA 5F6IB 1CGTA 1X44A 1A1NB 1WEJL 4XRCA 2FJGA 3SJVD 1U8IB 2IV8A 3ULVE 1AKPA 1U8CA 4L8BB 3LKPB 3SGKA 1U8HB 3T0XA 3HNTL 2YPLE 4MJ5B 1S9VA 3SCMA 4QRRD 3WNLA 3K8KA 25C8H 4N28A 4OVUA 2NUPB 3IJYA 2MWCA 2NY1D 4P2QB 1WCBB 4N0UA 3MRLA 1IB5A 4GRWE 4X4KA 4CC4C 1S78D 4CNIB 3WEAA 1PZUB 4MMXC 4W4NA 5T3XL 2ALWA 4W9JC 3L81A 2HMID 4EZKA 4IBSA 3WSQH 3FSVA 5KAQF 1R5WA 5E8OB 1MI5D 2B16A 3ALWA 4WI7A 3SOBL 1PG7L 2CO3A 2PWDA 4ANUA 2GFBB 4UTBA 1KJ2B 1N68A 3HCVA 4NPYB 1EHAA 1W2KT 3RPKA 1X5MA 3QUZC 3ALPA 5KJ7E 4YGAB 5A2IH 4AL8C 4CSSA 3GSRB 1HWGB 2RR3A 2X4PA 5C08D 3ULVF 4W70A 2BP3A 3QR2A 2AXJA 4U1IB 1PLGL 4WFFE 5GRUH 3X14A 2XA8H 1KB5H 5AB2A 3C6LC 5EG6C 1QRNE 2D73A 2UX6A 4DWHA 3B7UX 2R7EB 2FJGB 3QUYD 2KS0A 1CD1B 2DKUA 3TA3B 1P53A 4ZD3H 5JOFB 1WC7A 3MLTB 3CU7A 3PJLA 1SMAA 1FYTD 3P69A 2WWMC 4AYFA 4JHUA 2WB7A 4XOEA 1U30A 5D5ME 2Q87A 2BW5A 4M5SA 3CVIH 2DM4A 1OANA 1GYAA 3ISYA 1JZJA 3MSPA 5F9WC 4LSQH 3MLPA 4LDEB 3CMOL 2A38A 2X4NB 1BFVL 1DZBA 4HIQA 4JFZH 5I8OH 1SM3H 4H7VA 1G6VK 1SOQA 3NACL 2Q86B 4Q8BA 1CDUA 1FFNB 5IQ9A 2HFFB 5JDJA 3VI3F 1KIRB 2H1PL 4TN9A 3D9AH 5HHNB 4NCDA 3WNMA 3BFWA 2YUZA 1FZJA 2P46B 5EO0A 2CJUL 3KE0A 4JO8A 5DJZB 3LRLA 1D5IH 4DW2L 4UT9L 1FVDB 2GJ6B 5H37H 5BVJB 5AW8B 4N5ED 5KS9F 5BV7C 2K3TA 2NNCA 1RI8A 1T83C 4OIFA 5J3HC 3VRLF 4BZYA 4JEGB 1II4E 1BREA 1U8NA 1HDMB 3DRQB 4KKAC 3FRPB 4K5MA 5MERA 3D4CA 3IFNL 5L2JA 4H1LH 5CIPB 4HISA 4MHHI 2X70B 2P5EE 3UBHA 4OLZH 1AYRA 5EU7C 3I6GA 1F6AB 5CJQH 3QORD 3H7BA 4FYQA 3BGFC 5AZEH 4CC0A 5JYMA 1N6VA 3FCBA 3QUML 5PCYA 4KI5C 4OZIF 4FJ6A 3LNDA 1HOCA 4XNQB 2NY2C 4M02A 3I6LD 4NSKB 3QULB 3AY4C 3VWJA 3B43A 5IK3A 1TCMA 43CAB 4AKOA 3C60A 1U58B 3M1CA 3CFIC 4PY8I 4ZUTB 2BOCA 3HOGA 1YMMA 5C6PB 4V1DB 4QHMB 4D7BA 1XSIA 1JVKA 3P4OA 5C7XL 4IU2B 1AJ7H 1NQBA 5JOEA 2C9UA 4W9LC 5I1KH 5KJRL 5HHOD 4UQ3B 2VLRB 1MFAL 4MJ4A 3DUSB 2LLLA 5GSRB 1N64H 2X40A 5F21B 5CJ5A 3ARBB 5CSZA 2V6HA 5C0ND 5JQIB 4HOZA 3KJ6L 3BVVA 2ARJQ 4BA0A 3FOMA 1MF2H 2OMVA 1FZMB 3IMRA 2DQHH 2YGPA 2IH1B 5KS9A 3IDJA 4JUSA 2NY0B 4NNYB 3I3EA 3FPYA 5EU6B 1ID5I 4KKAD 4YPGA 1JZDC 3VG9B 3ARGA 4QNPF 3PIQA 4TUOB 5AFAA 4LCYB 4ECNA 1CYGA 4UQEA 3K71A 5K59E 2HUHA 2Y06L 4BKLA 3L3IA 4B7IA 1G0YR 3DVGA 3O2VH 5C0IB 4BFEA 4GB9A 1OAUL 2X4TB 4MQXD 3LEVL 2FYYB 1K3ZA 2FRGP 4WTZA 5CHNA 4IOIB 4DAGL 4XZUB 1CFSB 5EU6A 1EXUA 4EIBA 3O9WC 5CEYB 1K3IA 3CHQA 2P43B 4ZOCA 2ZTBA 4XP6H 3VGFA 2VLJE 2N7BA 1RUAH 2XC8A 1XGYL 4FQPA 4LHUA 1MCWW 1MH5B 4OCMC 4YDZA 3U79A 3FOMB 2Y5TB 1KOAA 4TSCH 3ZKQD 4G6MH 4OZGE 5IMOA 1JS4A 1TTUA 3GI9L 4KUZH 3NJKA 1MQKL 3MRJB 3VXRB 3MLUL 3WN6A 4OCXH 1Z0MA 3ARBA 3VI4E 2BRRH 5K5YA 4NYLA 2A9BA 4EXKA 4YXHH 2R1YB 5AB0A 1ADQL 4K9EC 3UYPB 5DR5L 1KXVC 3HE7B 2CA4A 4JR9L 1AC6A 1MDAA 5JPNC 2EYTB 3S88L 2CK2A 3MRRA 2WXPA 4WEBL 2C34A 3GIVB 2BSRA 2WVVA 3KS0H 3RJOA 3PY9A 1CPUA 5DRNB 1ZVSB 3W2DL 5T1JA 4MD4B 1K4DA 3NK3A 2GK0A 4MD5B 4FNTA 4RFOH 1NAMA 4F37K 4JREC 4DZBA 1BOGA 3CDGB 4Y16A 1KXVA 3AFLA 3AROA 1J5DA 1FNAA 2OJEA 2AC0A 2BNUB 3GF8A 3S36H 4BEIA 4MAYD 5ALBH 3QNFA 5BXFB 3SKNB 3RGVC 4OSUL 4HFWB 3GRGA 3K7UA 4H8QA 2DLIA 5C0GB 3KXFB 4G3YH 1UATA 3AB0C 3L45A 4P9HH 4JHBA 4XZUA 3DHPA 2OK0H 1P7QB 3WKNA 1A1MB 2W80C 2XN2A 3VGEA 2AAVA 3V7AG 3S3JA 3BVUA 3MXWH 5I76A 1JDCA 4N90E 5I28A 1AGCA 3SE4C 3IRZA 5B7FA 1PEWA 1ZHBA 2GC4C 2VISB 4HC1H 2NY6B 4IBYA 2Y07H 2F58H 3CBRA 5F6IC 1G7PA 4MAYC 2IH1A 1BM3L 4ZS7L 5LCVA 3KPPA 1INQA 5F0JB 2IOMA 2VDKL 1WZAA 4BFGA 4R5VA 4L05A 5GRUL 2HFTA 4R96B 2AW2A 2DY2A 4CN1A 1FH5H 4I2XB 4N2LA 2CRZA 1THAA 4WO4C 2YGQA 3KD4A 4GG8B 4NLHA 1M56B 5SWSE 3U4EB 1NCOA 8FABB 2BO0A 3PDOB 4AYFB 1TQTA 4BH7B 2O26U 4L5FE 2RH0A 4MAYA 3BKML 3U2JA 1KGJA 5D7IE 1IAKA 1SFDA 1DVXA 3QG7L 2NW3A 1L4IA 2ZCZA 3ZKXB 3AM8A 3WSQL 1W0WB 4WAFA 4IBZA 2IG2L 1ZV5A 4N20A 1HTYA 2XXMB 1U8JB 2V0AA 3OGCA 1DVFA 3MV11 1S3KL 1ZY9A 1RV6X 2BERA 3WTWA 3HI1A 3VFWA 4BFIA 2R1XB 1QUNA 1YLBB 4GO6B 4LSRH 4FF9A 4RMQA 3LSOB 3FCTA 1NAMH 4UDUA 4Z95H 4GT0A 5DJCA 2MMXA 1OEZW 2X28A 3Q9QA 2IOOA 4PVLA 4LMQE 5TH2A 3AT8A 4OGYH 4NQTA 1G1YA 1P7BA 5SX4I 3QCTH 1Q94A 4V2BA 5KSVB 1BMGA 5TPWH 4X6CE 3NEEA 1U8NB 1TR7A 1X6LA 2BSSB 2X4QB 3OPUA 1QI5A 4M1DH 3FB7B 2VMEA 5JIDA 2ZWSA 5JNYB 2D4DA 5DC0A 4YDKH 3KWTA 4FFZL 5E00B 3AQDA 2HH0H 1LMIA 1TO5A 4D0DB 3IGLA 2F53D 4BWWA 1SEQL 1S9VB 4DGYH 1ZLVH 1JGEA 3HNVL 4DKFL 5HYJA 1CK0L 2Q86A 3LN4A 2CMRH 2EDBA 3V79C 1LP9E 4B97A 3HBGA 4FKKA 4N25A 3C5JA 3UBXG 1Y6KR 3BKYH 2Z7YA 5CR8A 1X4YA 2FQEA 3UTQA 2PTTB 4LXFA 5BS0D 1MWAL 5JHLL 3PWUA 6FABL 5IMMA 1AGDB 2KDYA 1NKGA 3FN0L 4PRIE 1FFRA 3QPQD 4HCIA 1HZHH 3P4MA 4LCIL 2WY3B 2WMPA 2X1XR 3LY6A 4O02B 1KN2H 4JY4B 2CJ3A 2FCBA 4HUXA 3VSTA 5IFAL 2A99A 2CR0A 2Y7SA 4UT7L 1Z9OA 2QSCL 5ID0B 1IFGA 4P3DA 3MGOB 3AGWA 2J1KA 1GYWA 3VO0A 2WQVA 4TUKH 3MV8D 2DBLL 4QRTB 3LSOA 3DIFA 5F7LB 1SQ2N 1IT9H 2WQXA 2CO7B 1KG0A 2F6AA 1L0XA 3ZUNC 2HXAA 2IXQB 1FJ1B 2RAMA 4QHNB 2CBQA 1S7UB 1E4KA 1XSOA 4BZ2A 4NS0A 2DWDB 3S8WA 1JE6A 2XIIA 4HBQA 1JL8A 3AMKA 2C7UB 4M00A 2JKLA 2QVIA 3SE6A 2Y1ZA 1R5VA 4MQ7B 5E5RB 4U49A 2F53B 3F8UB 3B6SB 3GMRB 3LQAL 4NZTL 3V6OC 5GISH 4BH7A 2WD0A 4U6XB 2RACA 5JHMA 4RISH 2DQIH 3DX8A 1XZ0A 3F62A 3L48A 3PFQA 4MS6A 3VXMD 4B53A 2YOAA 4XWOD 4KO9A 4L4TB 2IPUK 4GAFB 2ZG3A 1VESA 2XOTA 4CGTA 2GSIB 4M8RA 5CLTA 1H8OA 4BK5A 1X7TA 4BUHA 1YAIA 3KPPB 4EO5A 3TZVB 4YXLL 5IKCB 3VFOB 2N3JA 3QI9A 2QPSA 4XCFH 1H0DA 3Q5TA 1UEYA 3IDMB 1UG9A 2C9SA 3TZVD 4F8TA 4Z8FH 4OD1L 3W5NA 2Z31A 4LLMA 1DVTA 1YG9A 2PO6C 3DOSB 4KRMB 4YSTA 3C08H 2CNZA 4FQQB 4K3GA 3IFPB 4DTGL 5B3JF 1CBJA 3F12B 5GS0H 1IJNA 1K5WA 5CP3H 5E2WH 4OFPA 1J9CT 1C5BH 1Z9NA 2X9XA 1QLFA 1MCWM 2A6DA 3BDYH 4I3RL 4KZCA 2NDGA 1FL3B 4JRLA 4MKTA 4N8CL 4DVRL 5CU5A 2IADA 2BP0A 2XXCB 3HG1D 5FO2A 2I07A 2FO8A 4OLVL 1OOAA 3FQNB 4F7MB 1N70A 3MBEB 1KIPA