2MTAA

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2mtaA00
2HX8A 3CVBA 3T9WA 2AANA 1PNCA 1QLEB 1XB8A 1A4AA 1SHXA 3S8GB 2OCCB 1AQ8A 1IKOP 1OCOB 2AZAA 5D4HA 4YVNA 1E67A 2Q5BA 2N0MA 4YSCA 2XV0A 1A4BA 2VMJA 5B7MA 1WAEA 1V10A 2EIKB 1BQ5A 1FFTB 4EF3A 3DTUB 4HHWA 3AG3B 2GIMA 1JZHA 1ZPUA 1GS8A 2DWSA 3ERXA 1GS7A 3HB3B 1ZIBA 2Q9OA 2I7OA 1PAZA 4YVUA 1JXGA 1KCBA 2Y69B 3FPYA 2CJ3A 2QT6A 1MZZA 5B7EA 4KOBA 2YAQA 4E9QA 1ID2A 2OV0A 1VLXA 1WS7A 3WKPA 1PY0A 2YAPA 2BWIA 4GY4A 4G70B 2XWZA 2FQDA 1ZIAA 4HAKA 1V55B 1BQKA 2HLEB 1ET7A 1JZFA 1FWXA 1NWPA 5FC9A 4A2GA 2HRGA 2VM4A 1L9RA 2YAFA 2W88A 4AKPA 2GC7C 2XX1A 1OE1A 3T6VA 3T6ZA 1ZDSA 3NJFA 4BK5C 1AZNA 2UXFA 2E86A 4GP5B 1FA4A 2B3IA 4A2FA 3IN0A 3PPSA 4PAZA 3IBOA 2MRYA 1AACA 5AFAA 3NJNA 5TK4A 1E5ZA 4JHVA 3MBWB 1OF0A 3UGEA 4DP8X 1NIBA 3NJIA 4QKTA 1BXUA 1M56B 4E9SA 2VW4A 3OMNB 1J9RA 3MX0B 1MZYA 3X1GA 5D4IA 3NSDA 4YSQA 1KV7A 1IUZA 3FSZA 1MG2C 1SF5A 3KW7A 3PLYA 2FNWA 3U25A 3UACA 1KDIA 2WO2B 4DP2X 3ABGA 1BYPA 3ABMB 4A66A 1QNIA 1TU2A 3V9CA 1OE3A 4HCFA 2QPDB 3NYKA 3BVDB 2HZHA 4UF7C 2XXFA 3KW8A 4HZ1A 1AG0A 5PAZA 1JZIA 2XLLA 3NSYA 3PCYA 2FTAA 4BWUA 2GHZA 2PP8A 4GXFA 2XYBA 5B7FA 4MFHA 2VM3A 1MDAA 1WA2X 2PPCA 3NSFA 4P5SA 2XXGA 4FAAB 1PCSA 1SDDA 2AFNA 1TKWA 2CBPA 3ASNB 4G71B 3PAUA 2EINB 4M4RB 1R1CA 2ZONA 3NJLA 4G72B 4A2HA 1ET5A 3IEAA 3RYMA 4DP7X 3G5WA 2XU9A 4YSAA 5I28A 1J9QA 2X88A 4BWTA 5I6OA 2YAHA 4UAHA 2IDQA 3H4FA 8PAZA 4Q89A 1JZGA 1AR1B 1ADWA 5EHFA 7PAZA 2BP0A 4HALA 2QPEB 4KNTA 1BXVA 2WO3B 4YSEA 3TA4D 2PCYA 4GP4B 3CG8A 2QDVA 3EH5B 5AZUA 1IBYA 4AX3A 2XV3A 1AAJA 2UX7A 3WIAA 1NINA 3T6XA 3QQXA 1IC0A 1AS8A 4YSOA 4KO9A 1PZCA 1A4CA 2BW5A 2FT6A 3EH4B 2BZCA 2JXMA 3NJGA 5I6LA 1PZBA 3EH3B 2IDFA 2IDTA 1OCZB 3X1BA 1NIFA 2EILB 1NIAA 1AANA 3WI9A 5B1BB 1M57B 4KO7A 3TBCA 2IDUA 2HX9A 1ILUA 1SHWA 2YQBA 1W8EA 4BXVA 3QJVB 4KO6A 1QHQA 1KCWA 1L9PA 1SF3A 1KGYE 1W6LA 2J57A 2X87A 3C75A 1SFHA 2PPEA 4AI7A 1YLBB 3UAEA 1F56A 2CALA 2QDWA 1GS6X 2FT8A 3TBBA 1OE2A 4DPAX 2AZUA 4YSDA 3FS9A 2JKWA 3CDZB 2BP8A 1NICA 3CVCA 3OD3A 2YAOA 5ANHA 1KBVA 3ZBMA 4QLWA 5I26A 1OOWA 4KNUA 1GSKA 1WA0X 4TXVB 5B1AB 5I5MA 4BDVA 1ET8A 4E9XA 2R7EA 3DKHA 3OM3B 3FSWA 1WS8A 1PNDA 2GC4C 2B08A 4L0PB 5I6NA 4G7RB 2DYRB 4KNSA 1J9SA 4N4YB 4W1TA 4F7KA 3S8FB 1NDTA 3EF4A 4K9JA 2XVBA 1NZRA 1JZJA 1NPNA 3CVDA 4DP5X 3SBPA 2IWKA 4JKNA 3FT0A 2XV2A 3FU7A 4E9TA 1HAUA 1GW0A 3PAVA 1GY2A 4UANA 2FQEA 4YSRA 2A3TA 3SBRA 2FQGA 4YSPA 4YL4A 4A68A 2P80A 4E9YA 4AZUA 3N55A 2YXWA 3NP4A 1NPJA 2TSBA 3FQ2A 4HCIA 1OCRB 1A8ZA 2IWEA 1XB3A 2YXVA 6PCYA 2BWDA 2EIMB 3WNJA 1HFUA 1J5DA 4BWWA 1CURA 1OV8A 1W6WA 3GXUB 1PZAA 3FPXA 1M9WA 4CSPA 3FSVA 3QPKA 3QJSB 3IN2A 3ABLB 2CUAA 4ZK8A 5I6MA 1KDJA 2VN3A 5D4JA 2VSMB 1BEXA 3S3CB 5I6KA 2PP7A 2VW6A 3AG1B 3CZUB 2ZWNA 1A3ZA 4FA7B 3V9EA 2CCWA 3PAZA 2PPAA 3ASOB 3UAAA 2ZXWB 2BW4A 4Q8BA 7PCYA 1KBWA 4A67A 4P5RA 1NTDA 4NERA 1N70A 2LLNA 4DPBX 4YSUA 3ZDWA 1GYCA 2H3XC 3FYIB 1AZUA 4CSZA 2IDSA 2I85A 1NWOA 4G7SB 1XB6A 4GP8B 2GSMB 3NP3A 1JVOA 2PLTA 4X4KA 4HCGA 2CAKA 3FQ1A 4BXSV 1PF3A 2PPFA 2XX0A 2TSAA 1AIZA 3H56A 4WKXA 1ASQA 2YARA 3AZUA 3NSCA 1A65A 2VW7A 1L9SA 3QJRB 2DV6A 2IH8A 4PCYA 4DP1X 3N2JA 1URIA 1RZQA 3DIVA 3FU8A 2PP9A 3JTBA 2UXGA 3QJQB 1CC3A 4E9VA 4M3HA 2FWLB 3FYEB 3D12B 1AS6A 3WG7B 1J9TA 1RKRA 2IWFA 4A2DA 4ENZA 1AZBA 1CYXA 3AG4B 3NJKA 4E9RA 3FQYA 3GYRA 1B3IA 1SDDB 2MTAA 2RACA 1ASOA 1DYZA 1BYOA 1XMEB 2FT7A 1ASPA 4DP9X 1MG3C 3S3BB 2HX7A 1EHKB 4DP0X 4GYBA 4NB7A 1AOZA 5F7BA 4YSTA 5E9NA 2H47C 3JT2A 1BXAA 4A2EA 1JERA 4HIPA 1X9RA 3IE9A 2BP0B 5B3SB 2I7SA 4F2EA 2J55A 2YAEA 1T5KA 3SBQA 1AZRA 2EIJB 4AKOA 1PMYA 2IH9A 1NIEA 6PAZA 1I53A 3FU9A 1RZPA 3NT0A 3HEIB 1CYWA 1OCCB 1E5YA 2P80D 2DYSB 2JFCA 2GB2A 2W8CA 1WA1X 2UXTA 3AG2B 3ABKB 1IBZA 1N68A 4KO5A 3NJMA 3AW5A 3T6WA 5F7AA 3TASA 1KYAA 1L9TA 3TU6A 1TEGA 5AKRA 4AKQA 2OJ1A 3X1FA 1TEFA 1SFDA 1PLAA 2GBAA 4E9WA 9PCYA 4DPCX 2VSKB 3FSAA 1ILSA 2DWTA 1JZEA 2GI0A 5I5JA 3WNIA 5TK2A 4HHGA 3PXLA 1ZV2A 5I6PA 4W9ZA 3OQRA 1HAWA 1JXDA 2WSDA 1PLCA 2Y1AA 2YAMA 1GY1A 2DY2A 2BP8B 1JXFA 3SQRA 1J5CA 2J56A 3S3DB 3ZIYA 2PCFA 2BHFA 2XUWA 2IAAC 3GDCA 3OMIB 4RH4A 3OMAB 4F2FA 1CUOA 3NJJA 3UABA 1SJMA 3X1EA 4BDVB 4DP6X 5A7EA 2R7EB 1L9OA 4WTQA 4G7QB 3UADA 1EZLA 1NIDA 3T71A 1AG6A 2PPDA 1JOIA 5B1KA 4KOCA 2FJSA 1GR7A 1SNRA 4N8UA 1RCYA 2FQFA 1PLBA 3H4HA 1ZDQA 1BAWA 2HXAA 1V54B 1DZ0A 4YSSA 1E30A 1L9QA 4DP4X 3FU7B 1X9UA 5PCYA 3ZX1A 4JHUA 2HRHA 3X2QB 2J5WA 3WKQA 5I5IA 2UXVA 3X1NA 3NJHA 2H5UA 1BQRA 5B1JC 3AY2A 2UX6A 2BO0A 2BZ7A 1E65A 2ZOOA 3EHBB 5IY5B 1JVLA 3L45A 5LDUA 2AVFA 1AS7A 5B1JA 1AZCA 4NAJA 2NRDA 3BQVA 1ETJA 1UATA 3QJTB 3QJUB 3CDZA
chains in the Genus database with same CATH superfamily
3BAKA 3GTNA 2HX8A 1PPIA 4JNXA 1DCLA 1PNCA 4IU3A 2NTFB 3RUGA 1SHXA 1Y6MR 2OCCB 2J25A 2DS4A 3NDZE 5EA0H 4TNWF 1NC2D 4P2YA 4BZ1L 1Z3GL 4YBQC 3R7RA 2XACC 4YSCA 2YPKA 2AXFB 3M8OL 3DVIA 4WW2F 2R2CA 5SWZE 1I3UA 2EIKB 4GSQA 3AXLB 2Z1PA 1A1OB 2YPVA 4PRPD 3VYOA 1QWHA 5AB9A 1OTSD 2G2PA 5E2WL 5IR1B 2Z31B 3E3QE 2J12B 5JYLA 1IGFH 1OGSA 1QBLH 2X6UA 4H25A 4HEMA 3GMRB 3UTTA 4KTEH 2Y2WA 2Q9OA 4LNRA 4U1IB 3RVXC 4BEIA 3H53A 1XSOA 2Y2YA 4JZOB 2APFA 2EDHA 1XF4A 2LR4A 1VPOH 3ZDYB 2AQTA 5KJRH 1SYVB 1R33A 1RZ7L 3V2AR 1BLNB 2GBTA 3OTTA 5DJDB 2YRPA 4Y5XA 5E2TL 5EUKA 1CLVA 5CFAA 2BHYA 3K71B 4JHZA 4GBXB 4LOUD 5I82A 5JO5A 2K45A 4OZ4B 3SHSA 3UZQA 2MQCA 3E3QC 1NBZB 2EZ0C 2Y5QA 2FL5B 3IDJB 1TQBB 4N8VG 2Y0SA 2WUBH 1QSEA 4BQ6A 3F8UB 3I2CH 4M1CC 5ITFB 4UTBA 5C0AE 1J1XH 2VRKA 3MNVA 5K1VA 3DIDA 3ZKXC 3EHBD 4YR6B 3SOBL 3LZLA 1CK0H 4R7LA 3FSOA 4GKLA 3VFPA 5LG1A 3T1WA 4M3JA 4L3EA 1NAMA 2GTWB 2YD7A 4J3SA 1UVQB 3IE4A 2Q76A 4GP5B 2DDQH 3ECBA 4MD0A 3CFKB 4MNGB 5EU5A 2B15A 4OM0L 4WFEE 1U8JA 1UWYA 2YXFA 3FKUS 4DH2A 1JZ2A 1CFMA 2DEWX 1JRHH 2Y7SA 2BMKB 2C4FT 3K6DA 4JW3A 3O4LB 4GW4B 3ZVVA 3OMNB 3X1GA 5LN8A 3MV8A 5D7HA 3RURA 1KCVH 5HHPA 3UBXG 2R69A 4X5QA 2HLFC 5IB5B 2DICA 3V0VA 1UXSB 4DN4H 4HT1L 2Q8BL 1YC7A 2XWBA 1Q4NX 5CEZD 1X5ZA 4GQRA 4A66A 1N7ML 4JHWH 4WSJA 5I75B 4HW6A 2OR8A 1YYLH 3HMXH 3HZMA 4WU5B 1GZQB 1A6PA 3U6RB 1G6RH 1BWWA 2GVYA 2FHCA 4HKZA 4BHUI 4PJAE 4D8PB 5CD5C 1T89C 5F71A 3D2UA 3I9AA 1DBKL 5C71A 3OMZA 2BOLA 1NGWA 1D5IH 4YXHH 3MZTA 3LZFH 4XO3A 4GXFA 3MRJA 5DD6B 3VX0A 1YUHA 2AV1B 1CD8A 2W59A 1A2YB 2NUTA 2X4RB 3H7BB 2WP3O 1KNOB 4PH8A 1KJVB 2D3VA 3LS4H 4NKMB 1SDDA 2CBMA 2GW5A 1ZJBA 2BRRH 1KJ3H 4RMQA 3UTOA 3AAZB 4HK3N 2XWDA 3B7UX 2P28B 3HC4L 1TSRA 5GRJH 1JZ4A 3ULSA 1N9PA 5JDSB 1DBBH 1RUQL 2E6QA 1X3DA 3CGTA 3K4DA 4KTDL 4M8QB 4F9PA 1BMZA 5EUOB 2Y7NA 1XH3A 2A5UA 1K8IA 4QOKB 3QYCA 4HXAL 4L1DA 4K5OA 4HALA 3E6FA 3L5WA 3DX7B 1SPDA 4QHMB 1BXVA 3NIFB 5F3HB 3S7GA 5IHWA 2PCYA 5GRXG 3SDCA 4AH2A 2IG2L 3FU0A 3DHPA 4RBPK 1FG9C 4FL4C 5LGHL 3KPSA 2AJUL 2Z93A 4XMPL 1L0QA 1BPVA 1RK0A 1N0LB 4PBWD 1NCJA 5EU6E 4RNRA 1RK1A 4Z7IA 1CE6A 4UI2A 1M1XA 4Y1SA 3FT9A 1UJ3B 2CXKA 2BNQA 2JTDA 3U83A 5C07D 5K1NA 4OKDA 2ZXCA 3BCFA 2Z7YA 4KH9A 4WI0B 5JR1L 1N5YL 3D18B 5EZJB 5F72S 1I1AD 3JWNC 2VE6B 4IEFA 4PS7A 5CN3A 3HRZC 2HX9A 1SHWA 2P3YA 3HLAB 2SEBB 4HEPA 2J8UE 4CADB 4FFZL 5CCKH 5JPNC 5GSVA 3NZHH 2V6HA 2Z35A 3MA7B 5CZKA 3TF4A 3FUKA 4PJ5B 3VXUE 2YEVB 3QJVB 3RILA 3MRMA 4UQ9A 2FLMA 2AV7B 3KPQA 3WSQH 4A7UA 1K8DA 4X6BA 1B2WH 2DIAA 2XWJA 1NUNB 2EXSA 1F6AB 1HSBA 4LSRH 3O41B 3WIFB 1ZLWK 4ZAKB 1YEDB 3R0MA 3X11A 3WNNA 3Q6GH 5CS7A 3BAXA 4IMKC 5GS1B 3VFOB 1OOAA 4NM8H 5DRXB 4YBLC 3CDZB 1RZFL 3FHQA 5J13B 4IJTA 1NICA 2BSEA 2WKOF 3OD3A 1PL3A 3L5JA 1QHOA 2JJTC 1OSPH 3G6JE 3QJFB 2DQJH 3P0GB 4L1TA 2HT2C 4AIZB 2R15A 3H9HB 2GJ6D 4JFZL 4PRHD 1JNLH 5GZNC 4HCRL 3UZVB 4NP9A 5I8CA 3UERA 5I5RA 5JOFA 1MAJA 4N8CL 4AQEA 1QPXA 3V4VB 5E08L 1J12A 3QARA 3VQ1C 4FNLL 5MENE 1E5BA 2DF3A 4YO0B 1GC1H 1Z7JA 3K8LA 2XBZA 4K9JA 3NFSL 2WY3B 3MU3A 3VWJD 5I2IA 3KVPA 1M53A 3HFMH 3ARFB 2V4LA 4TNGA 4XNUL 4HKXA 3SDXA 1JCVA 1TQVA 2J6EL 3GJFA 5CJOH 1BYNA 5EO1A 2X89A 1H3TA 3OKDB 2ZCKH 3DX8A 4FTVA 2YO3A 4IOIA 4ICXA 2NNRA 3T08A 2YXVA 3QVAA 4B9CA 3AS3A 1WG3A 3DXAA 2W07A 4H5SA 4K8RD 3G5ZA 4ISVA 2W60B 5J6GB 3SY0B 1MELA 3KLHD 4HWZA 4XNYH 3TJHD 3T0EA 1TJHL 5C92A 5CWSA 2CUAA 5C0DB 1A14H 2KMWA 2ZWYA 5L4FA 4LSUH 4HOXA 4RMSA 4GT0A 4XXWC 2Z9TA 3I6GA 1U8NA 2XRAH 1Z5HA 4W6YB 5CM1A 3OXRA 3EXJA 4RA3A 2AK1L 3WEMA 2A83B 3Q2LA 4HIQA 2EEFA 4Y4HA 2G0LA 2X6CA 4CUCA 2CM5A 3ZR5A 3EDKA 1F8TH 4EI6B 3QJXA 2KC0A 3MFGB 1NPUA 4JRYA 2W65A 4LDEB 4W9KC 4LO9A 1V05A 2YSSB 3V4UH 4NDMA 3VWKA 4YBQD 2O1AA 2Z91B 3LKPB 3WJJC 3HZKA 4Q7DA 2WTOA 4F8QA 5IJVA 3DMMC 1JVOA 2PABA 2LTQC 2NXYB 1A6ZA 1RIHH 3GSNL 4HCGA 4O2EB 2BSTA 4U7SA 3N5AA 4XPFH 5DJCB 4KV5F 3VFVA 1P69B 4K9EL 1NLDL 3H56A 4FQXD 4L4TE 4ZS7H 3C8HA 1B0RA 2J1XA 4WW2C 1I1FA 1OWWA 4FHJA 3N2JA 3D3VA 1RZQA 1OM3H 4YXKL 1S9VA 3WFDL 4W9FC 4XTRC 5KVFL 2IMMA 3QFDB 4M00A 2X9WA 5FYKL 1DBML 3W0WA 2BP3A 4GAYB 5SWZD 1LO2H 3RE0A 5AVZB 3ZHDA 4OF8A 4L0YA 4KJWC 3RU8H 3RA7H 4HXBH 4U0QB 4EI5A 3TN0A 3ARZA 1XD0A 2EZ0D 4NQQA 2X2YA 3VB8A 2MTAA 1AGEA 3RVVC 4M1CD 1SMOA 3EYFA 2CO3A 4R26L 4U6HA 3DRTA 5I19H 5F1IA 2X2IA 4F1ZA 3QH3B 1A6VH 1LE9A 5T5FH 5ACZA 1I85A 4WTZG 4H0HB 3U1PA 1FQ9C 2OR9H 3KCWA 4I3SL 4Z7VA 3PDOB 1TQUA 2WC7A 3GRWA 3IETA 2ZD0A 3TA3B 2HT3C 4HIPA 3QZMA 4ACTA 1UCBH 2WLMA 2J55A 2MKWA 3MTXA 4OJFL 1A7RL 4W9EC 5C0EB 1JZDC 3AUWB 1BFOA 2YAEA 3O6LH 1FZKB 1A7PH 4YHNB 2E3VA 5CLTA 3F12A 1I9RL 4QNPF 4L4JA 3V9FA 5C0AD 1KZQA 4W9IC 3EKCA 3MLZH 3CZNA 4OD3L 1TCRA 2HLFD 1KJ2B 5I1DB 4BSVB 3FQWB 4NUJA 1UACH 3GRBA 4NRZB 4P2RA 2CK0L 1DL7H 3MV9E 1PQZB 4GLRI 4WFED 5FA4B 1LHZA 4X98B 5IVXA 1NBYB 1Y18B 2FX9H 3VU2A 4UV4H 4Z0BH 1BFTA 2ATKB 3HBQA 5CD5D 2D3NA 3CHPA 2H2SC 3NQIA 4HC1L 2HG5A 3GBNH 2W9EH 2F61A 1KPUA 1AQDA 5E4EC 5I8KH 1MLBB 4PV9B 3GI8L 1UWXH 3KJ6H 3PDGA 1LWRA 3DSNB 4U1LB 4FFTA 4I13B 1CGVA 3SDYH 8FABA 3LKSA 1F97A 5I6PA 5INCA 3ULAB 5I16A 2IH1A 3KDMB 1YCSA 5E6SB 4JRXA 5IJBC 1W8OA 1PLCA 1T7VA 4EXKA 4OZFA 3VFSA 3BEVB 2RFXB 2VXUL 4NCC2 4FQ2H 3ZIYA 3DVGA 5IROA 3U7WL 1C12B 1IGTB 1JG9A 4FLSA 2R0WH 4PVLA 3HZYA 4UT9H 3TFKC 3UADA 1U0QA 1T22A 1OSEA 2AQPA 4QXUH 1ZGLP 3L1GA 5HGBA 4PWEA 2BOCA 4HUWA 4O51A 2CLVB 2VDRL 3C08H 2MPAL 4X5WA 1ZLSL 3N85H 2FQFA 4L29A 1D5BB 1N18A 2WLNA 35C8L 4AYDC 1DEEB 1QNZH 3MACH 1NCIA 4RGMB 4WFFE 4DQOH 2ED6A 4YC2B 4XP6H 1EFXD 1FP5A 3BLBA 3NCJH 5FCUH 3BZEA 1FRGH 3WAKA 2UXVA 1U2CA 4ODWA 5LB1A 1OD9A 2WXHA 5A2FA 2WXGA 3ZL4H 5KG9A 3F58H 1CGWA 3QUZD 4S10A 2VR5A 4YLCA 4NHCH 4NT6B 5IY5B 1BJ8A 4HWBL 4BV1A 1AS7A 1SEQH 1AQMA 4M61A 4NAJA 5JHDE 3T3MB 2E7MA 4HPYL 4W81A 1QLRA 3CBRA 4WNSA 1MJ7H 2PO6B 3Q2CA 4P05A 1CWVA 3HCVA 4UU9A 5EU6D 3VI3F 3QFJE 3KGSA 1ZVHA 2P8MB 4O9HL 4XP5H 3BUIA 3IFOB 5AKVA 1FF5A 2AZAA 1G7QB 2HUEA 3FRUB 3H0TA 1RZGB 5T1MB 4XP9H 3QHZH 2ZKMX 2EICA 1H19A 1A4BA 4L2YA 4Y0GA 3ISYA 4FZ8L 1BVNP 4WTZA 1QABA 5AB1A 3T2LA 4YAQB 2ZOUA 4XAKE 1ZHKB 2NW2A 2ZCLH 4ZYKA 3L48A 3V7MA 4UTAA 3VXUD 2HT2D 1CI5A 4S1QH 2V33A 3PHQA 5GZND 2RHEA 2F7RA 3KNBA 1MCWW 1BOYA 3DIFB 4MLIA 4ZXBD 4LLYB 3RKDC 1WC7B 4XOEA 2YEZB 4GG8A 2H32H 5I0XA 2Y69B 4I87A 2PCPB 1QBLL 3SKMB 2ERJC 4JHBA 5F88A 1OK8A 3L9EA 4TVUA 2HJKA 1WS7A 2VDLB 3IJHA 1GMEA 1NDGB 1A9VA 1G43A 3DUSA 1VPOL 2DQ6A 5KJRL 3OF6D 4UM8B 4P9ML 4JS7A 1NFKA 2PW1A 3RI5F 1NWPA 1AO7A 1EZVX 3QEUB 1RUMH 3V6OA 4HGWB 4M7ZB 1YMHA 2JJVA 2W88A 3F84A 3QW9A 2R2BA 4QRPA 2PYFA 5MEND 2WUBL 4H2CA 3B2XA 3I2CL 2XHNA 2E47A 5EF1A 3EFFB 5A2LH 1ZGLB 1S4IA 4Z77B 2B3IA 3CSFA 4QTHA 2C3VA 5E51A 5CLXA 2XN9A 3MBWB 4NPYA 4NQXB 2K6WA 3FFDB 3P30L 1WFTA 4YHIB 3KM1A 4N2NA 3Q5TA 3NCMA 5HYSA 2KPNA 2YR3A 4DFIA 2DMKA 4NQDA 2DDQL 4N2AA 5J56B 4Q74A 4LVNB 1C16A 5C08B 2JTYA 5FKPB 1EQWA 5FKAB 3IGLA 4ATWA 3ZHKA 2AXHA 1JNNH 4PMEA 1E43A 1JRHL 4C58B 3BH8A 2OI9C 3TV3H 2WO2B 5EZIH 4DP2X 1IQDB 3HBZA 1P7HL 5GSRA 2NLJA 1KCVL 3SGEI 4XCNA 3CZKA 5DYFA 3PHOA 1TEYA 2BY0A 4JDVA 4DN4L 5FS5A 1ZA6A 3CIAA 3P54A 3QEGH 1JHLL 1KEMH 1SMDA 4G2AA 4KV5E 2ZXQA 5PAZA 2CMRH 2J4WH 1YYLL 3HMXL 4A6YA 1MCBA 1KLUB 4YHYC 1F2XK 3SYPA 1G6RL 1B88A 1DQJA 1LK3H 3PNWA 1D9KB 2VISB 3JUYA 4YDVB 3RTQD 5LNDA 4ZUTA 3RL1A 1NCAH 1F3JB 4XN1A 1XIWC 2NX5E 1D5IL 4FAAB 3H54A 1NGXB 2VLKA 4YXHL 3UO1L 2R4SH 4EUPB 4M8UA 1A6AA 2NNXA 4G71B 4H8HA 3TO4B 3SPCA 3MRFA 4DK6A 4BKSC 4XTRD 1UCTA 4MXQC 4Y2DC 3HE6D 1BF8A 3GIVB 4K7PH 5CU5A 2VL5B 4GG6A 4H2AA 2E9GA 2F0CA 4KQ4L 5ADOH 2BRRL 1E4XH 1KJ3L 4BH8B 2C1OA 5I18H 1FNGA 3OQ3B 2O5YH 5HD8C 3QQ3A 1ZEAH 4L4TD 1FNEB 5BQ7A 1VA9A 3SD2A 1DBBL 5IOKA 5JW3L 5ILTH 3BFWA 5IFHH 2DJMA 3KPTA 2P7TA 1IBYA 3DECA 3QWOB 5T1KD 3K2IA 2Y4SA 3HNTH 2XV3A 5I15H 5H4ZA 3VH8B 4M6AA 2UX7A 2V0AA 1JHTB 2HFFA 3L3IB 3V0HA 4XMXA 4C4KO 4QNPE 2HT3D 5JUEH 4OLYL 1FIEA 2EECA 3IAPA 4F27A 1EO7A 3NJGA 2ZF9A 4IGBA 1JPTH 2JKNA 5F7FA 1PTZA 4LLWA 1KMGA 4IBLT 1EZSA 1TJIH 1EJFA 3FO9B 4G5AA 3T0DA 1AXSB 1EAPB 1DSFL 2AJ3B 2AK4B 3GJFK 1FL3B 2YIHA 1FHNA 3UG5A 4CJ1A 1LM8V 5EO0B 3UEQA 2ARJB 4LLUB 4I18A 1W6LA 3VXME 1OGAE 3OG6B 1NKGA 1ZS8B 3D7PA 5CBEA 3WTSA 5HDRA 5CCKL 3NZHL 5SX4H 1G1YA 4LU5H 3FAXA 4L3AA 4QJ5B 1I8KA 2H2SD 3WSQL 3ZDZF 1B2WL 3ATAA 5AZ2H 4B27A 4UOW1 2OYKA 3G6DH 1JF1B 2FJUB 4MAYA 4O2FB 4W9GC 4XVJL 5ANHA 4B9YA 2YUWA 5JIQA 3LRMA 4U1SA 3TO2A 1II4E 3Q6GL 3OKMA 2W38A 1GL4B 4IW4C 2NQDA 4NM8L 3B37A 1SXAA 3L4YA 4QI3A 3MV9D 5DVLA 2GAZB 1PNDA 4PRBB 3DV4B 2FBJH 1TXKA 4PREB 4GT7A 3ZJAA 1OSPL 4H1LB 1J9SA 1TO4A 3BPNB 2A6KA 3PQYA 4MMXC 3LMJH 1NDTA 2EIBA 2XVBA 3EZ8A 1UADC 3CC5B 1MW1A 1YJDH 5GGVL 3CSYA 3KL3A 3VFNA 4EDXA 2IWKA 4MA3A 4CDHA 5CCJA 3FT0A 3IDYC 4ZSOB 1GC1L 4YSRA 1VF5C 1L7IH 2FQGA 1CVSC 4UBDC 5HGGS 2P8LB 2X9ZA 4AV0A 3NP4A 2TSBA 3QSKB 5DC2A 1K4DA 2QBWA 3HFML 3N3EA 1PW3A 1P5UB 3HE7A 4AGOA 2GSGA 4N6RB 1IBFA 3OPZH 1TZAA 5DK2B 4HA1A 4H8VA 1LMIA 4F7PA 5DQ9A 5DWUH 4PLKD 1QA9A 3BSZH 4HUMB 3O0LA 1E2VA 1M71A 4JL2A 1M9WA 3TEYA 2WXQA 3B3IB 3O8XB 5DWPA 4P2OC 4S2SB 1DUYB 1N4XH 4M7JL 2NTFA 2Y7MA 4G8IB 1BHGA 5D4JA 4DF9A 4R90H 3VI3E 1GCYA 1AFVH 3ARGC 1GW6A 1KTLB 4TQEH 2AXFA 1IEBB 1A14L 3AXLA 1ZCRA 3AACA 2ZWNA 4WFFD 5IR1A 1GGIH 4EKJA 1UXWA 2Z31A 4YL9A 1U95B 3ILQC 4Z7QF 2XRAL 1T04B 4XB3A 3GMRA 1JK8B 2VZUA 2LLNA 2DPKA 1C08A 4U1IA 43C9B 4JZOA 1AZUA 4G6FD 1MH5A 2XVKA 1F8TL 1IC7H 1SYVA 4IQHA 5JHDD 1BLNA 5DJDA 3VXRB 5IW6B 1YPZB 3BP4B 3K71A 1RZKH 2CKBB 2Y36L 3DX3A 3S5YA 4OZ4A 4UDTB 3O6ML 2OM5A 2R2HB 4ZT1A 3RGVC 1NBZA 3EJJX 3QFJD 2FL5A 3WY4A 3IDJA 4WFGE 1DVFB 2J5LC 1W91A 4YOKA 3TH4T 4FFVC 1S7XB 3RKDD 5HDBF 3JTBA 1RIHL 3S5LA 3QJQB 4AGMA 1VENA 4IHOB 1NUDA 3N40F 4AQOA 3AWFA 1L6PA 2HFTA 3ECQA 1YNLL 3ARDB 2WQVA 1OM3L 4XAKD 5JW4Q 3CFKA 3AFLA 1LO2L 2WNGA 2W0PA 5L6YH 3T0BA 3U4BL 1WBZB 3VMOA 3RU8L 3RA7L 2XPYA 4HXBL 2BMKA 4X42A 4DSYA 5IMKB 3O4LA 4GW4A 4NRXB 3OAUL 5JHAA 5IQ9B 1JTTA 2Y5EA 5BO1H 1NMCC 2ZOKB 4Q9QH 1AOZA 2IFFH 1D7CA 4PGJA 2A4EA 4FQ1H 1BOGB 2XYCA 5F9WB 5I19L 1UXSA 3QO0B 4NZDA 2GBVA 3CAFA 5T5FL 4GUOA 5E6UB 2YD4A 3HR5A 3K46A 4YDJB 3EYQC 4NZ8A 5CINH 2FB4L 1JJUA 5GGTH 1BDYA 1FZMB 3NA9L 1M7IB 1SBBA 1GZQA 4XPAH 1JYNA 1UCBL 3FT3B 5IW3A 5E9DE 1OWRM 5AOMA 3O6LL 1HZHH 2X4UB 4J3OH 1BMGA 2ZT9C 4JDTH 3DUUB 4OUOA 5DD6A 2AV1A 4AMWA 3JWOC 4Z9KB 2Y07L 3MLZL 3ZZLA 2X4RA 3H7BA 1QKZL 1KNOA 4J4PA 4P2QD 3K6FA 1KJVA 1TMCB 3RWHB 3DVNB 4CSTA 4UM9D 2DYPB 3BPLC 3P77B 1UACL 4NKMA 4ADIA 1FSKB 1DL7L 1M7DB 4IMLB 3AAZA 1ZA3B 5IF0B 5SWSE 4FMKA 3NAAL 4BK4A 4L8SC 1RXLA 2FX9L 4RMVA 5C3TA 4UV4L 4Z0BL 4AL8C 4YXLL 5JDSA 2EADA 2XTLA 2RALA 3S48A 3MO1A 4LDCA 4NQSB 5J89A 5EUOA 2AQ1A 2FYYB 4QOKA 3K81A 1IL1B 5I8KL 4B50A 3NMEA 2V2TB 4YZFF 1XF5B 4PB0L 3PGCB 4QHMA 2PF6A 5F3HA 1OZTG 5JORA 4H8QA 3LD8B 2X5PA 1CDHA 1N2RB 3QORB 2XQYA 4LP4A 4Y2DD 3SDYL 5C8JB 2WGXA 1IC5H 2PCFA 3SDDC 1G7MB 3GHBH 4DEPC 4NUPA 4Y4FB 2JH2A 5HPMA 1WIPA 1N0LA 4DP6X 4LAQH 2OMNA 4FG6C 4FQ2L 3U2SA 5HD8D 5A16B 2G2NA 5KBMA 2NX5D 3T71A 4M29A 2E27H 3KPMB 2QVMA 2VLJE 4Y4KC 1F4WH 4L9LC 2R0WL 2JV6A 1S5HB 4M6OH 4PJ9B 4F8NA 4UT9L 3D18A 5EZJA 2YRBA 3LPPA 5FYLE 1WFMA 2MHAB 2Z7ZA 4QXUL 4YSSA 3RUGE 3HLAA 2SEBA 4CADA 3C08L 4I0PB 1WAAA 1RJLB 3MA7A 1QFWI 2ZJSH 5E8OB 2X41A 4PJ5A 3N85L 4A7TA 3Q8FA 4KRLB 4PCSA 4CL7A 3LN5B 2KZ1B 3JQOB 2WBWB 1RVFH 2AV7A 3OB0K 1QNZL 3MACL 2HT4D 3IXTB 3LIZH 4DQOL 1F6AA 3O41A 4XP6L 1E65A 5FCUL 3NCJL 4ZAKA 1FRGL 3MLTB 2FD6H 2ZXDA 5ALCL 4KAQL 2CHZA 4HEME 5EU3B 3VFOA 1MCPL 3BRFA 2QLYA 5DRXA 1KGJA 1M2OA 3CDZA 4OFDA 5IHLB 2FK9A 1VGKB 3S0PA 5AVUB 4QUOA 4NHCL 1R4XA 3QJFA 1SEQL 2Q7YB 4M1GH 2WQAA 1UH4A 3H9HA 3ZDZE 3UZVA 1MJ7L 1M6OB 1PD0A 2KLTA 3N04A 3RY4A 3V4VA 3IMBA 4IBWA 4NUMA 4X8GA 4YX2H 1RP9A 3ZE0B 4XP5L 4ABUA 4ADGA 4M9PA 4XP9L 1WAPA 3QHZL 25C8H 4LVHB 2P1YA 3DURB 2QTEA 2YQ2A 5GGQH 5C7XH 1DCEA 5D93B 5DFWH 3VXMD 4L3EE 5ICUA 4J2QA 3LZRA 4PMFA 4MGXA 2ZCLL 5C0CB 5D6CA 4PBVC 4S1QL 3SCMC 5CEZH 3QXVA 4UCFA 4Z7VF 1G9MH 4UQDA 5TTRA 4HFUH 1E9PB 1Y6NR 3O2DA 3FHEA 1SHSA 5KVEH 3OVUB 3RFZB 3ESNA 2X0WA 3ZGHA 2UUDH 3MKGA 4H88H 5E99L 1QBBA 4RAVB 5J6GA 1MJUH 3SY0A 3KWWB 2HLEB 5ICXB 4S11A 2YGQA 4HK0B 4XOBA 5C0DA 3ULVL 3GHEH 4ANWA 5B38G 2BRQA 4E36A 2PYEB 4KROB 4KXDA 1D6EB 1CLYH 1HKLH 2RB8A 2XX1A 2WB1A 1QFOA 3GXFA 1LDSA 1CR9H 4ZUWB 4NPKA 3BXNB 1RUML 3IBOA 5ICZA 3WBDA 5JQHC 3QC6X 4MZRA 2DEXX 4JLRB 1MCOH 1DVSA 1FE8H 4EI6A 2JKRM 3VSQA 4N2EA 2YSSA 4Z7QE 2YUVA 4GUPB 2Z91A 4KZCA 3LKPA 3TZVB 2VJ8A 3JWDC 3VUAA 3ROLB 5IBLD 1DBAL 4AM0B 4YK4B 1CD9B 3PFUA 1IGIH 3C2SA 3ILQD 3H6AA 1JHKH 4O2CB 5DJCA 1BWMA 2OMBA 4XC3H 1JNNL 4IHBA 3TBWB 4GSDL 2KHAA 4UF7C 3TV3L 5EZIL 3UXFA 3DO3A 3KGUA 3MCKB 3LXCA 4MYWB 2OP4H 4KJQC 4JANB 2FATH 3ARTA 5DXWA 4K7FB 3RTLA 3O3UN 3QFDA 4R96B 2JCWA 2HVJB 4GAYA 1QQDA 4OUUB 4DOHB 1Z0NA 5HDBE 3ZKQD 5CP3A 1E4JA 3IF1B 3KYKH 3Q0HA 4PJDF 3QEGL 2JMRA 1BVZA 1HEZB 2CMRL 4G7VL 2J4WL 3RGVD 1QOKA 3IGAB 1EHNA 4MLSA 1TTCA 2ZX6A 4FFVD 3CVHH 1FC1A 1LK3L 3UG4A 3V0WH 1A5FH 3US9A 4GQZA 2BOBA 4XAWH 1NCAL 1LO3H 4F9PC 2BNQE 3CV5A 1FG2A 1HJCA 2R4SL 5F7YC 1DO5A 3X13B 5I6OA 4L8CB 3PDOA 3T6QC 1JZGA 1QZNA 1UFUA 3UOAB 1ADWA 7PAZA 3KAAA 4RFOH 3TESA 4B7LA 4UZUA 5C0EA 3DBSA 3MNWB 4X7CC 5TF1H 1OTTC 4WFGD 3P1VA 1FZKA 5GHWH 5ADOL 3NFPB 3KL5A 1E4XL 3CG8A 4OFVA 2XV6B 4P9HC 2YMOA 3CN3A 3EG9A 5AZUA 3WFZA 3ZTCC 4E5XB 5I18L 4AX3A 3GTVA 5EO9A 3CQQA 1ZEAL 1S9XB 3D6GA 4KPHH 5IIEB 5ILTL 5G55A 1KJ2A 1S9WA 5DHEA 5I1DA 1FNAA 3EO1B 5I15L 2B4CC 3HNTL 4PJ8C 4GS7C 4NRZA 4IS6B 2YQ3A 1KCUH 4ELKB 2A0LD 2Y5TB 2J88H 1EJ6A 3EYQD 1PQZA 4ZW3A 2WM0A 3L7FB 5D96B 1NIAA 4X98A 1LP9F 1NBYA 5B1BB 1Y18A 1JSYA 3MLRH 5JUEL 4KO7A 1UOWA 3MJ7B 5E8EB 3TBCA 2NY3C 2ATKA 4FQCL 4N2IA 3ZLQC 1JPTL 3S2CA 1UM4H 1W8EA 3C09B 1R5VB 4J27A 4JJHA 1KPVB 4F37F 1SVZA 5E6IB 1MLBA 1TJIL 4PV9A 3B7RL 4U2YA 5DJ2B 5IQMA 2Y6SC 3UTQB 1IZKA 3AITA 4M7LT 2MH4A 4U1LA 1E27B 4MNQB 2EDRA 1BD2B 3KDMA 4L5FE 1V27A 2OXHB 3GS0A 4EZKA 4PPTA 2DAVA 3CFCH 4K8RH 5CEXB 3N0AA 3BEVA 4O02B 3ZOAA 2RFXA 3WTTA 4PJ7B 1C12A 1E7UA 1V3MA 4YZFE 4H26B 2P43B 5D2LF 4FQHB 2VDNL 1ZLVK 1FVCB 3RZWA 1WA0X 4FTVE 4CAGA 4ZFGL 4E9XA 3GSVB 2B08A 3UIYA 3S9DB 2JB6B 3NPSB 3DXAE 4Y7MA 3HBPA 2ZE0A 3EJZC 1Z0MA 3SGJC 4PRIB 4UAOC 3FQRB 3U2IA 3UTSD 4HDIA 5SWSD 1ZANH 2H1PL 5DSCB 4HD9A 1DEEA 4H13C 3HFFA 3BZFA 3ILPB 4DP5X 5J4MA 4IJ3B 2OXGB 1WZLA 1NCBH 5CF3A 5KJ7E 2EH8H 3BQUB 4FG6D 2APXA 3LMJL 5F9DC 3PWPB 1YJDL 2I60L 4L1BA 1SMAA 1O7SA 3FQ2A 1BQLH 3DJZA 5FGRA 4Q9RH 3QPQC 3O3DB 2OS7A 2VH5H 2R0ZH 2CIKB 1LDPH 1L7IL 2WPGA 4FKKA 2ZXGA 3GXIA 3T0EC 3WUWG 2CR3A 3IM1A 3CLEH 3ALWA 5E6YA 5L4MA 3HIZA 4CN4A 5HHME 1V7NL 5CZRA 2PO6A 5ABAA 3TVMB 3S35L 3TIDB 2HTKC 3OPZL 1ZMYA 4NIKB 4RFNC 4FNTA 5DWUL 3IFOA 4M56A 1JF6A 2OMWB 3FRPB 2VLJD 1G7QA 2WYHA 3FRUA 3QEQB 1RZGA 1SXSA 2PCXA 5F7MC 4AITA 5FO8B 4Y2OB 3GI9H 3GXNA 1KULA 4JEGB 1N4XL 5FYLD 1R0AL 5EC1B 4FI7A 2QGCA 2DLFH 4YAQA 4ZMPA 4Z7UF 1Z2KA 1ZHKA 1AFVL 2Z0BA 5LBSA 1MQKH 3VWKC 4TQEL 4CU7A 2OMTB 2EABA 4KX9A 4A67A 4BSWB 1M6UA 3DIFA 3QIWB 4Y8AA 4LLYA 2OCJA 4KNQA 3DJ9A 5I76A 1WC7A 4B5EA 2YEZA 2EP6A 5KYNA 4M9OA 2PCPA 3F05A 2WCGA 3SKMA 4GG6F 5F7EH 4GKNB 3IGKA 3VG9C 4OCXH 4UB0L 3P3TA 1MCNA 4GB9A 4MJIB 5ESAB 4Z7VE 1IC7L 3G04B 3PY9A 1GJIA 3FNKA 5KYXB 2CKNA 5ADPL 1CC3A 3GK8H 2PUQT 3SKUD 3QEUA 3R1GH 3SCMD 3TN0C 5DVNA 1ECYA 2VWEE 3CX2A 3EO9L 3A4FA 5DJXB 3J07A 1HCYA 3WXVL 1R5WB 3L08A 3EFOB 1NGYB 2FEEI 4P5KB 2XWTB 2JB5L 3UCQA 4A38A 4NUGH 5EWIH 1ZGLA 2OSLB 4Z77A 3S3JA 4GFXA 2DWEA 3ZGIA 2D9CA 1MQ8A 1I85C 5DD3H 3UH8A 1CB4A 2OSYA 3MBWA 1ZE3C 1ASPA 3FFDA 4QRUB 4L3ED 3ZMEA 4YHIA 4OZHB 5DJZB 1EHKB 2AXJA 2JKJA 1KCSH 5C08A 5FKAA 1CICD 1CLZH 2LQRA 2VWEC 1ZLUK 5L6YL 3OJVC 3RIFF 4ONGH 3AT0A 4FFYH 2XQYK 2QVFB 2DQTH 1OD7A 1WBXB 1IQDA 4F33B 5BO1L 5IK3B 4Q9QL 3RWFA 2IFFL 4TSBH 3MJ8A 4QWWC 4FQ1L 1YY8B 2IH9A 3O3BB 1N59B 3BSGA 3BISA 3IPBA 3FU9A 3VGEA 4IRZA 4ZMVA 5DZ9A 4AGPA 3RPBA 3IS0X 1CFNB 1VJSA 5GGTL 4FQIH 5CINL 5EOQH 2CCVA 3QP3A 4O00A 4JRXE 1DJHA 1S3KH 2Y7LA 3BIAX 4XCCH 4XPAL 2WLZA 1D9KA 2VISA 2EDXA 4YDVA 1OP5K 3NJMA 1QEWB 4C59B 2O26U 1TZOA 1F3JA 2PR4H 3EJTA 3IMSA 4JDTL 3GIZH 4FTDA 2MWCA 2LVCA 1NGXA 3UYRH 4EUPA 1JUFB 1WRFA 3NESA 2OJ1A 5I1HH 2FSEA 5FGCE 3TO4A 4PJDE 4UMSA 3WLWD 2GBAA 2OW6A 1UH2A 5KJ4A 4BGLA 1SY6A 1BBJB 4L8BB 5DCCA 5EV7A 1AHWC 2VL5A 1J1OH 5I8EA 4HHGA 4BH8A 1QBMH 5FUCE 2EDBA 4OQTA 4W9JC 4WGWB 4AGNA 4R97B 1K72A 1JGVH 3EW3B 3D39B 3MJ9A 4KRMB 2F9BT 4M03A 3WAJA 5IROC 1GY1A 3T8XB 4NZFA 1AE6H 5GS3A 5AAWA 1EVTC 3S34H 1SN0A 4NO5A 3S3DB 5FLUA 3QWOA 3AXHA 5BXFB 1GHFH 5DHVB 3ARVA 2R56H 2APVA 4N9OB 1VAHA 1PG7W 4KTGA 1JHTA 3L3IA 4XVSH 5BV7B 1S2EA 1Y07A 1EZLA 4A55A 3FO0H 4XHQA 2IC2A 3POCA 5FUCC 1IC5L 4XNDA 3QHTC 1PLGH 1I4FB 2OMYB 1F42A 3NZ8B 1OTTD 4WRLA 1WEJH 1CYGA 3FW6A 2CWRA 2FJSA 4LAQL 3FO9A 3N41B 2CR0A 4M5SA 1AXSA 1EAPA 2BNQD 5IJKA 2AK4A 3QDJB 2D7NA 1FL3A 2E27L 2Y3AA 5AW1B 1NCCH 1F4WL 1LP9E 4M6OL 5EO0A 2E7LA 2KZKA 4PIRF 4U6XB 2ARJA 4LLUA 4PJ8D 3ZTDC 3B2DC 2OK0H 1IEHA 5D4QA 1SVBA 2I69A 2BVOA 1S7VB 1ZS8A 3IDUA 1UA3A 3BYTA 2P5EE 4M02A 4D94A 2ZJSL 2YKKA 2NY3D 3RAJH 3STLB 3ZDYF 3OSVA 1RVFL 5DYOB 3EIFA 3FU6A 2JJSA 3LIZL 1QX1A 1JF1A 5FX3A 4O2FA 1MFVA 3BP6B 5IT2H 3QNYB 2Y6SD 3QAZC 3E2HB 4PN6A 1BGXH 2GJRA 2OMXB 3NRQA 5D4HA 5BW7A 2GAZA 3UPCA 5BUGA 4PRBA 3DV4A 1BVNT 5AAMA 3NFNA 4PREA 5D2LE 4ZOBA 4JREC 4H1LA 3QUMH 2OA9A 1P4LB 1NM4A 2WLIA 4LRIA 2AQSA 3CC5A 1AO7E 5D1ZB 2NY2B 2QELA 3V6OE 4HIIA 1WGOA 1QRNE 4QRPE 4YX2L 4YBHA 4ZSOA 4ZTEA 3MLUL 2EJ1A 4FFWC 1IBGH 1RZJC 4MQTB 3NG5A 3UTZA 1V3LA 1JFHA 25C8L 2B59B 2P8LA 3Q2NA 3K1KC 3EJZD 3UCRA 4OB5H 4XT1C 3SE8H 5C7XL 2EDOA 1EGJL 2YAQA 3PV6B 4JDZA 4Z6AT 4U31A 2BSCA 2EE6A 1AP2B 3PWLB 1FFPB 4LOFA 2X89D 2XWZA 5HY9B 3V6OC 5AALA 3V6ZB 1UD2A 1IQWH 4HFUL 5FO7B 2DQDH 5EIVA 2J20A 4RESB 4S2SA 5KVEL 3OHXB 1H6UA 1DUYA 4MA8L 1WQVT 3UP1A 1L9RA 4PV1C 4YDZA 4G8IA 3QPQD 4H88L 1MJUL 1OE1A 1ZDSA 3FZUD 1KTLA 5G4MA 2CO2A 1IEBA 5EH1A 3ZQ9A 1RP8A 1BZ7B 1WT5C 2OW7A 1JMXA 5E8PB 1CLYL 4NKOA 4R2GC 1U95A 3NJIA 3MLPA 1IEAA 2RJMA 3RJOA 1T04A 1WIUA 3MX0B 3RFRA 3V5DA 4ZFFB 5BO0D 1J8SA 3NJXA 4JUSA 4PW9A 4Z7UE 2F74B 1RLBA 43C9A 4YFEA 3L3JB 4A2MA 4Y16C 8CGTA 2DKUA 2VLKE 5CSGA 3ABGA 1MCOL 4P07A 3VXRA 3C6SB 4LPXA 4AIXA 4XZ4A 1YPZA 2GUOA 3BP4A 4JO4H 4Y89A 3INUL 5HHMD 3VWKD 2F54A 4UDTA 3BVDB 3RL2B 3J7HA 2MPVA 2R2HA 4GG6E 3S37X 2KUTA 1AG0A 1DVFA 3NIFF 2WLHA 1NOFA 4I3GA 2ZF8A 2IALA 3GLAA 1IBDA 1IGIL 2F5BH 1JHKL 4AUYA 4IHOA 5I1CH 4Z7WB 2FTAA 4BWUA 1NC4B 4XC3L 5DLML 3E8UH 1Q9OB 1R3KB 4JFEB 2ZKWA 1I3GH 5FFLA 1S9KC 3VD4A 4OLXL 1QFWM 1YDPA 5F7UA 3NIDB 5K9KB 2OP4L 5I9QC 4RA0C 3ARDA 2I9TB 1GYAA 1S7UB 2FATL 5T1DH 2NY6D 4G9FD 4LGPB 1R46A 3S96B 2VITA 3IMWA 4WHTA 3RB7A 3KYKL 5F0MB 4G72B 3E0GA 2JWYA 4NRXA 3GLZA 5IQ9A 4YSAA 4OVUA 3LEVH 1CN4A 2ZOKA 3TL5A 2X88A 1F4YL 4MXVF 2IDQA 3V0WL 1A5FL 3H4FA 5E4OA 3FTZA 2X0VA 3E80A 1BOGA 4NKIH 1NMBH 1LO3L 3QO0A 2VQ1B 1KBPA 4JFFE 3NK4A 3PHAA 2G30A 3ML9A 2AJSH 2EC9T 2AAVA 3N06B 3PGDB 4Q6KA 1FZMA 4UQBA 1M7IA 3HZVB 4F8LA 3FT3A 1MIEH 4HIEB 4RFOL 2OFQA 4G6JH 4JFUA 1TTGA 3ARBB 2X4UA 5I73C 5GHWL 5I6XB 1YEHH 3NGBB 2A74A 3EDDA 1BSIA 3DUUA 5TQ2H 4ZPTA 3RY6A 1FLRH 4MXWL 2AEPH 2C5DC 4HFWB 4HPHA 2CPCA 2EILB 2NUPB 5EN3A 5HI3D 3DVNA 4R83A 1VGEH 2DYPA 4X2UA 5GQBA 4XO9A 2YA2A 3RQ3A 3OXSB 4PB9H 4DPRA 1KCUL 1M7DA 4I18C 2R23B 2J88L 3OJ2C 4IMLA 1ZA3A 5IF0A 1DDTA 1XVSA 1TKWB 1ZKAA 1Q38A 4GRMB 4KO6A 3MLRL 4U2ZA 5F1SA 4H20L 1VSCA 3DPBA 1ROWA 2BCMA 3PQYE 5DMJB 3DX6B 1UM4L 4YFDB 4NQSA 3VNZA 5KW9H 4AI7A 2FYYA 3HHMA 4MAYC 1KYOK 4JUTA 3PS6A 4W68A 1TYJA 4WHCA 2P24B 4LCIL 1N2RA 2C9XA 4MHHI 3UYOD 3QORA 3SQBB 5C8JA 4KK5C 2CA3A 4P59L 1KBVA 1G7MA 2EXTA 4GQQA 2EUVA 3BLKA 3RRQA 2FVNA 4JRXD 1OAYL 2J44A 3OKOB 3CFCL 3CZGA 2MNJB 4Q56A 5A16A 2A9CA 1BVLB 2ZUWA 3VXNB 2RIKA 1FCGA 3RWCB 2N56A 3KPMA 3PP3K 4IKLA 4NO3B 1S5HA 2GY7B 4NAMA 4PJ9A 2XG5B 5DR5H 3LVTA 1I9IH 2MHAA 3L9BA 3FBKA 4XI5C 1RIUH 5AW7B 4L0ZA 3HG1B 4I0PA 1Z1WA 3JVGA 2C4FU 4QXTB 2CGYA 4UQ3B 5E8OA 2N1KA 3VCLB 2QLVB 1ZANL 2DZEA 2P80A 3LN5A 2UZXB 1KCKA 3KLSA 4HCIA 4DGWC 3IXTA 3MLYL 4RISH 5T3XE 2EH8L 6PCYA 4FE9A 3N42B 1KSRA 2WQ8A 3W11C 4BWWA 3MLTA 5CZVH 1S7RB 4R7DB 5EFIB 1VCAA 5EU3A 4LLQA 3IXAB 1BQLL 1GOGA 2EDEA 1IVTA 2MSPA 4ACPA 3FSVA 1VGKA 4Q9RL 2VH5L 3FOLA 1NMAH 5DJ8B 3ULUF 2Y3NA 4C54A 3ZDYE 1LDPL 2LFEA 1PZ3A 5HBBA 2Q7YA 3CLEL 2B0SH 2YD8A 2D9QB 1M6OA 4Q6IB 4WWNA 2MCG1 3WLBA 1F13A 2Z31C 3G6AB 4NFDA 2NR6A 4JY4B 4JKLA 3II2A 2H0PA 3WE1A 5A2CA 1XGTB 3BN3B 1NJ9B 3GZKA 2EIZA 4YDIH 2OZ4A 5I8OH 4FXKB 2BS8A 4FLRA 3DURA 3GI9L 4F2MB 5E9AA 3VDCA 3U9PL 3VRJB 5ABDE 4AT6B 2WXPA 3D69B 4F8PA 2IMNA 3ZZQA 2DLFL 3B83A 5JLZB 2VR6A 1PD6A 4GBXC 2P5ED 3WDJA 1RMFH 5C0CA 1MQKL 5ESQB 3T65A 1ML0A 4MNGE 4RDBA 2PTVA 2GUYA 4EN3D 2CLRA 1AD0B 1W0WA 5I74C 1E9PA 1TQBC 2X4QB 1F4AA 4LEXH 5D1XE 2ZXBA 5FDWB 2YARA 3J27A 4ZPVB 5EN2A 3RFZA 2JI2A 1WZ1H 3FT4B 4LP8A 2EIDA 4RAVA 1PKOA 5F7EL 3U6XA 2ZUVA 3KWWA 4APQA 4U1NB 4RGNE 4OCXL 2OYLA 4TULH 3H3BC 1AS6A 5AOJA 2HKHH 2G2RA 2PYEA 3Q06A 1ED3B 1T0OA 2F5AL 1HINH 2GYSA 3B2MA 1DN0B 3AG4B 3P9MB 5DQDL 4JKPH 2VMFA 3C9NA 4EQ3A 2NZ9D 1AO7D 2M8XA 3BXNA 3R1GL 3V4PH 3HI5H 5DI8A 1BYOA 1U8IB 1QRND 4XMKH 4IKKA 4KZDH 2CRZA 2EE2A 3T5WA 4NUGL 2ITCB 4JLRA 5EWIL 4RGNC 3BGFB 4F7EB 3SPIA 1ODUA 2ZSVB 3TEWA 3QDHA 2WXJA 4YSTA 5DD3L 4NN6B 4GUPA 3VYNA 1H8OA 5I75C 4R3SB 2BP0B 3WMSA 5BMFH 3WFHB 4ZG1A 3ROLA 4AM0A 1KCSL 4MJ6A 3K7UA 15C8H 4O2CA 1CLZL 4X8JA 3DSFH 3MRQB 4AKOA 1YEWA 5IB1B 4Z7OB 3TBWA 4FFYL 4QXVA 4FQPA 3BH9B 3NT0A 4JVUA 1OAQH 4X6FA 3V55A 3MCKA 4FG0A 4Y16D 3GBDA 3EJRA 2RBLA 2VMEA 5KVFE 4G8EB 4K7FA 4J4PC 4R96A 4DKFH 5JXEA 3AUVA 1BAGA 5BVPH 2HVJA 4RRPG 2WW8A 3ABKB 1IBZA 3NIFE 4KO5A 4WDIB 1CDYA 3IF1A 2JQZA 3H9SA 1HEZA 4PW4A 4FQIL 3LH2H 5EOQL 2WBJB 5AKRA 3ZYIA 1K9TA 2W91A 4XCCL 2EEAA 3L2NA 3WIHA 1NAKH 4WNQA 3UYPA 2GIXA 1UOKA 2PR4L 5HGDA 3HAEB 3VI4B 3HNVH 4BZ1A 3GIZL 4RX4A 1KCRL 4TVPE 1CGUA 2VLKD 4G1EB 3UYRL 1AC6A 2YPLD 5I1HL 2X6BA 4XMZA 3X13A 4L8CA 5J1AA 3X3FH 3WMQA 2LVEA 4JM2A 2WZ0A 3KPRB 3KDPB 1SQMA 3FUMA 3MNWA 4MXVE 2F8XC 1J1OL 3OAYK 2BP8B 5I1IH 4IRSB 3SQRA 1RPUA 3NFPA 4WEBL 4PJ5E 5F89A 2BHFA 3RWIA 1KWGA 3BZ4B 1JGVL 1BFVH 3T3MF 1UJ3C 1AY1H 3C87A 1WE5A 1IM9D 4DO4A 5IIEA 3APFA 4MS8C 1JZ8A 1AE6L 3S34L 3EO1A 3N1FC 5FWRA 3FH8A 4IS6A 4AV4A 4ELKA 3KR3L 2R56L 2Y5TA 2EVJA 4ZW7A 3L7FA 1SNRA 4XVSL 3FJTA 3DOSB 5E8EA 2PR9A 3Q01A 4KJPC 1EXHA 3N1MC 1G7PB 1T6VN 32C2B 1PLGL 3PXHA 4DP4X 2XPZA 5ITBH 1L9MA 1R5VA 1WEJL 2IQAB 4WNJA 4BK8A 3TNNA 5E6IA 1F18A 5DK0B 3X1NA 1TJGL 2KQMA 3KPNB 3PYCA 4ZAKC 2VSDA 1I7UB 5DJ2A 2VDQB 1CG9A 4JFFD 2HVKB 4LOEA 4YHKH 2KDGA 5GS1C 1E27A 2A77H 4MNQA 3WHXB 3ECWA 4UT6A 1BD2A 4HPOH 2FO8A 3SJVB 1RI8A 5J13C 3F3HA 4F15B 2OXHA 5KS9B 1VZIA 4PS3A 1RJCA 5BJTB 2OK0L 1JPST 3RWGA 3BUTA 2ICES 4O02A 1S9YA 4Q9BA 3K5SA 4R5TA 1QATA 1YAZA 4NN5B 4ZO7A 1ETB1 5K69A 4PJ7A 1GGTA 3WS6A 3B2UC 4MSWB 2F68X 4H26A 3RAJL 4PD4K 4FQHA 1KGUA 4L05A 3S8GB 4PP2B 4M6MH 3GSWA 2Q1EA 3GSVA 5BOZG 1AKJB 4X7FC 1WGVA 1ZLWH 5KYUB 1EEZB 2JB6A 5IT2L 1ZS2A 4Q58C 1RAMA 2WOBA 3CN1A 3ML8A 3S88H 1BGXL 3IJ8A 4HHWA 4XX1G 4LCUB 1YEIH 2GIMA 4PHXA 4PRIA 1ZPUA 3G5YB 3FQRA 4KK5D 1N64H 3ARFC 3OR6A 4JY5H 3SKJL 2IAMB 5BRZE 3ERXA 5DSCA 3ILPA 5C6TH 5MI0B 3TX4A 4N0UB 3O9WB 1GZPB 4TTDC 4Z3GA 1QR1B 3QUML 3WELA 4OLEA 4KXBA 3BQUA 4H8WC 4J8QA 3E1F1 5CKAA 3B5GA 5JIHA 4BINA 1JV5B 3PWPA 4WEEA 5H8DA 2EH7H 2OBGA 1J87A 3JV6B 4OLVL 1I82A 4JPVL 3O3DA 1AGFB 2FX8H 4E68A 3QCUH 3QNFA 1IBGL 3FFOA 4XI5D 1YZZA 3SE8L 4HAKA 3KPLB 3TVMA 4AE0A 5AEAA 1INEL 1TETH 3IDGA 4WSKA 2XBDA 3TIDA 5J12B 2YRLA 4OF7A 1AR1D 1G1KA 2GC7C 3QEQA 3Q2VA 3MV01 3W11D 5A2AA 1IQWL 1G9NH 1N10A 3NJFA 2DQDL 4OKVB 3GO1H 5CLZA 5FO8A 3ULUE 4Y2OA 5JW4R 5HI4D 1G7JB 3VDAA 1OARH 5DRNA 3D34A 1SUJA 3IAQA 4DP8X 1BQSA 4BK5A 3MA9L 4HIXL 4EMZA 3R7QA 4DW2H 3VGHA 5DVMA 3E8VA 1FH5H 4BSWA 2DTSA 3PUUA 3P4MB 5K1JA 3NSDA 1J8HB 2VLRA 2NXYC 3IRPX 2Z31D 4NNXB 5T3XD 2VR7A 4DETA 3VGDA 3ULUC 1E3XA 4HS6B 1M3IA 1HWHB 1QNIA 3TC9A 5H37G 1OE3A 1CQYA 2QPDB 1IGCH 2IBZX 5IMLB 4LOVA 3W37A 3KD4A 2QKIB 4MJIA 3KW8A 5ESAA 2DL9A 2W80C 3FO2B 5ANMB 1Q8MA 3FQNA 3G04A 1C9SA 2DMGA 4HS8H 3TT1H 4W6XB 5KYXA 1R6VA 4GBXD 4JO4L 2XLLA 4P5TB 3VXOB 4RSVA 2R1YB 2PP8A 3QWNA 2ORBH 1ROCA 4G11A 5DJXA 3BH4A 4GIPD 1R5WA 2ZX9A 1CBJA 1NEZG 4FC3E 2F5BL 2XWTA 4P5KA 4B9PA 4DZ8B 3BI9X 1WZKA 5I1CL 2P5PA 3DARA 4L48A 1JWSB 1TDQA 3UJJH 1OKEA 4Z0XB 1EDYA 1XD1A 3PAUA 3SE9H 5D5MB 4QRUA 3FUHA 4HLEA 1X9LA 4OZHA 5DJZA 3TA3C 3JWOH 4TTGA 3BUYB 4NO0D 2NT0A 1X44A 2CUMA 3QR0A 5DJ0B 1YYML 3WTWA 1SOXA 4EO5A 5CJXA 5T1JA 3F7QA 5AAPA 3SDAA 1HIMH 1V8HA 4PWIA 5D1XD 2CO1A 4KNTA 2CDFA 4LKCB 3ESOA 4LL4A 3LEVL 5IK3A 4KKZA 3PE9A 1ES0B 3ZKMC 4N3TA 1UUSA 2IV9A 3CVIL 4TUKH 3RX9A 4GRLA 4NKIL 4RGND 3ZUCA 4BZ2A 4AL8H 2BNRB 1UQSB 5DDHA 1LD9A 4UQ2A 1CFNA 4AMKH 4ZBJA 1O7VA 1NANI 4AYFB 2CM6A 4G6JL 4XNXH 1QEWA 1JN6B 1CGSH 2XA3A 4X9HA 43CAA 2NNAB 1YEHL 2YEQA 4ZMOA 5TQ2L 2X05A 5AB0A 1JUFA 4A7SA 1FLRL 4BSJA 2AEPL 3MRPB 3QIUA 1CL7H 4HZAA 1RUAH 2EACA 2XJLA 5DJYB 1BBJA 2IEPA 4MDIB 1VGEL 4DO5A 2J57A 4Y19B 1TG8A 2G75B 4IKJA 4PB9L 3P0YH 4X4MA 4XHJC 4YHPA 3D39A 3MREB 3FCTB 1KIRB 4KC3B 5A3IC 4QIRA 1CFBA 1IAMA 4ABWA 4YSDA 2JKWA 2KERA 3T8XA 2CUIA 3AABA 1I1YB 5KW9L 5BXFA 5DHVA 5B1AB 3IDNB 1HNFA 4MMZB 5E7FA 5B39B 5INDB 3SY6A 4TSAH 2X1PA 1X5FA 3T3ME 4KNSA 1B0WA 5FYLH 2OMYA 3NZ8A 4N4YB 1Y0LB 5EC2B 4RGMC 5KYWB 5CGYC 3WHE1 4YC2C 1MHPH 3IJ7A 4PHZA 4KDVA 4WU7A 3SGKC 3QDJA 4I48B 2GBUA 2WTRB 4TVPD 4X5RA 3VXTB 4OV5B 2XVGA 2YGOA 4MD5A 4NM4H 1ZXQA 4MS8D 5CO1A 2ATAA 3PAVA 1R3LB 4U6XA 4CGUB 4LCWD 5F9OL 5DR5L 3C5ZA 1I9IL 1KYUA 3QCVH 4FA8A 3FTGB 3D85B 5TF0A 3C12A 2LW3A 1S7VA 2WKLA 1QSFD 1RZ8B 3LH8A 1HJBC 2MOGA 4UV7H 2D3LA 4KJPD 4PJ5D 4EKXA 3STLA 4ESKA 1OV8A 1XQ4A 1I8IB 5DYOA 4ZFOB 3U30B 1YPZF 4QRFA 5FM4A 5BCAA 3OSKA 2C9VA 3BP6A 2F7OA 3S8WA 3I84A 5CZVL 5CUSH 3EH2A 5MP6H 5D7KE 2OMXA 3L3GB 1ZT4B 4X6DF 2WXFA 1XEDA 1D5MA 3KLAB 1HZKA 1UENA 3T2NH 3UROR 2VW6A 1NMAL 3UC0L 2RA1A 5B22A 3MXVL 4NWUH 1GAFH 2C9SA 3LY6A 1P4LA 2B0SL 2X9YA 4W4OA 2K0RA 4PJEB 3B2UD 3LKNB 4OF6A 5HJ3B 2Q87A 4Q8BA 3UJTH 5EF2A 4P5RA 3BFQG 1XAKA 5LKNA 5EZLA 4N2KA 3NN8B 4OT1L 3U7YL 4HJUA 5FDYA 2ILLA 3FYIB 4H40A 4YDIL 3RBGA 3WNMA 1JWMB 4AK1A 5I8OL 3T2PA 2B59A 2IH3B 4KKLD 5HHOB 3FF7A 2D8KA 4DK5A 3UBGA 4CVWA 3PV6A 1E9OA 1F11A 4AJYV 3ARFD 2DH2A 3MBXL 1Y7VA 4X6CF 1AP2A 1DBJH 2E5EA 3PWLA 1FFPA 1RMFL 2ZUQB 4DGYH 3ULVF 1SXZA 4QRRB 5HY9A 5C08E 4HH9B 1T6WA 3TBSB 1URIA 1XCXA 4M7ZC 5FF6B 3JWDH 2O6PA 3OHXA 4N86A 2Y22A 4N24A 5K9QI 1MSPA 1WZ1L 3C60A 4NC0B 1A4JB 2NSMA 1NFDF 4U49A 4TULL 1O6VA 4ZFQA 4N2DA 5BRZD 2HKHL 1EIBA 1FDLH 1KELH 5LCVL 5JW5B 1FH2A 3PUCA 2VERA 5ERWB 1BZ7A 4LVNC 3QUKB 1HOCB 5E8PA 1EEUA 1HINL 1QLEH 3I02B 4PJBA 4AIOA 4X7EC 4JKPL 3HG5A 4XNZB 3WGUB 4QHNA 3AWEA 2CJUH 1U3HB 2WMPB 4NX0A 4ZFFA 3V4PL 2P48B 2F74A 3GZQA 3EOYG 3L3JA 2WUCH 4XMKL 2LU3A 1YEEH 1PFCA 1M1SA 2Q8AH 5DMIH 4XR8C 3C6SA 3DNKA 1A22B 1KB5B 1X5YA 1MUJB 2PWGA 3GD1C 4WI3A 3RL2A 4LSSH 2XVLA 4P23B 3QDMA 5BS0A 3FN9A 4I0CC 1D9KC 2WXOA 1U3NA 4Z7WA 4HWBA 1HYSC 3EUUA 1R3KA 3HBGA 4JFEA 4ZFZB 1T3FA 4TS6A 4MQSB 3ZY7A 4J3VA 3B5TA 2IF7A 4P9HH 3BSHA 3K6NA 3TO4C 1U21A 3BT2L 3OHMB 2I9TA 1CLOH 2YZ8A 1S7UA 2YWZA 4DKFL 5IHUH 4JQIH 6FABL 2WQWA 3B9AA 5BVPL 1QFWH 3S96A 3L4VA 1U8QB 1AGDB 9PCYA 1S8DB 1PDKB 1PFOA 1RPKA 2B4CH 5GPRA 3W9EB 3D07A 5IUCA 3ZE2F 2G3XA 4G1MB 5TK2A 2X44D 1NAKL 2NYZA 4PJFB 3RNKB 5IV2A 2XY2A 1ORQB 1TQCB 4NFCA 2VQ1A 1IAOB 2AK4E 3HNVL 2OX5A 2J8HA 4GW1B 3Q9PA 1MVUB 4W9CC 2VLME 2QVTA 3WFBH 1H3UA 3CHQA 3TA3D 3RVTC 2XUWA 3OMAB 3L5XL 3MV7B 5KBPA 4HIEA 1HHJB 3FDWA 1L9OA 3ARBA 1NOLA 5J8OA 1IRAY 4LRNH 3W2DH 3WJMA 4FS0A 2CIIB 1D5ZB 1P6FA 3ILDA 3PGFH 1BFVL 3BW9B 1J48A 4KY2A 1AY1L 4LCYB 4PY7A 4B9KC 4CILA 4DVBA 3BRGC 2XDHA 1WIOA 2NUPA 3M1CA 1ONQB 3H4HA 2OMVB 2N7SA 5C86A 2E7LC 1MWAB 5T3ZE 2G5UA 3OXSA 4WK0B 1CTOA 3ZE0F 2R23A 2VYRE 2Y1ZA 1UTDA 2FJFB 5I5IA 1DVQA 3A67L 3L5IA 4GRMA 4PLOB 1BQRA 2H6PB 4ES9A 5JNYB 3CFTA 4KWUA 3I9IA 5ITBL 3DX6A 1W15A 4QTIH 3A5VA 4F7MB 2EDWA 2JJSC 4ODTH 3U0PB 4JFDA 2JQMA 5ACMA 5D1QB 1VZHA 1SN2A 4X99A 4ZSOE 4YHKL 1HSAB 4ETQA 3FCGA 1OSZA 1B2YA 1KYOJ 1PEZA 3SQBA 5BW7C 4HPOL 3QA3B 5AAMC 3BPNC 4H7VA 2C3XA 2CLZB 1OP9A 1ZHBB 4XHJD 4XX5A 1CXHA 2Q5BA 4OZIA 3I85A 3WN5A 1VKXA 1BVLA 3GMPB 1OAXL 3QQ4B 1TNNA 3RWCA 4HJSA 1WDAA 4NO3A 3ARPA 2GT9B 1JZHA 3CBJB 1QFPA 4M6ML 2R1XB 4EBQH 1A7OH 4HBCH 2XG5A 4S1RH 2BCKB 1GS7A 2NT1A 3HMXA 3SOTA 4BQBA 3FT2B 4G8GB 3VTMA 3MFFB 4NNPH 2HPOA 1R3IH 4UQ3A 2C9UA 5LHDA 1P5UC 1N64L 3VCLA 4JY5L 1RJYB 4QY8B 4MKMA 3QIBB 2UZXA 5C6TL 1PYWB 3ATFA 4N2HA 2OV0A 1MHHB 2R27A 3DHUA 3T8VA 2GJPA 4HUKB 1KF9B 2JKXA 3O8XC 1S7RA 5EFIA 2LOEA 3TF7C 5AYUH 1GGYA 1BZQK 2NYYC 5LLIC 3IXAA 3VE0A 1OAKH 4N25A 2ETWA 1U93B 1E2ZA 2X4SB 1XGPB 2FX8L 3QCUL 3L4XA 5DJ8A 3BKMH 3WFEH 1C1EH 2HRGA 1GJWA 3VXRE 4AMXA 5D7LA 4AKPA 4IU3B 1YPZE 4R6UA 2DQGL 3T6VA 1X4ZA 1E3FA 4Q6IA 1TETL 2OKMA 4Y1AE 1MJJB 1XGTA 2KDYA 1ANUA 1NJ9A 1Y1DA 3D52A 4OLZH 3UGEA 5C2BH 2K1MA 3QPXH 5LWYH 2CHNA 2EE3A 4LMQE 2ZWSA 4FXKA 1WICA 3GO1L 4JG5A 4LGRB 4F2MA 3OZKA 2C7UB 3VRJA 1WCQA 1OARL 2YMXL 3UTTB 4AT6A 2OL3H 5JLZA 2EDFA 3DX9A 3PL6A 1FFNB 5DFTA 1NC2B 4DW2L 1XMWA 3QUYA 4G9DB 1KENH 2E8YA 4AE1A 1ZE3H 2OSXA 1DVFC 3FFCD 2X4QA 3DYPA 3H6JA 5A6MA 1LLAA 4KVNH 5EUKB 3GRWH 2N0KA 4KK6D 4K5NA 5FDWA 4GOSA 4L1SA 1L4IA 4ABQA 3FT4A 3AU0A 3UZQB 5GIRB 5D7KD 3BAIA 1JDDA 3KS0H 2JIXB 4PTUB 4U1NA 4X6CE 4YDMA 4KITB 1IGCL 3ARDC 1T7XA 3TM6A 3ULVE 4JPIB 2NY7H 3MROB 2WHVA 3P3YA 1DDHA 1ED3A 5F7DB 4XCYB 1VEPA 3OR7B 4HS8L 3TT1L 4QRQB 3WNLA 1NAMB 4DQAA 3I9GH 2MCMA 2CBPA 2FRGP 2ORBL 2LGNA 1VEMA 3ECBB 4MD0B 5KZCD 2BERA 4PJCB 4EZJA 1NFDE 4X4YB 1U8JB 3H55A 1EDQA 5C0JB 1ZTXH 3HB3C 1NBVH 2ITCA 5F9WC 4FGMA 5GZOA 2WZPD 3UJJL 2ZSVA 2DI9A 4AEHL 3VMNA 2SODB 3SE9L 5HHPB 5FEBA 4YJZL 4R3SA 4F5CA 4WHYG 2XXMB 2BP0A 4R4FH 2QPEB 4UOW0 3JWOL 2WO3B 1JK9A 4X9YA 5FGSA 2XWBB 5DO2C 3GSOA 3MRQA 5IB1A 3CQFA 1JPFB 4M6NH 3ZR6A 1FAIH 1HIML 1MHEA 1BA9A 3BH9A 2ZWLT 3HZMB 3EOBA 3SPJA 3NRPA 2J1WA 3DGGB 1TYEB 2FEJA 1UM6H 2VSCA 4HKZB 4PLJC 5EIIB 3QQXA 4A7VA 1LGVA 2D7MA 4G8EA 1EO5A 4TUKL 1VEOA 1B4TA 3FN0H 3BCDA 2XN0A 5D6DA 4N28A 4AL8L 3EH3B 4OCYH 4WDIA 3GSQB 2NUTB 2CR6A 3C6LD 3THMH 1FSKC 1KTDA 3ECVA 3WOVA 2GITB 2ZWKA 5EDSA 4YHOH 1IKFH 2YQBA 2Y23A 4GAJH 3BZDA 4XNXL 3HUJA 3LN9A 2NXZD 3SYQA 7CGTA 1P5VB 1HYSD 3QZWA 2NPLX 1IV8A 4D7PA 1HEJC 3ESVF 3ULSB 4DGUA 3HVDA 5DHYA 1RUAL 2K7QA 2PPEA 3CUPB 3LD8C 3QORC 1XH3B 2CBQA 3ZE2E 1K8IB 2FT8A 3KPRA 5F3BA 1VFBB 1R5IA 2FO4B 3E6FB 5E2VL 2BP8A 3DV6B 4IRSA 4Y4FC 3S35X 1DQKA 4BFRA 4ZZKA 3P0YL 1BW8A 4QRAA 3SDCB 4AH2B 3LQAC 3BZ4A 5CLYA 2YBGA 5HYJA 4WO0A 4YDLB 3KPSB 4ORZC 1RK0B 4PJ9C 4RNRB 1RK1B 2FH6A 1I1CA 1CE6B 4JDEA 4C8XA 1UWGH 1WWBX 1FCCA 2BIPA 2YJQA 1YA5A 3MNDA 4XNMA 3E9UA 3DOSA 4TSAL 1F6FB 4I0PC 5A2BA 3JVGC 5IQLA 1G7PA 4QHUB 1AI1H 5FYLL 4IEFB 1GOHA 1JFQL 3CZEA 4KHXH 3LN4A 1WITA 5DK0A 3RDTA 4E9YA 1MHPL 3KPNA 4IRJB 1A3RH 1FLTX 3ZE0E 1OCRB 2AK4D 2HVKA 4I2XB 1CDUA 1YQVH 5E94A 5SX5H 3FUDA 2L0DA 3KPQB 4NM4L 4XP1H 5I30H 2YPVL 3WHXA 4X6BB 2VLMD 3WNJA 2XZZA 1A6TA 3E1ZA 4KX8A 4N8VB 1CURA 4OFQA 3SKOA 3C5JB 5FGBA 5BJTA 3QCVL 3X11B 3R8BB 3Q7JA 2P5WA 1CMOA 3CVHB 2GY5A 1RZJH 3BPOB 5C0CE 4MSWA 3RWJB 1KDJA 4F8OA 4PP2A 3KVQA 4RAHA 3D08A 1EUTA 1AKJA 2XPGB 4I5BA 2GFBB 4XPGL 1EEZA 2BJMH 1KXVC 3F6JA 5I8CB 5JOFB 4V1DE 4AQEB 5CUSL 3VGBA 5MP6L 1ZGLM 1YC8A 5T3ZD 4HUNB 3DUHA 4LCUA 5D93C 3G5YA 3K6OA 1JYWA 3EOAA 3F7LA 1JNHA 2IAMA 3NJVA 1TITA 3ASOB 3UBXB 2ZXWB 2BW4A 2WD0A 3T2NL 2PYEE 1AIFA 1C5BL 3QAQA 3K74B 1N70A 1GZPA 1GAFL 2P45B 3COOA 4HIJB 4YSUA 2TRYA 5DT1H 5LGKA 2GJ6B 2WNWA 1WPCA 3CSTA 1THAA 3QE5A 4PRHB 4OZHF 1JV5A 4K73A 5HDLA 2YD6A 4QPEA 1H6EA 3AWGA 4CU8A 1OP3H 2F7IA 4K15A 3SDXB 3GJFB 3UJTL 3RFZC 3IDMB 3JV6A 1GSMA 2OULB 1BEYH 3MC0A 1WZMA 4WKXA 4IOIB 3V95A 2Z6FA 3DK0A 1YEFH 2DV6A 1DE4A 3A4DA 4PCYA 3VWJB 3P11L 1KWKA 5I1AA 4WO4A 3FU8A 3KPLA 4KROC 5KSBF 5BZZA 1N6UA 4H8PA 3IB4A 3FYEB 1HT6A 3MBED 2R69L 1AMYA 1DBJL 1Z3GH 4DGYL 5CWSB 4ENZA 2WN3A 1FYHB 4XVTH 4LEBA 3D4CA 4QHLB 3O8XD 5E2WH 4BA0A 1NEUA 4OKVA 3GGWB 3JWDL 3BMWA 1B3IA 1T1YB 1G7JA 2NYYD 4MNHB 1B6UA 1MCWM 5FXCH 4CMMA 3ALXA 2PXYA 4ODSH 3MNMA 4XNQA 4Y4HB 3TZVC 5IEHB 4DOHE 4NB7A 1FDLL 1KELL 1RZ7H 1J8HA 1AYOA 1NGZB 5HXMA 4F24A 3K4AA 3MYJB 4NNXA 4YK4C 1JERA 4DNLA 5CGTA 3PDDA 4NDMB 1JZ7A 1CT8A 4J1UA 3TBVA 4HS6A 2CJUL 3HZKB 5IJVB 5KEZA 1A3QA 3HTLX 1AZRA 3Q5YA 3QUHA 5IMLA 3MR9A 3CDFA 2WUCL 3LZOA 1YEEL 3SZKC 1X5MA 2QKIA 3VFVB 1SLWA 2HUHA 3HG4A 3FO2A 3RWDB 1E5YA 4L3FA 4OIIL 1MEXL 1I1FB 2A6IB 3VXOA 1TUPA 4P46A 3V7AG 2BVEA 4Y1AD 1Z9OA 2AEQH 4LSSL 1OB0A 1EEQA 4HOWA 4M5TA 4ODXA 3RX8A 4DZ8A 4XRCB 4EI5B 1JP5A 3CLFL 1JWSA 3I50L 4FQXB 1U8KB 4I88A 1TEFA 4GUCA 3QWRA 5D5MA 4P9HL 1AGEB 2XTJB 3ARDD 1FO0H 1CLOL 4BCZA 4WWOA 1YECL 3QQ9C 3BUYA 5KTEH 4JQIL 2G4GA 5DJ0A 4OD1H 1P1ZB 2Q8BH 1QFWL 3JT0A 2VZOA 5SWZB 1WWAX 4XC1H 4ZX5A 4JO2L 4FNRA 3IETB 2B4CL 2XIIA 1FFOA 2Q7NA 4LKCA 3O6FD 3Q48A 4J8RB 5K5YA 3MODL 4UT7H 12E8H 5C0BB 1ES0A 5EORH 1YNTF 3HB3D 1EO8H 2NCMA 1FVDA 1MI5B 3APCA 4JL1A 2DMCA 3EBIA 2EEBA 1UQSA 2IBZY 3ULVD 4BDVB 1AYRA 2EC8A 1EHAA 1T21B 2HRPH 4MNQE 4MZ2A 4MS6A 3QJOA 3WFBL 1U41A 1BD2E 3GUTB 5D96C 5TE4H 2WTPA 4LEOB 3HOGA 5DURB 1JOIA 4MDRA 5F7WC 4AYFA 5DO2D 1JN6A 4P2RB 3QULB 1PZUB 3C09C 4AJWA 1IIIA 4MB5A 4DIXA 1OGPA 5IVXB 4LRNL 3W2DL 5E6IC 2G3MA 2L7UA 3MRPA 1X9UA 1S46A 3M86A 4POZD 4Z18A 3FU3A 5DJYA 4MBRA 6TAAA 4MDIA 3FUNA 3FULA 1UC6A 4YNYB 4Y19A 2E7BA 4HXAH 4D2NA 2G75A 2BS9A 2F8VA 3VW3H 5ID0A 4C4KT 3UDWC 1JYVA 5B1JA 2AJYH 3MREA 3FCTA 1KIRA 1MVFA 4LHUG 2WZAA 2V2XA 4U4BA 1UEMA 5INCB 5DZLA 3WS6C 4F1SA 5I16B 4L5FL 2AJUH 2XFXB 1J0YA 4NS0A 3CK0H 3S37H 3VFSB 4QTIL 4ODTL 3VRIB 2FO1A 3DVGB 3IDNA 1F4XL 3NPSC 1IKOP 3FCBA 4UUJB 2HRLA 4YGVB 5IQNA 1ADQA 4YVNA 1XGUB 2FHBA 2XQBL 5IKCB 3JBG7 4XCEB 3LRGA 5GRVK 1YVLA 5DUPL 4Y4FD 1ICTA 1Y0LA 2Q2LA 3K6IA 1K3ZA 2IBBA 4GKSB 4IJ3C 5HGBB 5KYWA 1HC1A 1BX2B 4O51B 2HWZH 4PJAB 1J5HA 4XO8A 3BQUC 3F00A 3LNHA 1NGPH 2ENYA 4H4NA 1CVRA 4QGYA 3SQOH 4ALAC 4I48A 2WTRA 2QJDA 4FXLA 4OV5A 3HKFA 2YRZA 2Y06H 3QEQE 2I7OA 4JFWA 5JIMA 1R3LA 5T3XH 4OD2A 1A7OL 4HBCL 3BZEB 4S1RL 1NGQH 2CJ3A 3DHMA 3MLWH 1ZV9A 1MZZA 3D85A 4Q4EA 3LS5L 3RB5A 1A4KB 4NEHB 4ODWB 3C8KB 4NNPL 1GYWA 2ED8A 3TVMC 5KG9B 4XBGB 3GMOB 5BRPA 3FTSA 1FNLA 5IJCC 4AY0A 5FV1L 4AVKA 4ZFOA 4M61B 1P4BH 2N3JA 2AF2A 4YLQT 3EAKA 4HCRH 3ZT7A 1EFXB 3KHQA 4JMNA 4ODVH 2XZAH 2AQNA 3L95B 4FNQA 5AYUL 4ZNEA 1A02N 3L3GA 2Z3FA 1OAKL 1IJ9A 3RGHA 3IFNH 2E7DA 3PWVB 4BK5C 3ZO9A 1JWUA 2JK5B 3QUZB 4WCYH 4Z7WF 5IMOB 3BKML 1U42A 1AACA 4JPKH 4Z7NB 5JOPD 5TK4A 1E5ZA 2NNCA 2YGPA 3NIDF 4BGDA 2ZIDA 1XHHA 3QIWC 3GZOA 4PJEA 4N0FB 4H44C 1U8LB 5HJ3A 3O2VH 4ZYKB 2J6EH 3TWCH 3VXSE 1F00I 2DLIA 2F7QA 5C2BL 1IUZA 3KNBB 3QPXL 4AZ8B 4WQOA 4LK4A 1XF2B 1JWMA 1T83C 4ZRGA 1BF5A 1G87A 4P4KD 1KN4L 2ICEB 4E5XG 3IPEA 2OL3L 4OZHE 4XNBA 1NUGA 1ACXA 1JE6A 5C0CD 1SQ2N 2I5YH 4NQED 1J8KA 1KTKE 4HH9A 1EMTL 3CX5K 4XO5A 5FF6A 2B5IB 1X7TA 1I8AA 1E8YA 4KVNL 3GRWL 4ZXBB 1E40A 3GXMA 3M17B 5TPWH 4PVBA 3FU5A 4LHUD 4V1DD 1MKFA 2WB7A 1SGKA 2XXGA 1J05B 2H6OA 3I6KB 3BIKB 5L2KE 2H0FA 1E42A 1OM9A 2NY7L 2PW2B 5JW5A 2PYED 1OANA 4QTHB 3IBEA 2WWMD 2ZONA 3KJ4B 3QUKA 1HOCA 5CJQL 4XODA 3FTWA 3I02A 2XN9B 4ZTOL 3RYMA 4KZEH 4L1HA 1MIML 2XU9A 3I9GL 2WVUA 3PPEA 2QGBA 1NCTA 4MB3A 4OFYA 4NQDB 1ACYL 4L3CB 3GSNH 4U1KB 2DWXA 1WCBB 2Z92B 1NLDH 1NBVL 2NY5C 1YAIA 1JXKA 3BH8B 4P57B 4YSEA 1EJOH 2BXYA 4C56D 5L7XH 3QBTB 3R4DA 2Y2TA 3TZVD 4XCNB 3VVVA 3WFDH 5KVFH 3X3GH 5EEXA 4P23A 1OY3B 2Y1VA 3RIAK 1OLLA 4HSCX 1MNUH 1WHOA 1PG7X 4AYBA 4KO9A 5H37H 3ROOB 3X17A 4M6NL 2JXMA 1FAIL 1QLFB 5E4AA 2XA8L 3PNWB 1UM6L 4FERA 2JSFA 3UMNA 4ZUTB 1OP4A 2IGLA 1PZ5B 2DW5A 2R29H 1OALA 1J7VR 4F7TB 5JA9A 2BM3A 4G8FB 1ILUA 3FN0L 4XNAA 5I0YA 3AROA 2K6YA 4GFTB 4TVPH 4WIQA 1U8QA 1QFHA 4HZLA 4YUEH 1HCVA 3APNA 1AGDA 1B9KA 3BSZA 3HI1A 1PY9A 4FEIA 4LLVA 3THML 1S8DA 1PDKA 4Z3EA