2MTAA

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
b'DKATIPSESPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGVLGEAALKGPMMKKEQAYSLTFTEAGTYDYHCTPHPFMRGKVVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
molecule tags Electron transport
source organism Paracoccus denitrificans
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2mtaA00
4YSOA 1KBVA 5ANHA 2XU9A 1ET8A 3BQVA 4YSEA 4G7QB 5I6NA 2E86A 1XB6A 3WIAA 3OD3A 3CVCA 3H56A 4YSUA 1AS7A 3ABMB 1X9UA 1DZ0A 4E9XA 1R1CA 1ZIBA 3ABLB 3QQXA 1NIBA 1SF3A 4A2HA 1GS8A 3AZUA 5TK4A 1NPNA 3DIVA 2YAEA 3S3DB 2PCYA 1QHQA 2BP0B 4AI7A 3N55A 3IE9A 7PCYA 2HRGA 2UXTA 1XMEB 4AX3A 2PCFA 3OM3B 4DP6X 3NT0A 3WNIA 3OMIB 2VM4A 4QLWA 3NJNA 5B1AB 4N8UA 3FU7A 2GI0A 4YVNA 1NPJA 1OCOB 2XX1A 3S3BB 1GY1A 2XX0A 4EF3A 1L9QA 4M4RB 4DP2X 3H4FA 2JXMA 3PPSA 1WS8A 2HX7A 4DP1X 1JZGA 5F7AA 2OV0A 1RKRA 1L9SA 1XB3A 2HX8A 1OF0A 2PLTA 2AANA 2Y1AA 2CJ3A 2XV3A 1A4BA 3FT0A 2EIKB 3FU7B 4DPCX 1WA0X 2FJSA 3OMNB 2AZAA 4JHUA 1E30A 4AKPA 3FS9A 2RACA 4W1TA 1PY0A 4G70B 3WNJA 1CC3A 5D4HA 3FYIB 2VMJA 3AG3B 5I5JA 4Q8BA 1JZIA 1AG6A 2UXFA 1BEXA 5PCYA 2XV0A 3TBBA 1URIA 4X4KA 6PAZA 2FQFA 4FAAB 3IN0A 2QDWA 4ZK8A 3IN2A 3MBWB 4A2GA 4DP8X 5I6PA 2YAQA 3FPYA 3TBCA 1MG2C 3UADA 3PAUA 5EHFA 1KCWA 1W6LA 3V9EA 4E9QA 1QNIA 1A8ZA 2A3TA 2NRDA 4AKQA 1OE1A 1AZNA 2CBPA 1M9WA 1PLAA 1NIEA 4P5SA 2UX7A 3ASOB 2VW6A 4E9TA 2VSMB 1BXVA 1AACA 2VM3A 1AQ8A 3AG1B 3CVBA 1BYOA 2H47C 4AZUA 2BWIA 4UANA 1JZFA 1AR1B 2GB2A 3HEIB 3D12B 2XXGA 3NYKA 4HIPA 4YSPA 3FSAA 1ZPUA 3X1BA 1SF5A 3PXLA 3NP4A 4YVUA 2H3XC 4PAZA 1V55B 2BW5A 1A65A 1ILSA 1AOZA 3QJQB 2DWSA 4HALA 2YXVA 2FT8A 4KO5A 3RYMA 3X1GA 1IBZA 2DYSB 2PP7A 2GBAA 5LDUA 2IDFA 2IH8A 2CUAA 2GC4C 2VN3A 2YXWA 1ZV2A 1JXGA 1BQRA 2ZWNA 3N2JA 1BAWA 3S8GB 2JKWA 3ERXA 3GDCA 2I7OA 3S8FB 2FTAA 1AS6A 1NTDA 4YSDA 1B3IA 1JZHA 1GR7A 2IDSA 2HXAA 3EH5B 4Q89A 1SFDA 4AKOA 3FQ1A 2YAOA 1MG3C 2BZ7A 2FQDA 1ZIAA 4PCYA 3ZBMA 2EINB 2B3IA 3X1EA 1MZYA 1QLEB 2PP9A 2BP0A 2QPDB 3NJFA 3FSZA 1E65A 4E9SA 1KV7A 1ZDSA 2IDQA 3FSVA 3CZUB 1TU2A 3GYRA 4A67A 1ADWA 4HCIA 4YSCA 5I6LA 1XB8A 2YAFA 1NWPA 3OMAB 1OE3A 4E9WA 1PZBA 1V10A 2DWTA 4GXFA 1ETJA 5E9NA 4HHWA 2R7EA 1AZUA 1L9TA 4BWTA 3EH3B 1AZBA 5I28A 3G5WA 4NB7A 2VSKB 2BW4A 2ZXWB 1KBWA 3UAAA 3FU9A 2XUWA 1AANA 4P5RA 1CUOA 1NWOA 3X1FA 2YAMA 4YSQA 1A4AA 2HLEB 2DV6A 2UXGA 3UAEA 2EILB 3L45A 2AFNA 2MRYA 1J5CA 1M57B 1SDDB 2UXVA 2XLLA 3IBOA 3NJKA 4KNSA 7PAZA 2WSDA 2J57A 2GHZA 1SNRA 3NJIA 4E9RA 1JXFA 1V54B 4ENZA 3DKHA 3UABA 4YSSA 1FA4A 2PPFA 4UAHA 2MTAA 4HHGA 1JZJA 3UGEA 2W8CA 1TEGA 5I26A 1N68A 3IEAA 3KW8A 3NJMA 5PAZA 3SQRA 3T6VA 8PAZA 3PAVA 2ZOOA 3SBRA 1I53A 3CG8A 1F56A 2IDTA 2XV2A 4KO7A 2IWKA 4HAKA 2GC7C 3AG2B 4BWUA 1SJMA 3NSFA 4HCFA 2J5WA 4F2EA 4FA7B 4E9YA 3PLYA 1JOIA 1FFTB 2VW7A 1SHWA 4BXSV 4DPAX 3ZX1A 1PNDA 1NIAA 5B7EA 1MDAA 6PCYA 3EF4A 2J55A 1AZRA 1J9QA 2BWDA 2PPEA 4A68A 3ABKB 3TA4D 1KDJA 1ASQA 4DP7X 3DTUB 1JVLA 4G7SB 3AG4B 1CYXA 4KNTA 4UF7C 2AZUA 3QJUB 4DPBX 1WA1X 4N4YB 5B1JA 2HRHA 1PF3A 2PPDA 1TEFA 4YL4A 2PPCA 3CDZA 2GSMB 4L0PB 1KDIA 4JHVA 3V9CA 2N0MA 1HAWA 5FC9A 4F2FA 1GS6X 3QJTB 1WS7A 2YAPA 1IBYA 1IC0A 2FWLB 1JZEA 3JTBA 1OOWA 1M56B 3FYEB 3FSWA 4BXVA 5A7EA 4GYBA 2BO0A 1RZPA 1NDTA 4GP5B 3CDZB 3WG7B 2FQGA 4YSTA 3SBQA 1AG0A 4MFHA 1E5YA 2YARA 3BVDB 2J56A 1DYZA 1J5DA 1ZDQA 4KO9A 1CYWA 2BP8A 2CALA 1W6WA 3KW7A 1CURA 4DP4X 5B1BB 2PPAA 2IWEA 2WO2B 3QJVB 3ASNB 4E9VA 1RZQA 3T6WA 1ASPA 4BDVB 1NIFA 1RCYA 4A66A 5I6OA 3ZIYA 4BK5C 1BYPA 4QKTA 2BZCA 4HZ1A 4W9ZA 3HB3B 4K9JA 5IY5B 3AW5A 1PLCA 3X2QB 4NAJA 2IDUA 1AS8A 1FWXA 1JXDA 1ASOA 2UX6A 3MX0B 4G71B 2JFCA 3EH4B 2P80D 1AZCA 5AZUA 5I5MA 4KOBA 1UATA 3X1NA 2PP8A 1GW0A 4YSAA 2FQEA 1SDDA 2OJ1A 3QJRB 3ZDWA 1W8EA 2Q9OA 3ABGA 3S3CB 1YLBB 2FNWA 2QPEB 3TU6A 3QJSB 3NJGA 2AVFA 1PZCA 1J9RA 2HX9A 1OCZB 4DP0X 9PCYA 1EZLA 2VW4A 4DP5X 2IH9A 1OCCB 2B08A 2XWZA 1KYAA 1PMYA 1T5KA 3TASA 3T71A 2ZONA 1A4CA 2CCWA 3NSCA 5B3SB 1HFUA 1NZRA 2FT7A 5I5IA 3FQ2A 2I85A 5D4IA 1BXUA 5B7FA 5B7MA 3PAZA 4HCGA 1J9TA 1GYCA 3NP3A 4G7RB 2CAKA 3NSYA 1WA2X 4YSRA 4A2FA 2GIMA 3GXUB 2HZHA 4KO6A 2H5UA 1PCSA 3NJHA 4A2EA 3T6XA 3NJLA 2Y69B 4F7KA 1A3ZA 1KGYE 2FT6A 2XYBA 1HAUA 2QT6A 3JT2A 3SBPA 4CSPA 1IKOP 4CSZA 5AFAA 3C75A 5AKRA 1BXAA 1WAEA 3WKQA 1PNCA 1PZAA 1VLXA 1ET5A 1BQKA 5B1KA 3PCYA 3T9WA 2EIMB 2QDVA 3FU8A 2WO3B 3FPXA 4WKXA 1ET7A 2DY2A 4BWWA 3NJJA 3AY2A 2Q5BA 1OV8A 5B1JC 2YQBA 1GS7A 3WI9A 2YAHA 4KOCA 2TSBA 4WTQA 2R7EB 1ILUA 2XXFA 2EIJB 5D4JA 4GP8B 2W88A 1GSKA 3OQRA 1AIZA 1JVOA 1E5ZA 2TSAA 4M3HA 3T6ZA 3QPKA 5I6MA 1TKWA 4JKNA 2OCCB 4RH4A 4BDVA 2BHFA 3EHBB 1J9SA 2XVBA 1L9PA 5F7BA 1NIDA 4GY4A 5I6KA 3NSDA 4DP9X 3H4HA 3CVDA 1ID2A 2X87A 1SFHA 4A2DA 4KNUA 3WKPA 1N70A 1L9RA 1BQ5A 2IWFA 1SHXA 1GY2A 4G72B 3U25A 1KCBA 2IAAC 3UACA 1PLBA 1EHKB 1L9OA 1AAJA 2X88A 1NICA 3FQYA 1OE2A 2I7SA 4NERA 4TXVB 1X9RA 1IUZA 1MZZA 1OCRB 2BP8B 1E67A 1NINA 1PAZA 2DYRB 2P80A 4GP4B 5TK2A 2LLNA 1JERA
chains in the Genus database with same CATH superfamily
1BGXL 5FHAH 3S5ZA 3SYOA 4JFZH 4X6BA 2CGRH 4UQIM 4LNRA 1SJXA 3ETSA 4C54A 2BNUB 3FZUD 3HC2A 3VWKD 3AGVA 5I18H 5DD3H 5CGMA 2EYRA 4QR7A 3KPPB 5AKTA 2DEYX 1Q0EA 3EDKA 1DUYA 3GB7B 4MA7H 8CGTA 4P9MH 2KLSA 3B7YA 4KH9A 4PRAB 4YHKH 1AP2A 2MWCA 3B34A 1BD2E 5HY9A 5TE7H 3VFVB 2J4WL 2UZXB 1DFBH 3SCMA 3OGCB 3AZUA 4X8JB 3VNZA 3OKMA 4JFQB 4ZW7A 2EAEA 3SE3C 2IALB 4OZFH 1Z66A 2HLFC 4LDLB 4RBPK 1TYEB 2K8QA 2VABA 3M1OA 3OXSB 5T3ZL 1XAKA 2APSA 2Z65C 1QASA 4FL4B 1L6ZA 2NCEA 3MCLL 2QLYA 1HOCA 1XD0A 1D9KA 1WFOA 4CDGC 2ZF8A 1KGIA 3DVNB 1GKEA 1VA9A 1OCOB 5DQDH 2BY1A 2IAMC 4PWEA 5BS0B 4MZ3A 1UB5B 2Q86A 4DP1X 5GRVK 2VO8A 1CGUA 4N6RB 4IRSB 5D72L 3K6OA 4AYID 4YDMA 4MNGA 1FL3A 2CCVA 4H1LG 2CJ3A 5HGBB 1L7TL 2EIKB 4LF3B 4FOMA 4KHTH 1U8IA 3ZO9A 4MA1C 3RHWF 4IBVA 4ZMVA 1UD3A 4FQCH 3CNKA 1T6BX 2FWOB 2RACA 1SUJA 3MUHL 1MSPA 4Z7OE 3D3VB 4OM1H 2BHZA 2WXOA 1CR9H 1LO0H 3IRZA 2GKIA 1JZIA 1XXDC 3E38A 2MNUA 4YPJA 5CR1A 2QKIC 3QXAA 2GTQA 5CZXD 5I6XB 5IB2A 4OM1L 5FECB 1WCBB 1DQKA 2W38A 1PKQE 1KYOK 2A9BA 2GVYA 1G5GA 3HHMA 5ACZB 2PR4L 5DJDB 3MUUA 3QIUA 3MBWB 4NN7C 3H1ZA 3QA3B 3VA2C 4FKHA 4FQIL 1QP1A 2JQMA 3VSQA 4UCFA 3NFPA 1QFPA 2E3VA 4XO3A 3UEQA 1RJLB 2OYPA 4X7EC 1NOLA 1D7FA 2X53A 3DSNA 3MLRL 4HWNA 2CGYA 4YXLL 1OGAE 2NRDA 5DRZB 5EN2B 4NO3B 5EO1A 4HJ0C 1NIEA 1XF5A 4PYGA 4OF0A 4HH8A 4HIHB 1IKNA 3HTLX 3PG2A 2XBZA 1KB5B 4XPTH 5ISZE 1KGJA 1ZTMA 4OKVB 4JR9L 5KG9B 1H3TA 3BQUA 5H8DA 2R2CA 5EUKB 3TCTA 3IDIB 1ILSA 2JQZA 3HZMA 1CFQB 1X7QA 4M1DH 2D7PA 1SEBA 4XNYH 1EERB 4AGPA 5HJGA 4YHPB 4LPVA 2YBRA 5AUMA 4KTEL 3X1GA 2AQTA 4JY6A 4OLVH 4NZRH 4U1JB 4OKVA 1T7ZA 3F12B 4F9LA 2CUAA 2QPUA 5A6IA 4GXUN 1HYSC 1QLRB 5D2NA 1DSFH 1AR2A 1BAWA 3MRNB 4KK9C 3S8GB 1HH6A 4M6ML 1PJWA 4L9LC 4I13B 1IVLA 3ERXA 4H4NA 2AEWA 3OVUB 1GGBH 3NACH 5LCVH 1AS6A 1NUNB 1MAJA 1RJZA 3KH3A 4QUOA 1B4JH 4ISVA 3FOLA 1CFVH 2HG0A 2Y25A 3HNVL 2K4AA 1FFNB 1U8LB 1H15A 2WXIA 3FH5A 4JM2F 2UY7B 1MZYA 2NLJB 1OGAD 2BP0A 4N8VB 5FEBA 2NZ9C 1FIEA 2CDEB 4Y5XB 1PAMA 5DZPA 3QO0B 3QDGE 3WS3A 2BOBB 1RZJC 1J12A 1OKEA 2GSGA 5CR8A 1F4WH 4Q56A 3FCSA 1YQVH 1XIWC 1VGKB 2P24B 1V10A 3I9PA 5F7MC 2FBJL 4GXFA 5CJOH 1MVFA 4CMHC 4UUJA 3VXNB 2VUKA 1H0DB 3CZNA 3CMOL 3GJEB 5ITFA 4FJYA 5DJ8B 4XVJH 4XPBL 4JL2A 3QW9A 4M5YL 5SV4A 3KXFB 4N5ED 2N7BA 5CJOL 4B96A 5KVDH 1RLBA 1ETB1 3QO0A 4LLYA 1WSST 2Z1PA 5DC9B 2X9YA 1AANA 3MRLB 3QZWG 4QHMA 1UYWL 5DI8B 2JB5H 3CZJA 3AVEA 4XP1L 1U8HB 3IJ7A 2HB0A 2E8ZA 2EILB 3GT6A 5I75C 4N90E 2FO8A 4OBRA 3HS0A 4UBDD 4PG2C 1DVFC 2HTLD 4EQ3A 3KGRA 3RL2A 3FT4B 3UYRH 1G7IB 3OX8A 2IFFH 1BVNT 3QQ4A 4L8CB 4HT1L 2D3NA 2IMNA 1DVZA 3WEXA 4LSRH 2WLJA 1P7KB 3FQNA 3HKFA 3EW3B 2WXHA 3QFDA 3EKCA 1T21B 1E28A 5EDXA 4W6XB 5GGRA 1A3RH 2MTAA 1TNNA 2VSDA 5DRWB 5IMOA 1MIML 4LLUB 1WBZB 3COOA 4BFOA 1QLRA 3RLSA 5AB9A 5I26A 1GTNA 3IEAA 3OB0H 3RGVC 3BAWA 1NKOA 4MS6A 3QYMA 5IREA 1XCTB 3NG5A 3FQRA 1T21A 1FO0B 1A1OA 4I2XE 2ZKHH 3QRFM 2ZOLA 2ZP8A 4AYEC 2HFEA 2XKNA 3S48A 2P1YA 1PDKB 3NQIA 5J12B 3CPUA 1XL4A 5T8IA 4LLUA 5F9WB 3SE4C 2WV3A 4GIOA 2OJZH 1MCSA 1PZ5A 4I85A 4K94C 4U6YB 3STBA 5C0ND 4BFFA 4WAFA 1ZT1A 3LEXA 4AENA 4EN3A 3PHSA 4I48A 3ABKB 4LGSB 2YC1B 1FJ1B 2ZXGA 1ASQA 4HIJA 1IAKB 4BE5A 2OMXA 4LRIC 1NEUA 3EUDA 4ONGL 3SZ6A 4L4TD 5B39B 5E2UL 3CN1A 4N4YB 4XN1A 2OTUB 1HWWA 3X3GL 3SQBB 3U4EA 1CE1L 1TQBC 5DS2A 3PGCA 3BVUA 3P4LA 1WJ3A 4JANB 4O02B 5FC9A 2KQNA 3G6JF 4LASL 3CVHB 1FL5B 1G0YR 1IBBA 1HHKB 1OT2A 2WK2A 1OAZL 1O6TA 3KD4A 4Y5VC 5HGAA 4ZX4A 4LHUD 4MB1A 5KJ4A 5J6GA 4WHCA 1UKQA 4KTEH 4I3GA 3GK8H 4U3CA 3QAZC 3TJHD 5AYTA 2YK1H 4Q52A 1NOAA 3WG7B 5LBSL 5MEOB 1A4JB 3BVDB 3WXWL 2WXNA 2FEDC 1J5DA 1DYZA 3QEQB 2Q7YB 3AREB 3EBHA 4H8HA 4B9IA 2FX8L 1G9NL 2V5RA 2OMUB 5J0BA 1JP5A 4ZXBD 4EDXA 5BO1H 2Z34A 3AWEA 5KYWA 5LQBL 1ZLUK 3T8XA 4MAYD 1RUKL 4JJHA 3DSFL 3P4OB 2OULB 3TBTA 4KRPC 4L23A 1BYPA 3IWUA 4LB8A 3TLRA 1CK0H 3T09A 4Y1AD 4Z7OF 1Q1PA 1N9PA 4PREA 4OIBA 4BSJA 1XR9A 2DL9A 1R5VB 3DSFH 4U6TA 1WFIA 4IEFB 3FN0H 3QUXD 1RIUH 1UURA 4ADGA 2CO1A 1USQA 4M9PA 2VERN 1ZEAH 2VDRB 2MSPA 4WEMB 4NAMA 3AREC 3FU6A 1IGTB 2W1NA 5MENA 3I85A 3I6SA 5ADPH 5HHXH 3Q8EA 3RU8H 3ZMNA 5IB3B 4XGZB 3O6LL 3BDYL 1FQ9C 3BD4A 4HKXA 3L13A 3BHBB 3NOIA 2F8IA 2IFGA 2FNWA 2E9JA 3WAKA 5TJWK 3TIEA 4HIHA 1F42A 1NCWH 2F68X 4UQBA 1D7BA 1J5IA 2V0AA 3SZKC 4KI5E 2JXMB 5ABAA 3D5OF 3UGUA 1OK8A 3EZJB 1SJEA 4PSRA 4XBGB 3W0WD 5KG9A 2VR3A 1B9ZA 4F15C 1KIPB 1LE5A 2IH1B 3MGTB 4OFYA 1EZLA 3RWIA 4MCNA 1L6XA 1F1AA 4N2FA 2D8KA 2KQMA 3VXSD 4HKZB 3DX7B 4LOVA 4XB3A 1BVOA 3GMRB 3K6IA 4OV6F 1G4RA 2QQQA 4HJUA 3TASA 1BVKB 2X0UA 4D0CA 2FLMA 2HH0L 3TCXA 4J8QA 3HN8A 1IZJA 5FYJU 3ARDC 2ZUUA 1JMZA 3VFPA 3P02A 1NAMA 1RUQL 3QI9C 4B50A 4BKLA 1E9OB 1OAUL 1P0SE 4W9LC 4F7TB 2GJ6E 4Y19B 5E8OB 2VITA 1C1EL 4YO0A 4H8UA 1UCBH 3GINA 4YSRA 5KSAD 3ZLQC 1YMMA 2WZPD 4JLRB 4ATTA 3BRFA 2H1XA 3NJHA 4A2EA 4QHUA 5GSVA 2PCPB 2ZX6A 1FZKB 3BWUC 2YPLE 4G8GE 25C8L 4HC1L 1FBIL 2VAJA 1MJ7H 3GHEL 5T5NG 4L29B 4CSPA 5CCKH 5DD3L 3WKQA 1PZAA 2XPGB 5C6TL 1BQKA 4H8WC 5JHBA 3T9WA 2EIMB 2QDVA 4DUVA 3BZFB 4MAUL 5CO1A 1MHCB 1EHNA 1Z5LA 5DJCB 3WO4C 4YHKL 2V2WB 3CFQA 3K2KA 3NJJA 5C6TH 4HISA 4XBPB 3O6KH 4KZDH 1DLFL 2NW2A 4YHLH 5IFJA 4ONGH 3LRGA 2DRUA 2CK0H 2BSBA 3CBJB 3GJEA 3OPUA 1DQMH 5D96B 4ZT1A 5IEHB 2IC2A 3PDOB 4K5LA 4LHJB 2N01B 1QG3A 4TNGA 3ALWA 2PYFA 2CK0L 2J1YA 1E4KC 1YEGL 2W80C 2XZCL 3UZQA 2YWZA 3RG1C 3C60B 2NY1B 1SQ2N 3N85L 4L2YA 3TESA 3PNWA 5E56A 3DGDA 4KUCF 2QTEA 4GBXB 1NCHA 1A7NL 3EHBB 5F7BA 1NIDA 4S1QL 3DA0A 3M8OL 5EOQL 4YMPA 1YJDH 3C9NB 2LV4A 3MRGA 3SBWC 2OMZA 4FXGA 2ID5A 4CA4A 3HNTH 5DS8B 3N43F 4WNQB 5LVEA 2K6ZA 3NEXA 1NBYA 3U25A 1UD6A 4F7EB 3PE9A 5HYIA 1AAJA 1IQDB 1E28B 3VD2A 3L16A 4OFIA 3I84A 4IIZA 3FQYA 3BKCH 3BKYL 4Q4EA 2WLZA 1A4JA 2XVLA 5BQ7B 2ZWYA 4JGNA 4ES8A 3D07A 2AJ3A 3PWVA 4K7PH 4P2RB 5I1LB 1PD1A 1GC1L 1TO4A 3LXCA 2XBDA 5DHVB 3BN9D 1Z9SA 5C2BL 3BQVA 5E5RB 2Z93A 3FN0L 4H1LB 4S1DC 1XB6A 3O3DB 3OD3A 2F8VA 2XG5B 3M1BB 4L9LB 5I8EB 1E9QA 4UILL 1E40A 4GIPD 1YEHH 4MMZB 4NZUH 1FNEA 1ZXKA 2WUBH 1OB0A 4UM9B 2VL5B 5AOJA 5BO0D 2JE8A 2WN2A 3BD5A 3BDYH 3CFNA 1BF5A 3C5ZB 2VN7A 4YZFF 5D7IE 4ELMF 3Q8CA 4A2HA 4MS8C 2NY7L 3GXMA 4LSVL 1ETZB 4FZEH 2K7PA 3ARFD 2XN1A 5JHLA 2YAEA 2P5EE 2GITA 3RY5A 4N28A 3RI5K 3ZT5A 1YVLA 2UXTA 4MMZA 5IJDC 1BZEA 4FLHA 4WV1A 1I3GL 1JMXA 5HYFA 3A4AA 2BPBA 4JDVA 3R8QA 5KS9F 3CZKA 5TQ0L 3TEXA 4AV4A 3IDNB 1QFOA 1ETZA 2P49B 4PQXA 1B9KA 2X9XA 1WISA 3C60A 1NBVH 2VMCA 1WS8A 1AI1H 5D7IB 2PCFB 5F7AA 4N2MA 4ELMB 3UYPB 4YOKA 4RFEA 4WEUD 2FX9H 3FU7B 3P4NA 1TZHA 4NQEA 4AZ8A 2VRKA 4ZNEE 3OMNB 3BZ4A 3N50A 3NRPA 3GBEA 1A02N 5IB5A 2QTVA 1E4JA 4U49A 1KGCE 2WNGA 3NRFA 3KWWB 5JTWA 1XBDA 1P5UC 2YRPA 1HHGA 2XWBA 4Y89A 1CC3A 3V4PA 4CN6A 1ES0B 4ZSOA 4N9OB 5TE6H 2OS7A 2ZUSA 5BMFL 4PRDA 3DLQR 1A1MA 4EIUA 2NY4D 3BMWA 1M3IA 3ZHNA 2OL3H 4YHZH 2FWSA 3WKYA 5B38G 4PRIB 5DD1L 1SVZA 5CCKL 3K81A 4PJAE 1P6FA 2NUPA 2G2RA 2VDLH 2IQAB 4WW1A 2EEXA 1QFWI 3L3OA 5C0IB 4LP4A 1TJMA 5I1CH 2WB7A 4PVMA 4G6KL 1XGQA 4QO1A 1ZSHA 4OUOA 4OJDH 5DD5L 3I74A 4OI9A 1I3RA 4X9GA 4U05A 1HC1A 1QR1A 1RUPH 4GFTB 2EO9A 3OB0K 2D3LA 4EI6A 4JHAL 4XP9L 1T2QH 1HSBA 1MFBL 4CC1A 3ES6A 1CTOA 3QE5A 5BZWB 5I1IL 4U1JA 2V9QA 3JUYA 5DT1H 1ED3B 3S3SA 1HKLL 4TVPH 3L3IB 4GUOA 2FZ3A 1UYWH 1UWGH 4V33A 4PGZA 3RIFK 5INDB 3VFOB 5BVJA 2AXHA 3TURA 3FO0H 5CGYD 3QXDB 1XGPA 4WKZA 1Z3RA 1A6VL 4DAGL 3BGFB 4LSUH 1KB3A 5IJKC 3IFOB 1A65A 4NHUB 1HX0A 1UC6A 3QRBA 1NBQA 2FEJA 2GUYA 3HLAB 3M8OH 4HALA 3TVMA 4QRRB 1A6VH 1WZAA 3L7EB 4XCCL 3IVKA 3Q13A 3ESOA 3OAZH 1F97A 2WP3O 4NQEE 1QEWA 4UOZA 2AV1B 2ED6A 4OLZL 1A3RL 1G6RA 4N5UA 3PP4H 3VCLA 4OGYH 4DSYA 2AK4A 4LSDA 4QRAA 1DO6A 1OL0A 2D0HA 3VFPB 1XCQA 4G59C 5KVEH 2R56L 1IO4C 4H8VA 1JK9A 2OMZB 1NBCA 2X38A 5TFSL 3HJEA 5E95B 2XXMB 5D7LA 2PKDA 3RVVD 3CLFH 1AHWB 1WK0A 5D1XB 3SGEI 4QOKD 4LCWE 5JW4N 4OVUA 5LGHL 1UWEH 1SFDA 3OJ2C 2B4CH 4XCYB 1UXWB 4M7JL 2YAOA 1IGJA 4NJAL 3LIUA 5EBWA 1MJJB 2PP9A 5H2BB 3DV4B 4NOFA 4QHKI 4UQ2B 3BH9B 3DV6B 4AJVA 4XVUD 2IDQA 2XQYG 4TQEL 2APXA 3HG1A 3SE8L 4ZSOE 3BN9C 2ROYA 4JFDB 3K8LA 1S3KL 4AG4L 5EU4B 5JOEA 1BIIA 2NY7H 2F54D 3G5ZA 2YHGA 4U1NB 4U6HB 3U30C 5I28A 2DWDA 4MAYC 2ERJC 5FW8A 3FT1A 2FYYB 2PYED 2R4RH 3ZTJH 3EFDL 5C07A 4KX9A 1LQSR 1TOXA 4ZUTB 3UZEA 4GI9A 1P9MA 3FU9A 4I4WA 5HDLA 4F93B 2NXZD 3FT9A 3M7OA 4A2LA 1BVNP 1A4AA 3A24A 3JWNG 4JR9H 1QVOB 2X7LA 5J1AA 1XH3B 1G9HA 4BSWA 4LDEB 4GG6E 2E27L 3IRPX 2EXTA 3Q5OA 1ZHBA 1OT1A 1GZHA 5IMKA 5LBSH 5GS2H 1G5AA 4LQFH 4W9JC 1T1YB 1SM3H 3U7WL 3V0VA 2UWEE 3C5ZC 3DBSA 4PM1A 1OB1B 2JKTM 1HNFA 1TTFA 4FC3E 3DROB 3PV6B 4GRLB 2IGFH 3SDYH 2CBTA 2QPSA 3G6JE 1G6RB 4PJBE 3GTNA 2QEJA 3RE0A 3FUKA 4GINA 4LAQL 5AW2B 5EU7E 2CGRL 1ROCA 3GMLA 1R3KB 4HIXL 3SDYL 2OR9H 4PVBA 3LKNB 4JFED 4Q14A 2AJ3B 1DZBA 2IWKA 2PUQT 4PGCA 4U3SA 3LY6A 3RX8A 2WUCH 4PRHE 4PGDB 2BY2A 4CU8A 3PJSB 1FL6A 5J3HD 3V79C 3SGDI 4L1LA 2E74C 2B39A 3TWCL 3ENEA 5ACZA 4PY8I 4Y5VA 3DMMB 1PNDA 2CLRA 1KG0B 4UTCA 3D18B 1R75A 4KKRA 1AXIB 1P4IH 2JF1A 1FNEB 2I27N 2XWEA 3GD1C 4XTRC 4PJBB 2Z7YA 4E41B 3X11A 1KDJA 4RCAA 5T3ZH 3V4PH 2J8OA 3DTUB 3NFPB 4EZKA 1Q9LB 4P2RE 4P5KA 5KSAC 4ZO9A 5IBLD 3FQUA 3KR3H 4YL4A 4ES9A 4ZMOA 3HNSL 1D5BB 2PPCA 4Y2OA 5IF0B 4KKAD 3QPXH 4F7MA 4O58H 1F3DH 2EVGA 2NY1C 2YPLA 1A6PA 2ENPA 3GBML 4HS8L 4NZFA 4OIIH 4ZO8A 5JMRA 5F7UA 4HIQA 4Q4IA 5JIHA 1NGZA 5FM8A 4X2UA 4JFVA 2VLLB 4OD2B 2ODHA 3BZDA 3FSWA 1T89C 1SBSH 3ARBD 4UIMB 5DEJA 5T5FA 3O6MH 1DQQA 4KXAA 2WAHA 4N2IA 1CXLA 2A6JA 3MGOB 1N0XH 1BBJA 1F4XH 3AS2A 4ZXBA 4MMYA 4AJYV 5E00A 4AQEA 2E7DA 1T0PB 2P5EB 3EUUA 1C8QA 2FYVA 1ZDQA 1RUQH 3WO4B 3BRGC 1TG8A 1KCVH 3KPRD 2YBRB 1YEIH 1MI5E 3DX9A 4ZTOL 4DP4X 5I8OL 4G6AD 4I1NB 3SKNA 3CHPA 1UXMA 4DKAA 4YHIA 1T1WB 1O7DE 3O3UN 2NY2C 4P5MA 5I8OH 4WFED 2COQA 3DX3A 4GJTB 2WWOA 5E8PA 2NY6B 5AW8B 1IC4H 1ZLWH 3HB3B 3D0LA 4QT5A 4PRIA 1OZUA 5CIPH 3B1UA 3MLRH 2YD3A 1H3XA 5JYLA 4ODXB 3AW5A 5DHVH 1QRNA 5L2JA 4DZBA 2ZXAA 3UAFA 4U3SB 5KUKA 2QSVA 3ZDYF 2Z31C 1SJEB 2Q8BL 1HEHC 2QHLA 4XHJD 4PH8A 1TQCC 3FRPG 1WWAX 3OKKA 5I16A 2FQEA 3DMMA 2EH8H 1A6ZA 5DFVC 3ZUCA 1XGTB 3BT0A 4RMWA 1A9BB 4NDMA 3KLAA 3TJEH 5HBBA 3ZQXA 12E8L 1HXYA 3WE6A 2WLNA 3FUIA 1HHJA 3QJSB 4JFEB 4M6OH 4Y4KB 3WJMA 2XZCH 2WVVB 4W9GC 4CRPA 4AH2B 4XNUL 2IG2H 2HT2D 2Q8AL 3L2MA 3KXFA 4M6OL 4HYTB 1YPZA 1WFMA 3VGEA 5BW7A 4HXBL 4LQ1A 3IDIA 2GPZA 3MXWL 3QWOB 2IG2L 1WIOA 5TDPA 3U0WH 2Q2LA 1HHJB 2X89A 1VHPA 1KYAA 3HE7B 3A6CH 4H26B 5LBVA 2CCWA 5CHNA 2IBZX 2FT7A 4IMLB 4Y4FB 1FGVL 1A5FL 1IGYB 2YFNA 4RMVA 1JL8A 3BPCB 2A6JB 3MGOA 3U7YL 5JOPD 2XWCA 3TO4B 1ORQB 4KRNA 5GGQH 3MLWH 2P5EA 5E1GA 3UYOD 5C0EA 2A2QT 3B4NA 3FFCE 1BCIA 3I9GL 1IC5L 3LZNA 3LZFH 4GH7B 4BHUA 5FPIA 2DQJL 1PCXA 1YDPB 1YY9D 4F7KA 3MLWL 2JV6A 5ADOH 3VFUA 5LN8A 1H3GA 2A74C 5D2LE 4G6ML 4P5TA 1ORQA 3CLEL 2QV2A 4D8OA 3B9VA 2EDDA 4KZCA 4OF6A 2DLTA 5DUMH 2QSQA 4EDWH 1F4HA 3TVMC 4J28A 3WS6C 2WYZA 1DSWA 1E2ZA 4O2CA 3UC0L 3RFZA 5ICXA 4NQQA 2XN9B 4W68A 4I5BA 5ISZD 1H19A 4LEOA 2Q5BA 4LSVH 4OGZA 4P23B 1JGDB 4OCYH 5FW6A 1GRWA 3FQTA 4B95C 1C7SA 3QAZB 5JPMC 2JELH 1FC1A 1BJ8A 1KJ2H 3I75B 4Z7VB 3K6NA 2QSCL 4WGVB 1BQHB 2XXFA 1UXLA 3B3IB 2EH7H 1C12B 2ZAHA 2HWZH 4XPHL 4C4KO 2H6PA 4HK3N 5JHMA 3E9UA 5FOBB 2TSAA 4F2ME 3OXRB 4PGBB 2JKLA 2QSCH 1VGEL 3UTSB 2YZ1A 2IFFL 4G8AC 5I6MA 3Q01A 4NRYA 5IW1B 2OCCB 2V17L 1FZJA 3SQBA 1TCRA 3U4EB 1NGPL 2BHFA 2V8MA 2VDOB 3ORJA 5J1TC 3S97C 3QWRA 4ELKA 1VERA 2XV6B 1CFNA 3QZBA 3NSDA 4M7ZC 2A74B 5AZEH 1WD8A 3CFEB 1RHFA 1A6WL 5C70A 1Q1JL 1G4MA 2L7UA 4WW2A 4C56E 5E94A 4NKMA 5GS3A 3WKPA 3ECQA 3JYCA 1MPAL 3ULSB 1SVCP 1L9RA 3VM7A 1SHXA 1DBJL 4GRLD 1KCBA 3HE7A 4HIEA 5JNYA 3GZKA 5L8JB 1E9QB 3HI6L 3CLWA 4F2MB 4X6DB 4M61A 1H9DA 4L3EA 5F7DA 2F53A 1IUZA 5D5MF 2GUOB 4YHYC 3EYVB 4PEEA 3VM5A 4LE8A 2FX7H 2RH0A 4I18C 4NP4H 4C59B 5AAPA 1GOHA 1WTGT 3VQMA 1LVEA 4H0LC 3STZA 4M7LL 4IBYA 4KMQA 5D1ZD 1GZHC 4DIXA 3NABL 5I66A 4WJ5B 1D5IH 1U3HA 1D5RA 4YDLB 4KVNL 3EGSA 3H56A 3K71A 1E2WA 2AQPA 4N0YH 3S5YA 4Y1AE 4AEHL 5FA3A 1ZRUA 4AE0A 4YLQT 3GS0A 4M00A 1IJNA 3ABLB 3GSQB 5IBTL 5MHSE 5IT2H 2HRLA 3X3GH 4APXB 1P1ZB 2LW3A 4L4VA 4O2CB 4KZEH 1QTSA 3C08H 4HKJA 1F90L 2R83A 3FSOA 3GJFH 3B2VL 5KYNA 1U3HB 3KLSA 2J3SA 3VD3A 3S3DB 3VH8G 5MENB 2SEBB 1KPUB 3WNIA 5LB1A 3QUYA 1TQCB 3WSQL 1ML0A 3NJNA 5B1AB 3DRTA 2PTUA 4N26A 3CFMA 2BXYA 1YQ2A 2OQJB 3TA3A 2L7EA 4EF3A 1OGPA 3VFVA 2JXMA 3UPRA 1K4DA 4KHTL 4R7XA 3WIFA 4J3OF 1K8IA 1G9NH 1Q0XH 1DQQB 5FKAA 1OAKL 4FFTA 5AW6B 2AANA 4S1DD 2AF2A 1BFOA 4PJCB 2FJSA 2QQKH 1RUKH 3P0YL 1U93A 4KWUA 3IF1A 2KLRA 3KCWA 3PIQA 3LZFL 2X4QB 1YEKH 3FYIB 3DSNB 1T5WA 3BAKA 1EDYA 2WKGA 5I15H 3FCTA 5DJAA 2B4CL 1H3UA 2JJSA 1I7RA 2XV0A 5LBSA 3W9EB 2FR4A 4TNVF 5LNEA 2I9TB 4L3EB 5F7DB 4PLNC 4B9CA 2GUOA 3MV7D 1RH8A 4QCIB 1EEQA 1T5XA 3QORB 1ITBB 1YMMB 4FXGC 3X14B 2BVEA 5I6PA 5IQLA 2HG5B 4KDVA 2G5BA 1AIFB 3GJFA 1HIMH 1KEML 4NQCD 4PS3A 3RVUD 4BFIA 4C58B 4G8GD 2HVKB 4FLRA 1WRFA 2XICA 1W6LA 2J1XA 1IILE 4PJFF 1TFHA 4PJDE 3G5YA 4YDKL 1G1KA 1ZE3C 2BIMA 1PLAA 4HUUB 5ID0B 2F9BT 5HYSA 1AJ7L 1R5WA 1YN7A 4KK6D 3BIAX 5C09E 4E9TA 1RSYA 3Q2NA 5I71B 3UBFA 4X5WA 4Z7VF 1BYOA 3V7MA 1PG7W 4DKEH 1JFHA 5IHZA 2V37A 4NPYA 3L1OL 5A2BA 3LKOB 3APMA 1OP5H 2H7WA 3Q48A 4ALAL 4Z7VA 1EJFA 4MCYB 1NGPH 4XBGA 3QJZA 1HCVA 1UM6H 2AEPL 5KBDA 3L1OH 5AW5B 1CBVH 1LQBC 1XEUA 5T1KB 3HE7D 1N6QH 1Z9NA 2NY4C 2UZYB 3N41F 1XF5B 4ECNA 1H8NA 4ZRGA 1IBZA 3H7LA 4WNJA 1M6UA 3BAXA 5CBEA 4UQEA 3LNGA 5KJRL 2EXYD 1DQTA 3PWLB 4HLZG 4JN2B 4UU9B 4ALAC 5I1HL 3IM1A 4ZFFA 1SJHA 1UZ8A 2WLIB 2DEXX 1JDCA 4PUBL 3WFCH 2Q2EB 2I7OA 2UZYA 1UGKA 4PPTA 5DJ6A 2BINA 3ZKNC 1OGTB 1HHHA 1X7QB 1U8QA 1V05A 3HS9A 2H2PD 1AHKA 4JAMA 5LAPA 4M7LH 1GGTA 4P48A 4Y2NA 5CJXC 4NT6B 5B1CA 1KWGA 3OKLB 4L3FA 4XE0A 3WJJA 1BG9A 3TC9A 1QLEB 1MFAL 2QPDB 4DN4L 1TR7A 1TZGH 3FUMA 1KV7A 2FHBA 1R5IA 4K3EH 4K5NA 4DKDC 5KYYB 3LNDA 3RILA 1F58L 5L8LB 4RGNC 2Y3NA 1JPSL 2WLKA 2EUXA 4F20A 5FHBH 4WJ5A 3TN0A 2DWTA 5DJCA 3N9GH 4XAWH 3HVNA 4TSBH 1LLAA 4EI5A 1AZUA 1L9TA 4ZTPH 3ZE0B 3LMJH 3RWHB 1UTDA 3HZVB 2HVJB 4FULA 5E6ZA 3V0IA 3R18A 1P7KA 2K4WA 3GMMA 1ZLWK 2P28B 4WCYH 4MD5B 4GQQA 4ONFH 3BEWA 3OZ9H 1C12A 3I50L 1S2EA 1NFDE 3JV0A 3LMJL 5AVVB 2XTJB 4P5RA 3EO9L 4BZ1A 1KYOJ 4K8RL 3VWJD 2DV6A 1I9EA 1KJMA 4NZ8A 3QXAB 5G4OA 4C56A 3RWHA 1U8OB 4Y7OC 4KNSA 1AZZC 2HFTA 35C8L 3HMWL 1Q9WA 1TSHA 3FU3A 1BREA 32C2A 4NKDA 4HGKC 4WWKA 1XF3B 4E9RA 4JKWA 2Z3FA 5HGDA 3VSUA 2AKRB 1DJXA 3NN8A 4UINH 5EN3A 1B6DA 4OR1A 3B6SB 5AWNH 4XBEH 3DDGA 2X4PA 1MXGA 1ZA6A 2CM6A 1ZT4A 3AY4A 5BS0E 3GHPA 2R56H 2DBLH 4OZGA 4WGWB 2YOCA 5C2BH 1MUJA 2HT2C 1O6SA 1WWBX 1RFDH 1AGFB 1HL4A 2ZOOA 1T4KB 4QHKJ 1D9KB 2IDTA 1IB5A 4UILH 1H8OA 3LZRA 4J5VA 4PJEA 3P0GB 3AU1B 4YLCA 1JGEA 2BVPA 1IEHA 3MLXL 4RWYH 3KS0J 1AH1A 4YJZL 5T3ZD 3LH2H 2ZKMX 1DUYB 1YECL 4TQEH 3RBSA 2R4SL 1QI5A 4QCIA 4GSUA 3CVIH 4RETB 4HAGA 1U8KA 1W0VA 2CJTA 4EQ2A 1KT2A 1AKJB 1WTLA 2YA2A 4DP7X 1LL1A 4DPBX 1LTXA 4HK3J 3BH8A 5AW9B 3L6FB 4XMPH 4W9CC 3ZUNC 5KOVC 1AD9B 4LRNH 4CKVX 4HQQH 5KYUA 3QO1B 3DOSB 1HOCB 1IEBA 4KJQC 4V1DE 4F2FA 5ERWA 1RJZB 4JY5L 3ULVD 1BECA 1TTRA 2Z6FA 3CJJA 5F71A 5GRZA 5HVWA 1WO2A 1XTMA 5KYWB 1DE4A 3U0WL 2FZ3B 3VXRD 3QIBA 2LGNA 4PJ9D 3GZPA 3WXWH 3I9IA 2P42B 2I07B 2OTPA 4YSTA 3O6FC 4AQAB 4MFHA 2B5IB 4DPRA 4JQVA 2CDGA 4TLTA 3GF8A 5TE6L 3AGWA 1RPUA 4FQXD 1XF1A 5DJ2B 5T5FH 3BAEH 4XNAA 2XZAH 3PS6A 1MNNA 2F2HA 2VLKD 4ZPVA 2D3JA 2WO2B 5DD1H 8FABA 4E9VA 5C0CE 1LK3H 1ZA6B 4OH2A 3TZVA 1MWAH 2DTMH 4K5OA 3M7FB 1XGUA 4AL8L 5JOFA 1YNKL 1OAXH 1YMMD 4PJEE 3MBWA 2BZCA 3ZL1A 2PCXA 2R0ZL 1OM3H 5JR1L 2F7RA 1ECYA 2Y2TA 1JN6A 1P4UA 4OZHA 1DQVA 5EBGA 4KJPC 3HE6C 1IM3B 2WOBA 4FG0A 3SDXA 3G3LA 3ARDB 4ERSL 3TWCH 4WHTB 5AZUA 2HLFD 1UATA 2QBWA 3HFFA 2GG1A 1GW0A 1M71A 1TQUA 3IB4A 4DQOL 1P7QB 4IBLT 4Q74A 5TF1L 3BP6A 2EVJA 3EOYG 3SYAA 4GLRI 3O8XC 4Z6AT 2WCSA 4ZFOA 2EE0A 3VFSB 2G60L 3UCRA 4HA1A 4Q0XH 3RUGF 3DTXA 4JB9L 2OJEB 5A3IC 1AFVL 3KYMA 1QPKA 3RHWK 3JWDC 4NXSA 4QAWA 2ZG2A 9PCYA 4MMZC 3GS7A 3J7HA 5HDRA 1XIWA 2WANA 1SMDA 3ZZLA 5C0CA 1N59A 3FN3A 3BP7A 2N1KA 3VAEA 2BIIA 4GW1A 1VESA 5HDWA 2IANE 3U1SH 5FX3A 4LSRL 2E7HA 2GJ6A 1WHOA 3MXVH 4OBSA 3KLDA 2ZPKH 4G1EA 3N44B 1K9TA 4XCFH 5GZND 3FQ2A 5TDOA 4LVNB 2H2SC 4BBWA 3A22A 2O5ZL 1V5JA 1EMTL 3RDTA 2ICWA 3SDAA 3BAJA 4UTBH 4JQVC 2ZX9A 4X8CA 1GYCA 5G2NA 4XXCA 5JA8B 3DPBB 4JW3A 4Z7UB 3HHRB 4HGMA 4TRPH 1CF8L 4RISH 2HSIA 5KVGL 1JGDA 2VO5A 4N8PA 1BM3L 1IE5A 2EEDA 1TNMA 3IT8D 3WUWG 4BH8A 4E41D 4IBTA 3SBPA 2H45A 1KBBA 3OJDA 2Z92B 4NIYE 3STLA 3C75A 1S3KH 3PHQA 3LH2L 4P3WA 1AGEA 1JHLH 3VXUA 4YL9A 3FU8A 4JPSA 3SGDH 3FQNB 4FI8A 1PZSA 4TMPA 5FA4B 2XNAB 2XN9D 2JCCE 4HS3A 3BQUC 1T2XA 3LKRB 4BH8B 1G9ML 4U6VL 3MV8E 2WVTA 4W9IC 4X9YA 1BAFH 3C9NA 1ZVHA 1U3HC 4BE6A 4D2NA 4I0CC 3QDAA 3DVNA 3M1CA 3ZTCC 5C07B 3HRZB 4JDZA 1C08B 3G04A 4JY5H 1N2RB 4M62L 4WIQA 4XNUH 3VFSA 1M53A 4F2MA 3FNKA 3FTZA 3QUZD 2AABH 3NCYS 4KK8D 3NAAH 4OJAA 3MRBA 1AHMA 3QRGL 4K9EL 2G3MA 5F1NA 1CQYA 1J48A 1NL0H 2GJ6D 3CVDA 4XXCC 1ID2A 3V5HA 5IMKB 4Z7QF 1A1NB 1V3JA 3QFDB 4LPXA 4GSDH 1FVEB 3GMOA 5GIRB 3GWJA 1DJWA 4I48B 1BQ5A 2X44D 3CX2A 4MB3A 4WHYH 1GY2A 5H94B 3ARBC 3TVMD 3GSNA 1GGIH 2Y36H 3SOBH 3WEOA 3FTGB 4XVOA 4J1UB 3BFQG 3U7YH 5DHMC 2BCMA 2BNUA 4YGVA 4X6CA 4JO3H 3DPDA 3V4UL 2HLAB 3PL6B 3PGCB 5CEXB 2IO5A 4N9GA 3JT0A 3LN4A 2P80A 3CXHJ 3OGOE 1DLHB 4EUPG 2XWDA 3CX5K 3GMLB 5ADOL 2L3BA 3GSNB 5A2IH 4MX7A 1PQZB 1XCXA 5IJBC 3B7RL 3EOTL 2CPUA 4BELD 1Z6JT 3OKMB 4JFQA 4ZMAT 1FHGA 2X1WL 5K39A 3SGEH 2YD4A 2AJXL 2VMEA 1Y6MR 2EDQA 5DS1A 5CS7A 1X9UA 2EEFA 3OJDB 4BD4A 1P9MC 4XP5L 3MBED 1TVHB 3DXAB 3LV3B 5JORA 3G5XA 1I4FA 1GTFA 2G5UA 2FL5A 3PDDA 1K2DA 4ZMPA 1TZIA 4OM0L 4ZW5A 3VVVA 2DH2A 1AXSB 4GI8A 3MNWB 4NGHH 2Z93B 1BX2B 4H1LA 1TCMA 4Q0XL 2H0EA 3PAYA 1CB4A 5AVRB 3NIGB 2XSKA 5KBPA 3FT4A 5DGQA 4A2MA 4AXWB 4DOHB 1QA9A 3VQ2C 4JO4L 3DVIA 3K4DA 3DC0A 5EF3A 3VXRB 1HXYB 1EPFA 3EAKA 1GY1A 3Q5TA 4HCRL 3N0PB 4HIIA 4ZFGL 2H1LM 1G7JA 2Z8VC 4NO5A 4OZ4A 1E5CA 4WI0B 2HX8A 3ALPA 1ADQH 4ELDA 4ZFGH 4FADA 2IQAA 3VYOA 1QRNE 1SXSA 5TDPB 3PHOA 4NM8L 5B8CB 3E2HB 3NK4A 1IZKA 3B9KB 2FEDD 1E6JL 3HZYB 1Z1WA 3JTSB 3UROR 3RWCA 2R2HB 1A1OB 3F8UB 4WZ9A 1K5NB 5DVKA 2BOLA 4HPHA 4JGUA 2BVYA 4GUPB 2C5DC 5PCYA 1NCDL 2GW5A 2MHAA 2VTFA 2NY5C 4N9GB 3PHOB 4X7DC 5B8CA 5IQOA 2WO4A 5E8DL 4DP8X 1TZHB 1XGRA 1YY9C 4JZNB 2P24A 1LEGA 3EGDB 1RUPL 2P5PA 4D8PA 4FQQB 1HCYA 2OMXB 5HVHC 4FTVA 5E5MB 4PV8B 1JF1A 1XEDA 5DZ9A 1OPGH 1PKOA 1M42A 4ETQB 3D3VE 4AEHH 5I0YA 4UV4L 4LLMB 2BS9A 3MV01 3PHQB 1KIUB 3O8XB 4PCKA 3TNMA 5FGSA 4L5FH 3AU0A 3ASOB 2VW6A 3L7EA 3VRJB 5IJCC 3W1ZA 4NQVB 1U8HA 2Q8AH 3CZSA 3V5DB 3EGXA 4OU3A 2DZEA 5F2FA 3APFA 5HGAB 3LKRA 2PCPA 5HJ3B 1PD0A 2D4FA 4GRMA 2Q76B 3F7KA 4DGUA 4ZAKA 2W07B 4XC3L 1YEJH 4UQ3A 2PWGA 2H3XC 1V55B 1KIUA 4XB8A 3MRNA 3DYOA 1KPVB 4P2RA 4J8RB 5D7JC 2AQ2A 3MUY1 1E3XA 3CIQA 3LNFA 1KGCD 4M7KH 1IL1B 2DYSB 5HJ3A 2E46A 3O2VL 4Y1AB 2Z8WC 4MDIA 5DC0A 1G7JB 3L4XA 1PEZA 2OMTB 2CUHA 2G4EA 1V8HA 3HI1A 3WMQA 6CGTA 1WAPA 2Y6TE 4FXLA 3IFOA 4IU2B 2NOYA 4B5EA 2EDOA 4NJAH 5MENE 1Y0LB 4PU2A 3CK0L 3ARFC 1XDTT 3MRQB 3QULA 4LFHD 5LXGH 3KPNB 2FO4A 4UNVA 1N6QL 2MKLC 3BLKA 3PNWB 1EFXB 4BRVA 4WFGE 4LLVA 2IBGA 5DURD 3SGJC 5T3XH 5JHAA 5I9QB 3H2QA 2Q20A 2W0LA 2KZ1B 5I75B 1XCQB 2VMFA 3SCMD 5E24E 2XIDA 3T0EC 2VQ4A 1G6VK 1MREH 2FD6L 4PP2A 4D0BA 4OIAA 4WO0A 4MX7B 4J3TA 3MRJB 3DJSA 1EFXA 1X7TA 1ETJA 4K5PA 2BSTB 4S10A 5CNHA 3RGVD 1KIRA 4F7EA 3UYPA 5BUGA 1ZHBB 2PNDA 5H37H 3WO3B 4HWEH 1M7XA 4JGJA 1DVFA 3NA4A 3WNPA 4E0RA 5E2TL 4HQQL 3D2TA 1KBWA 2FVNA 2OSYA 2XUWA 4AM0A 4X6EB 5CBAA 3II3A 4DKEL 1NWOA 3CE1A 2KL6A 3DETD 5E2TH 5KVDE 4K55A 5E9AA 2V2TB 5J6HA 3RZCB 5DO8A 2MRYA 5KAQG 2QFPA 4N2BA 3WS6A 1J5CA 1GMEA 4X4ZA 3GS4A 1TJGL 3IBOA 2XHNA 1MPAH 3QZMA 4HU2A 3AWGA 4R2GB 1FLRH 3R19A 2VDRL 4BK4A 4J8RA 3VXQB 2EKSB 2EYTA 3HI6H 4HGWB 4U1HB 2E0PA 3MJ9H 4XX1E 4NX0A 5M94B 4NM8H 1NAML 4PLKC 3MBEB 5EUOB 1F4YH 2ZJSH 3W2DL 3DYPA 1W16A 2JSFA 2NX5D 2XZAL 3GM0A 5AVQB 4DGYH 4OV5B 4BSWB 2R29L 4GRLC 4X4XA 1H5BC 1KTDA 4ELME 3SQRA 4POZC 2GSIB 1T0MB 3EBGA 3TBVB 1I9JH 3LZPA 4G8IB 4HGWA 2VISA 4YHZL 3PWPA 5ID1A 2MTPA 1ZA3A 2HTKD 2WN3A 5DQ9A 1NSNH 3AXIA 3OG6B 5F6IB 3AG2B 3BH8B 5EF2A 4ZMTA 1JK8A 4K94L 1NGQH 1KC5H 3GSWA 2DQTH 3QUHA 2EADA 5FM5O 1JRHH 3D4CA 2VW7A 4ZS6C 5CN1A 3TONA 1Z9OA 4JY4B 4DPAX 3QISA 1NIAA 1CL7I 3C60D 4FNPA 2VXTH 3PPEA 1HCZA 5TF1H 5CGTA 2CRMA 4P57A 5E5UB 2CO2A 3AG4B 3S98A 1ZGLP 4KNTA 3WHXB 4ZTPL 2EDKA 4N90D 5A7BA 4JB9H 4JJ5A 4X4ME 4PI2A 4AL8C 1EFXD 5JIIA 3V9CA 2A77L 2WWNA 1WAAA 3OZ9L 1FNSL 3Q1EA 1ZGLA 4LSUL 3NIFF 2FWLB 3CFDA 2JJSC 1MY7A 3ULUH 2WXPA 3SKNB 1XZ0B 3BFOA 1WAAF 4MYWB 3U46A 1OANA 1U0QA 3VE0B 5E6YA 2DS4A 1J8SA 3GMNB 5EZLB 3BGAA 2QVTA 1DJIA 1K4DB 4FQCL 1I3RB 5JZ7D 4WK0B 2DYPB 1JE6A 1G7HA 1A66A 2AV7B 2ZUYA 5TDNB 2ZUTA 2B59A 1AHWC 5FF6A 5AG9A 4R96A 4N0UE 5C92A 5IV2A 4PWKA 2DWXA 3ARGB 4TRPL 3VG0L 4ENED 5MEPA 1V7ML 5B1BB 3UTTE 2ZZUT 2XWTB 4PCTA 4LBEB 4LEEA 3ZE1B 1UWEL 1T20A 4N2KA 1DANT 3QIWC 4CNIA 2ZCHL 2AQRA 1X5IA 5IZ7A 2ATPA 1MKFA 4HJTA 4LP5A 1CXFA 1XSIA 4W9ZA 4ZFOB 4LPUA 4UM9A 3IXAA 3N1GC 4RQQB 2B14A 1RIHH 2MQ3A 2RQEA 4A7TA 2RAMA 5BJTB 4JRYB 5EORH 3L5WB 4JRXA 1IM9A 3QEQE 1AIFA 2DQEL 4U0RB 4Z7OB 2DLFH 1ASOA 4FL4C 3TEZA 2DMBA 3B2MA 2A6DB 4TKWA 1KWKA 1K85A 1X5YA 4U6VH 4OUUB 1R5IB 1YUHB 2GAZB 4KKBD 3UXFA 3ZE1F 4F58H 1G1OA 3S3CB 2NNRA 4Y2DD 3P2BA 1GKOA 4IRJD 3Q2WA 5EMYA 5I0VA 2UYLB 4XMPL 2XA3A 3WD5L 1J9RA 5MP6L 5DD0H 3AQXA 2DIAA 2DQHL 3A6BH 2AABL 2OMBA 3ARQA 1D5ZB 3LOWA 5I9QC 4OLVL 4L18A 4IOIA 4FXGB 3V0AC 1LK2B 3ARGC 4DP5X 3LZOA 3JZ7A 4HBQA 3S3PA 5CBAB 2ADYA 4NUGL 3VD1A 1QI4A 2A73A 1GZQA 2BH0A 4XNQA 3ATFA 1I8IB 1JTPA 3HBQA 5TGBA 2BHUA 4PJ9A 1EHLL 2HJFA 1N0LB 3ELQA 2AP2A 3SKOB 1BVLA 2IOIA 5GQBA 3V4UH 4Q2ZB 3PY9A 2EZ0D 1YEWA 3NSYA 4WTZA 1IV8A 4K7FA 1XO8A 3JWDH 4XC1L 5I1EL 1KYFA 3WIHA 3C2SA 2XWJA 3QEQD 2OA9A 4GKSA 5C0BA 2WP3T 3MACH 4JAMB 4UTAL 4XC1H 1XF4A 3GIZL 1F58H 4K2UH 3WHE0 1F86A 5KZCD 3GXIA 2QT6A 5HI5C 1LP9A 3SD2A 2R0ZH 4MXVF 4POYA 4POUB 1PNCA 2O5NA 3PCYA 2BWQA 1OSPH 4JUSA 4WFFD 5EPMA 2P8MB 4BUGA 3K3QA 5JPMA 3BUDA 4TUOB 1OP3K 1RMFH 2JELL 5KOMC 4ZOBA 4P3DB 3BKMH 1W80A 1AC6A 2NY0B 3LHPH 4DFHA 2AQ1A 3IAPA 3Q5YA 1G87A 2YQBA 4IBUA 2TSBA 4WTQA 3CHSA 3B83A 4IRZA 4Y9BA 3GMPA 4OIFA 2JB6B 5D4JA 4O4YH 5GZNC 5IHLB 1UENA 1KELH 1A14H 1EBAA 1V3KA 1DBAL 3CZGA 3MROA 2NUTA 3UG4A 4ATWA 5I0WA 5DLLA 5SWSD 2E9BA 2R69A 3GBMH 4OIIL 1Q90A 2WQRA 5I8CA 2IBZY 4KQ3L 5CLYA 1T1XB 2PXYA 5CN3A 4Q7DA 3S36L 2VJ0A 4L1BA 2XDHA 1IQDA 5DR5L 2DM7A 2AV1A 1L9PA 1IM9D 3FF8A 1NGYB 4RFEB 3QT2A 4PIBA 3V52L 5IW6A 5GS0D 3R4DA 1DBJH 4JRWA 3I6GA 4MCZB 3IGKA 2BSDA 2ZUQB 3K4AA 3MLSL 32C2B 4M5ZL 2CQVA 1T4WA 4OAWB 3DVGB 1T1XA 4XNBA 2NX5B 2MMXA 3KXFD 4YBLC 4IRJA 3WFBL 1NICA 1A1MB 2JTYA 3B9KC 2ESVE 2L0DA 3PWPE 4NP4L 2GEQA 3FU5A 4U3XA 2X2HA 4KJYA 3MX0A 4OD3H 4QMEA 1A3LH 4L9LA 2MNJB 2RJMA 4Y2OB 2EE3A 5DJDA 4ZX5A 3WFBH 1P84J 2VKXA 4HWBH 4GP4B 4RISL 5TK2A 1B0RA 5KVGH 3MA7A 4KU1A 3E6HA 1KBVA 2D7QA 1A3LL 5ANHA 4ZW3A 1AD0A 2HKHH 4Z7NF 4PJFB 3NGBC 1ZKAA 4I8DA 4ODBD 2OLDA 2EIEA 4WI2A 3G6AA 3EHBC 2CLRB 1U58B 5C0JB 4LCIH 2EXYC 2WBJA 1O0VA 2E59A 5HI4D 4CMMB 1K6QH 3AM8C 4N2CA 3WTWA 1MCBA 3Q8AA 5E6UB 2ODIA 1AO7E 1ACYL 5FCUH 3M6DA 1EEZB 5D96C 4P5TC 4GW5B 2ARWA 4JFHE 1IIKA 4NRZB 4P3DA 2G2NA 4YDVA 3EFOA 3N55A 1XGPB 4WKZB 1T1WA 3WD5H 1XMEB 4OT1H 4WU7B 1MLBA 3NQKA 2AJZA 4ZUUA 2H26B 5T1LD 5D2NE 4QRPD 1IMHC 4U6XB 1CFBA 1UFUA 3DUHA 1S78D 5JHDA 5L0QB 3CXHK 2FJGA 3CQQA 2NYKA 3TZVC 2VC2B 1VACB 2AJUL 1S9WA 1F6LL 4M4RB 4XXDA 4NUGH 2Y5TA 3ZR5A 5JDJA 1U92A 4RWHA 1AO7B 4R26H 3VD7A 1YSOA 2C3WA 1F11B 1BEYL 4G6JH 4QAMB 4D3CL 4HBCL 4YAQB 1GJIA 5KSVB 3TO2B 4E42B 4GUQA 5BO1L 5JHDB 4J3UA 1WA0X 3PL6C 2UY6A 2ZP0T 2A38A 4W93A 1A7PL 2MCMA 3ZE0E 1JZ7A 2R23B 4AVKA 2G2RB 1GGIL 2Y36L 4W1TA 3GXNA 4HMDA 3S96B 4AL8H 4JFEA 2GYSA 2DQJH 3AG3B 4P2OD 5AZ2L 1Q0YH 3QCVH 4WENB 5B39G 5SWZA 5K9OB 2H2SD 3KDMA 3DX6A 2HUEA 4LBEA 1BEXA 2XTJE 4LLMA 4PCSA 5C08B 3SDAB 5KSVA 1URIA 3CIAA 2FQFA 4G6MH 4UZSA 3SODB 3TGXA 1GVIA 3P9LA 4G5ZH 5IM7A 3QDMA 5C0NC 4FNSA 1F3RB 5BZWA 1Y7VA 3UC0H 5JHDE 1MREL 4Y19D 1AMYA 3II2A 1MELA 2VDKL 3GRWA 4NRXA 4QHNB 1TO5A 1HQRB 4OCYL 2KT6A 4WW2B 4UQCA 4QRPE 5AG8A 4Q6IC 5HDOA 1DHKA 3V6BR 3ZKSD 5DCCA 3BP6B 3O0RH 1SEBB 4JHBA 2Y2YA 4QRSB 4BZ1H 4AZUA 4AUJA 4PJ7B 3HEIB 5K9JH 1L4IA 4AQOA 3GM8A 3V8CA 5AB1A 4LESA 3IDMA 5KSBB 2H4EA 2VLJA 4RBPH 1G94A 1DEDA 3VI3E 3REWA 5TQ2L 5E00B 4XMKL 2BERA 1IGFH 2FB4L 4Z0BH 3RTQC 4ACPA 3BIKB 4TQPA 1N2RA 2E75C 2CNYA 1P4BL 4H2AA 3BZEB 2VDOL 1XHHA 3CFKB 1EMTH 2CIIB 2R2EB 4M7LT 2CK2A 4PJ7A 4XMKH 3LIZA 4XCEA 5K1NA 4L8SB 3QWQB 4W4OA 3B2XA 3QQ9C 2DMKA 3QZWB 1ZLVH 3MA9H 4XBMA 3LXBA 3TOPA 3ULUD 1RZ8B 2GJPA 1JG9A 5L0QC 3FB8B 3S8FB 1BVLB 4YZWA 1JNLL 1NTDA 1FO0A 1WVZA 5GIRA 1CZ8H 3RVXC 4XN5A 1B3IA 4YXHH 1RV6X 1ONQB 3UBHA 1UEMA 1A7RH 2HXAA 4PB9H 4Q89A 1EZVY 1YA5A 2VZTA 4EI5B 1P1VA 5BUAA 4AKOA 4P4KD 3U6RB 2Z4TA 2DWYA 5LKNA 3N5AA 3NCWA 4ELKB 1AR1D 4P23C 4O2EA 4CVXB 3FQXA 1UHVA 4FNLL 4G8FA 1A6TA 4EN3B 1WZKA 3CZUB 3VD9A 1N8OE 3CV5A 4JFEE 2UVEA 4A67A 5IQMA 3VB8A 1N7ML 4DGVL 2X09A 4BZYA 1HJCA 1O9WA 4M56A 3HC0B 1SHMA 4DT2A 4C83B 3IXTA 4S1SL 3ARUA 3ARWA 3T6QC 2QELA 3W0WE 5KSAB 4O5LH 1BQHA 3QIWD 2YPLB 4HPYL 3BQUD 4PJCA 4K8RH 2E6PA 4G7YH 4HWZA 4XNMB 3TNNB 5GJTL 3WCYA 5ITBL 3RY4A 4KXBA 2YSTA 3KYNA 3WJJC 4HUVB 5CZVL 3ZHLA 2YAMA 2A9NL 1ZLSH 1A7OH 3P77A 2W0PA 4UT9H 4X7TA 4G7YL 4J3OC 1RU9L 5KW9H 3NIDB 3SPVA 3BLBA 3PWUA 4WNSA 5BUPA 2VISB 5EZOL 7PAZA 4AEIL 4LL1A 2BIOA 5F44A 2FK9A 4N2OA 1TF4A 2BC4A 2CO3A 3QNXA 4AYFB 1Y07A 4FE9A 3MUGB 1Z0NA 3OAUH 4CVZA 1YDPA 2DF3A 1MHEB 2P45B 2HJLB 3T2NH 1NC2D 3VFTB 4B27A 3L3KB 4Y2LA 2X4UB 3K46A 3DIFB 3C6SA 1NA8A 2EC9T 2GFBA 4JFOA 3DYMA 4NZJA 1H6EA 2QVMA 4YGVB 5DJZA 2XPZA 3TEWA 2Y9RT 1AKJA 4JRXE 3VDBA 2B5IC 1PYWA 5DQJA 3UG3A 1I53A 4APQC 3VFRB 5IWLC 3MUGA 1K3ZA 4DO6A 2XV2A 2DJUA 2VL4A 5I19L 4BWUA 2YC1A 3NCXA 1OEZW 4R7NA 5E4OA 1PLGH 5LAXA 1J1PL 2BVQA 2WIIB 2ZT9C 2QMKA 1MAML 2VR4A 6FABL 3T3ME 3QIUB 4HJIA 4LEBA 3EYQD 1W72B 3HJ0A 4YDJA 4MVBC 1AZRA 2KZKA 1O7VA 2GK0B 1VKXB 1RPQA 3CC5A 4PMFA 3QC6X 2I24N 4LSTH 1F6AA 3QP3A 4UYPA 4ZUWA 5C8JA 1KXHA 3OAYK 1EXUA 5TQ0H 5DD6B 3NVQA 2GSMB 1DFBL 2NY2B 5IIEA 5KSAA 1BOGB 4LSTL 1LMIA 5CD3A 4PSPA 4H5SB 3W81A 3CFEA 4IBQA 4XNZB 4NLAA 5DJ2A 2YAPA 2NSQA 1UM6L 5GGSA 1UVQA 3K7UA 1BVKA 1W0VB 2OCJA 1UACH 4MNGE 3D69B 4FFWC 4NNXA 5DURB 3QR1A 3L6FA 3MKGA 1KPVA 4DGIH 5DEGA 4C55A 3SYCA 3BSHA 3V0EA 3IDYB 3L54A 4FNRA 2ZJSL 5GS2D 4WU5A 1RL1A 5IJKA 1XSOA 2BOBA 4DGIL 1L7TH 2P5WD 4Y1AA 5IVZB 5DMGC 1JUFA 3ASNB 1FN4B 5DYFA 5JR1H 1IGIL 2F18A 5E8DH 5F7EL 2KS0A 4Z3HA 5CILH 3D39D 3EYSL 3VSTA 3KPSD 3D30A 3IJHA 4H8WH 4G8GA 4ERSH 3RDJA 3L3JB 1F2XK 3E8VA 5JHLH 1BQLH 4HV8A 3RVWC 1IEAA 5MEND 3FAXA 2CKBA 2CR3A 1T2QL 3ESMA 4PJAA 4E2OA 1JXDA 1YEFL 2OXHA 3LRHA 3N9GL 2P80D 1T03L 3HS0B 1GGUA 1KPRA 3JSSA 4ZPTB 2WSKA 1LE5B 1HKLH 4P4RA 3ETTA 1SDDA 4QXUL 1E8WA 3OV6A 1CT8B 3BSZA 1HZKA 3VMOA 5FOBA 3K5RA 1Q72H 3NN8B 1L0XA 2QPEB 3ZE2E 3M86A 5CSZA 2QHRL 1A0QL 4PJAB 4PYHA 1KIRB 2X4TB 1EHXA 4DEPC 4ABQA 3Q1SL 1S3RA 2ZSVA 2FATH 2XZQH 1DVXA 3B2PA 5BV7L 1A0QH 3FONA 4U1KB 1PSKH 3UAJC 2ZG3A 1OW0C 4KPHH 3L3GA 4PVLA 2BDNL 3H3PH 2DQCH 3J27A 3OHXA 5D7JD 4YUEH 5AUMB 3MN8A 3B7TA 2OZ4H 1VPOL 4MQ7B 4YFEA 4KPHL 3CVHH 3RNKA 2F8XC 4XBEL 1I7RB 1HE8A 2FR4B 1M1SA 3PUUA 1UB6B 5DSCA 4R4NC 1WT5A 5DFAA 4G9DB 1ID5I 3QNXB 2F53D 4ADJA 4AYFA 3HAEH 4KO6A 2H5UA 5HHME 3H6AA 3IPFA 1HSAB 2ADGA 2KDGA 3O6FA 4G42B 2LU5A 4JZJB 4X0KB 3NH7H 3FUJA 1JYXA 2IAMD 3GXFA 4IRSC 4G1EB 1ICTA 4PJDB 4PLJD 4U1IA 5IFJB 1HAUA 1U8OA 2CDFB 3D3VD 4TVPD 4BINA 3AACA 3VXOA 4POZD 1VEMA 2GSIA 4JCWA 4EN3D 3MLVL 5AB0A 5FO9A 5HXMA 2ZOWA 3KJ6L 5B38A 1RZGA 5EORL 1NCBH 4ZW8A 3CVIL 3MCYA 3PL6D 1HSAA 1N5YH 1VFUA 3CSFA 3ULVH 1GZPB 4CKQA 1FFQA 2EC9U 5IB1A 4M29A 1CGXA 4BYHA 2OKMA 3FCSB 2WWKT 4DESA 2R4RL 3AY2A 4FNUA 1UKTA 3RWJB 3VXSA 2XPYA 3RPBA 2XA8L 1GOFA 4EBQL 5EBMA 1INEL 5TH2A 1OALA 1ILUA 6TAAA 4EIZC 1UJTA 1MJUL 2YMTA 2ZCLH 3CCHA 3MKKA 5FGCB 3FO1A 2VXSL 3KLLA 4JO1L 1GOGA 3ELAT 2OW6A 2D73A 3DX8A 4B9JA 2WMPA 4LAJH 4YHOH 4JKNA 1UACL 3WIFB 4NC2B 4ZYKB 3RP1A 5HYJD 4LFHG 1JDDA 3SPHA 5IIEB 3LDBC 2DTSA 3MJ9L 4AZ8B 4L3AA 2ZWKA 1AXTH 3LVEA 3MA7B 4ZQTA 4H20H 1SFHA 4FFZH 4X6CE 3B43A 1MCNA 5ICZB 2R29H 2AEQL 1GAFH 4G72B 4AMXA 2EECA 1XMWA 2GT9A 5D6CB 1I9JL 3HLKA 5C6PB 3KJ4C 2EYRB 3BGFC 2I7SA 5KS9E 2IJ0C 2HTKC 1OCRB 2MQ0A 2YQGA 1KOAA 4AEFA 1BWWA 3HOGA 4KKCC 5HJDA 1QQDB 4K94H 4AQ8C 4Y5YA 4R96B 2PPAA 3C5SB 1MI5D 4HKXB 1EO8H 4R7LA 4F8PA 2VDLB 4NWUH 3FTVA 2M1KA 5JUEL 4ANUA 4GBXC 2FNBA 5I1AB 4N0CD 3EXJA 5FUZH 3NTCL 3WDJA 4WUUE 1AQKL 2GEEA 3C60C 4A39A 3QHFH 5C0CB 2V3FA 4NWUL 3RWFB 4TVUA 2ZWLT 2LE9A 3ABMB 3GC3A 4OZHE 3H3KA 3VGFA 1KJ3H 2CJSA 3ZGIA 5KS9B 1OARH 1U8JB 2YUXA 3FMGH 1DDTA 3NZ8B 1IAMA 1L9NA 2DLIA 2LFGA 1UA7A 1OCWL 4HEME 4KKLC 5GGTH 3B37A 2BP0B 2A6DA 2LABA 2HRGA 4LPTA 4UZGA 1ZHNB 1F3DJ 4O02H 2FATL 1WEJH 2J5LB 3FT3B 3LPGA 4YHML 3RVUC 1JWMB 3TCLA 3MNZB 4XP6L 1WT5C 3FU7A 3P4NB 4Y1TA 4IRJC 3RWDB 4KQ3H 5DMIL 2F7OA 3VU1A 4OZHB 3JWNC 2EIZA 2BP3A 2DMGA 4YUEL 5AVYB 1K5WA 3ARDA 3PDGA 2R69L 3GUFA 1U21A 3JWOC 4KI5C 4PJXF 1ZSDA 1L9SA 3LRSB 4OJEH 4L29A 3GO1H 2QGDA 1L6PA 2XN0A 4MNQB 1G7HB 3HKZA 4AXWA 3ME0A 2X6UA 4L8DB 4WI8A 4ABWA 2ZYSA 3MRRA 3AT0A 3TBSA 1MCDA 3F83A 3WLBA 3RBGA 2EJ1A 5T1DH 3NPSB 4UBDC 2Q0ZX 4GOSA 1YO4A 3DARA 1BIHA 1N59B 2LQRA 3TN0D 1QATA 4Q97A 3QUMB 4IK7A 4I77L 4JL1A 2YAQA 4LVOB 4DZ8B 3FPYA 3IU3B 4JZJA 2R15A 4P59L 4X0KA 3WLBB 4L4TE 3JTSA 4DGVH 3QSKB 3F7LA 3F3HA 4LCIL 1PX8A 2Q6WA 2FSDA 3PQYA 2C3XA 4EN3C 4HJJH 1FCGA 2VDQB 3P2DA 4WJG3 1G9EA 3ZZ1A 1MW0A 4P5SA 3DOHA 2DD8H 4OFDA 4XPGH 4DN3L 5JPMB 1AACA 3LPFA 1RY7B 3SKUD 1PL3A 2J6WA 2JKJA 3ARRA 1EBPA 2YKLH 4G83A 4NQDA 5BVPL 2BWIA 1QWHA 1JZFA 4J1UA 1Z0MA 4P46A 5EWIH 3TIEB 4A7GF 1OWWA 5C9KA 3FSAA 1ZPUA 2XQBH 1BMGA 3NP4A 1MCOH 1PS3A 1ZK9A 5B8CC 3TYGH 1RZJH 1Y1UA 5H35B 4OLEA 3U4BH 3MTXA 1A9VA 2NQ3A 4FFZL 4X5QA 5I8CB 3PXHA 1S6NA 4PD4K 2BJMH 3DOIA 3BD3A 3O3DA 1FG9C 1I8IA 1IGJB 3I9GH 2RMNA 2JKWA 4ORGB 3ML8A 4LCYA 1VFAB 2NNXA 4XO8A 1XGUB 4YC2B 1N18A 3ZDXF 3CDGA 1I3VA 3IPEA 4PGCB 1LYQA 2UZXA 1JZHA 4GW4A 2H9GA 2WZ0A 2UV3A 4I3RH 4NQCE 4KBPA 3FUDA 4GAGH 1X6LA 2C34A 3GMQB 4QHUB 5GSVB 5AW4B 1BIIB 3NCYP 3CQFA 3WKML 4NCC1 4Y5VB 4MDIB 3EOTH 1QLEH 1XF4B 3NJFA 2V9TA 2BIHA 1U91B 4EXPX 3T1FB 2LU4A 4KXZI 3BKML 3VXRA 3BYYA 4GW4B 1FPTL 2V6HA 1TU2A 1ADWA 2EYSA 4KDTC 1EA9C 1P84K 1J8HE 1IBFA 1WF5A 3CBKB 4BA8A 1U2YA 3F84A 3KYMB 4J3VA 4HHWA 3S4SG 2QSTA 2RTTA 2ETWA 2R7EA 4F7MB 3B2UC 5IF0A 4NB7A 5CP3A 4FTDA 1I7TA 1XR9B 2DWEA 2EKSA 2EYTB 2K3TA 5HDBB 3GSOA 3S4SB 3OKOA 4LEXH 3VG9B 2GY5A 4I18B 3QUZC 2DIJA 2BVUA 3DXAE 5DRWA 3QNYA 1BG1A 3QUXC 2Y07H 3QZLA 2QMJA 4OFPA 3K6DA 3MYZA 1P7BA 1Q1JH 2XG4A 4F91B 4OJFL 2VGLM 4G43A 5EOTA 1WWWX 4AQEB 3AY4C 5LWYL 3HUJB 1PYWB 1O6VA 1F4YL 3OKOB 4Z0XB 5A6LA 5I0DA 4RNRA 5C0AB 4TYUA 3MRGB 3CFCL 5ILTL 3VXRE 5FGCE 3LKQB 1G1CA 3J2PA 4KJQD 1JRHI 4L2LA 4HHGA 2EDEA 5D6CA 4MXQC 4G9FB 5C0FA 4FP8H 4YFDB 3UGEA 4MBOA 1TEGA 4HJSA 2AGJH 2VABB 5A40E 4KTGA 2XT1B 3HR5B 1NGQL 4MJ4A 4W6WB 5GZOC 3RKPA 3KPQA 4N22A 4V2BA 3EJYD 3IDGB 2VN4A 4TTDD 4HKBB 4I77H 2WNKA 2Q76A 3O2DH 3ECWA 5IESL 4YK4C 4KVCH 3CXDL 1SHWA 2VDPL 2VR6A 3TA3D 5KVGE 4GG8B 5EEVA 1F90H 1UT9A 5D7SL 2WINB 5HHQA 1PKQB 3TN0C 6PCYA 4IKJA 2WBWB 1X5ZA 3TA4D 4NBXB 1UT2A 4AGMA 1KN2H 3IMSA 3AB0C 1WDAA 2J8UF 1SOKA 4GW5A 1TEFA 3FBQA 5D55A 1X7SA 3QZOA 5B22A 4AYSA 1CD9B 4HX1B 4JHVA 3RB7A 2DMCA 3KWTA 2P43B 1RERA 2QVKA 4WUUB 3V5HB 3EOBB 4R9HA 3QJTB 3DGGB 3QQDA 4OI8A 3AXHA 5DLMH 1G7LA 3JTBA 1BEYH 1M56B 3RX7A 5B4MD 4B6ZA 1FLTX 1G9NC 5E2VH 3UMTA 3UTPD 1MIEL 2ATPB 1RJLA 4GP5B 3CDZB 3SOTA 4XCYA 2EVIA 1VPOH 4PRHA 3SDDC 2FQGA 2GTZB 5ACLA 1MF2H 3CVHL 4LIQH 1M7DB 2DL2A 1AQMA 1S7VA 2B1AL 3HZYA 3IYLW 1RIVH 4H0GA 2D03H 3KW7A 4L8SA 4UQAA 3ROOB 5LXGL 1D5MB 4M03A 3QJVB 2P5WB 1C16A 2C3VA 43CAA 1JPEA 1XXFC 4FYSA 4NUPA 1A6UL 3QJFB 5J9PB 2Q3ZA 1AZVA 4IQHA 4MJIB 3CU1A 3RIAF 4N25A 4BKSC 4WO4A 1B2YA 3UJIH 4JFDD 5CSBA 1I75A 4AM0B 1CG9A 3F04A 3O3EA 1KV3A 3LAFA 2HRPH 1O7DC 4NO0B 5IY5B 2BOCB 3SE3A 4AMWA 1PLCA 3VD5A 4JZOA 4QIRA 3X2QB 4BZ2L 4CGTA 5K59E 2NDFA 3KPOA 1D5XB 3RJDA 1JHKL 5EOCJ 5EO9A 5EBWB 4Z7AA 4F58L 1E3FA 5DJXB 4UQ2A 4DEWA 1ZOXA 4AT6A 3CSPA 3CU7A 1EEYA 2MEJB 4ODTL 1DJHA 1R3JA 3WEXB 5ICYA 3F00A 4V1DD 2OX5B 5CCGE 4P2YA 1C08A 3G04B 4B7LA 5AOIA 2Y5QA 1GZQB 3V5DA 3V0VB 1T2JA 2ZXQA 5HI5D 1IKFH 1ITCA 1EO5A 2HFGL 4RIRB 4QYAA 1PZCA 3L5WA 4HIIB 4JRXB 1OCZB 3U4AA 4JDTH 4NENA 1M3JA 3WIIH 2A74A 1QZNA 1CL7H 5DSCB 1NBZB 2VDOH 3C6LA 1FZMB 4N2HA 5F7KC 1FNFA 4F92B 5JW5A 4MSWB 1HYSD 2KC0A 3WUWA 2FJHB 2Y6SD 3MRHB 1NDMA 5GSRA 3T71A 2WB1A 4J3OD 4MS8D 5ENWB 4J3SA 3QHZH 1JPST 2XTJD 3B5HA 4LU5H 4DGYL 3QZWA 5B38B 1DVFB 1KEGH 1MFDH 4Z5RA 1LXMA 3ZRSA 2CAKA 3OKEB 1OB1A 4QNPE 1N12A 3QNZB 2YD2A 5D7LB 1B6UA 5DVNA 3VXUB 3WUWB 1S78C 5EIVA 3EADA 2ITDA 4KKBC 3EDDA 2ROXA 4ELMA 2WLHA 2ZWSA 2XYBA 3R06A 4WUKH 1OSPL 1JDAA 2BRRH 5IJVB 5JW3H 5J9PA 5FA3B 1G7IA 3OX8B 1WAEA 3C2AH 4BEIA 3V95A 4APQD 1CD8A 4UDUA 1MCHA 3QIWA 4WKXA 4DKFL 3OHMB 5AB2A 5KBLA 4PRID 4BWWA 1COBA 4WCYL 3TBYA 1GPOL 1HEZA 1XV8A 3HC0A 4B0MB 1DBAH 3PREA 3GSUA 3NJXA 3C5JA 5FUOH 5DJXA 1B88A 2OM5A 2Q7YA 2WINA 5HHQB 3ARPA 1Q72L 2RQ8A 3ARDD 3UTQB 5FO8A 1RU9H 2BXZA 1YYLL 5EU3B 3BGMB 4U0QB 5FWQA 1NPUA 3LRLA 3PUCA 1B2WL 3D25B 2GBVA 2YUZA 5FYKD 3QPKA 1T83A 3ZU8A 1EGJH 1CGSL 4BDVA 5L2KE 4X7TB 5DD6A 3CFBA 3D39B 3I3DA 2OK0L 2DBJA 2ED9A 2F58H 5AENA 5KVMC 2HAZA 3KGTA 5I6KA 1S7UB 3BVTA 4RQQA 1QYGL 1BZQK 4N68A 1ZPLA 5D93B 5KBMA 1N4XH 2R1YA 5GRUL 3E6FA 2CKBH 1UJ3A 5D8JH 5B4MC 1SVBA 4QRPB 2QADC 4FXKC 4JQIA 3UACA 2FJHA 4K15A 4N0FA 4CUCA 3CH1A 3LKQA 3G08B 1FVDB 2XOTA 5FB8B 1Y6NR 5C0GB 3L8QA 4NERA 1DCLA 1QACA 1ULVA 2H6OA 4B5ZA 3T1WA 1UASA 3ZYZA 3WGVB 2X3BA 2WQAA 3BHBA 3C5ZA 5GJSH 4OB5L 1KGXA 2GCYA 4X6DF 1BQUA 1DJSA 4JZNA 4P4KA 5K59F 2DEWX 4X5XB 1R3LB 5FV2A 4F7CA 3OPZL 2XU9A 4G7QB 5IHWA 5IVZA 4J3WA 2H6UA 2E86A 2HVKA 5K93A 4JZJC 4X4YB 5I1GH 5LG1A 4NAQA 4G7VL 3JVFC 5DMJB 4CILA 1MRDH 3H9SB 5GHWH 4B9ZA 3INUL 3AITA 2XC8A 1KPUA 3NMEA 5B21A 4IS6A 2CUMA 1U4EA 3KVPA 1CLYL 4E9XA 1DQIA 3CWGA 4NQVA 1JFQL 4HD9A 1P2CB 1W72A 3MYJA 4WSKA 2OYKA 4XNQB 1D5XA 4ODUA 4NN7B 2B20A 4ODVH 3LB6C 1M2VB 4HUWA 5H37G 1JGVL 1YNTA 4NUMA 3S35X 1QHQA 2PCYA 4XPBH 1INEH 4FQXA 5FFLA 4AX3A 3FB7B 5IW3A 5MP6H 4ZMYA 1NGWB 4BJLA 4AVHA 1T6WA 3QUKA 1CL7L 5CD3B 4NDMB 3HNSH 3PWNA 1TQVA 4PTUB 4JFFE 1NPJA 2ISDA 3RGHA 2XX1A 3OBAA 3IJSA 3DUUB 3TJPA 3B56A 4PS7A 5FCSH 3C8KB 4OD1L 1YEEL 1TETL 3RWGA 4A6YB 4ANVA 2CA3A 3GRWL 4UT7L 5T5FL 1URZA 3HPLB 2PLTA 4M43L 4R2GC 2VERA 2XV3A 5D1QC 3S88L 2DQGH 2WYIA 2YO3A 1FORL 5AYUL 3FB5A 4AKPA 5IVXA 2ZD0A 2IAND 4GMSH 1OP5K 2YSSB 1OTUC 2AI0L 2H3NB 2YGNA 5C2UB 4G70B 4DOHE 3DX9B 4WWOA 5CHNB 1XH0A 5D70L 4RX4A 3Q3GB 1UT1A 3FOMA 3IGAA 3TWYA 4ZX6A 2VDKB 3IS0X 1PZ3A 1BQLL 4QRRD 1SEQL 1F0LA 1W8OA 4KROD 2DJSA 5EC2B 4QXVA 4F24A 3FB5B 1YEDB 1G7QA 4OCXL 3NIDE 1DVTA 4AYMC 1AO7D 2CRYA 3EYOB 1B0IA 4YFLF 2J21A 4U4BA 2HJKA 3FOMB 1QRNB 4DQOH 5E6ID 3D9AL 3HZ3A 2G3XA 2G75A 3HC4H 1KCWA 5B3JF 1R19A 2A3TA 4NKQB 1H3PH 4DK3A 3VFMB 3NZUA 5CEYB 1AZNA 1LNUA 1KJ3L 1O7SA 1M9WA 3HN5A 3NCFB 3IDYC 2IADB 2NQCA 3VDCA 4AQ8A 5L6YL 3V6OA 2CJUL 2XN9A 3CVBA 2N1TE 3VD0A 3L7FB 3BW9B 4IIQA 2ZOTA 2FBOJ 3MV11 1CDIA 1OTSC 3TV3L 1S4IA 5SX4H 5JO5A 4OLWL 1CGSH 2YA0A 3IU4L 5DVPA 3MV8D 1KG0A 2BDNH 3H3PL 3ZTNH 4Z7IA 5A2KH 4LNVA 2WXQA 4M8RA 1E5BA 3NFSH 5IUCA 4XNZC 2VR5A 1ZANL 4CN1A 2FT8A 3GI8L 5LNDA 3P30L 1ETA1 5JPNB 4IKLA 2FGWL 5IV2B 3DX8B 3MLSH 1N19A 2E8YA 4OCNC 4JS7A 4PV9A 4MZRA 3STZB 3P0VL 1UGNA 5LDUA 1FZJB 1P7QD 1T83C 4F8NA 3P30H 2VN3A 1ZHLB 4Q6IA 1UH2A 4OZGB 5FIEA 5IVXE 5I1JL 4NT6A 3T1FA 3V6OC 2ENQA 3GO1L 3W5NA 1DJGA 4L4TA 4YSDA 3K72B 2XWJB 5C0BB 3S9DB 3AUVA 4PS4H 2W91A 4X8JA 5KJ7E 4HJ0D 3U9WA 4CJ1A 2ICCA 1QSEB 2X2YA 4FNLH 1DBBL