2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
3MZKA 4LGNA 2I3TA 4J77A 3SLED 5TF2A 4JSNC 4ZOZA 3ODTA 5EM2B 4QL1A 5EARA 5IC7A 3B7FA 4OWRA 4X63B 3IIWA 4J0WA 4GGAA 1A0RB 4FAND 5AJAA 3EI4B 4OZUA 4Y7RA 3HFQA 1SQ9A 4A08B 3V7DB 4JD2C 4QRJA 4A11B 3AH8B 2Z2NA 4ZOVA 5FA5B 3SXTD 2J56H 3SBRA 4GM9A 5TEFA 1GG2B 3NVNA 3JB9L 5K1CC 3AL8A 5EMLB 3V5WB 1RI6A 4JXMA 1NR0A 5HQGA 2UZYB 4J84A 3JZGA 3K26A 3RMZD 3E0CA 2HXCA 2J57G 4J79A 3J80g 1MDAH 2I0TA 2UZXB 4U1EI 4J73A 2O9KA 4FA4D 3SBPA 5FQDA 2CNXA 5EMJB 5EAMA 5TDHB 4O1QD 5C9ZB 4IMMA 4QQEA 3SN6B 4JSPC 2H9MA 3PVUB 3EI2B 5GXHA 3MZLA 2H47A 5A2Qg 5H17A 1L0QA 2QC5A 2HJ4A 3IKOA 4GQBB 3I7HA 5HE0B 4XYHA 2CE9A 1NEXB 5B4WA 3C99A 1SQJA 2AGWA 3PVWB 4Z8LA 4O3TB 4A2MA 3L4OD 5GMKn 4FA5D 4A2LA 2P9KC 3OKYA 4CI2A 3UKUC 3RRMC 5I5MA 2AH1A 4J82A 5IGOA 2OVQB 4K3JB 3UVNA 2GNQA 2PM6B 1SHYB 3MKSB 3PE7A 3OL2B 4GGCA 4BL0A 2GC4A 2H9NA 3UR4A 2HKMA 2YNPA 3C5MA 3I7KA 2CN3A 4IA9A 3OKWA 5KDOB 1VYHC 4ERZA 3UVKA 2PM9B 3RFGA 2H13A 2YBAA 3DXMC 4ERQA 4K3ID 2BBKH 5CXBB 3BG0A 4J0XA 3SMRA 3AL8B 2AGYA 3PXSD 3W15A 3I7OA 5FKQA 4CY1A 2W18A 1PGUA 3JROA 2QXVA 2IAAA 2TRCB 4AOWA 5EMMB 3SCYA 5C2VB 2CO0C 4QT8A 5FKSA 2YNNA 5CXBA 2H3XA 3GFCA 4PBYA 3AFCA 4PSWB 4E5ZB 4LG9A 2YMUA 3L4MD 2P9PC 3BG1A 3EI1A 5SXMA 2IUQA 3OW8A 3V9FA 2Z2PA 4GM3A 5EM2A 2P9IC 4FA1D 5CYKA 2XL2A 5EMKB 3NVXA 3DSMA 3VA6A 4H5IA 3SWSD 1PBYB 4A09B 1R5MA 2Z2OA 4CZYA 1XHMA 4CZXA 2Q7QA 3DM0A 3SHFA 4D0KA 2PM7B 3EI4A 4O45A 4A0AB 5H1MA 1QNIA 3UVOA 4L9OA 2XU7A 1Q47A 4FAVD 5GSAA 4A08A 4CI1A 4G56B 5HE1B 1B9XA 4XYIA 2I0SA 4JSVC 3FRXA 5I5JA 3EI2A 3A0FA 3VGZA 5IJ8E 4X60B 5JWZA 1JMZB 4FHLA 4O9DA 3OL2A 2IURA 4ES0A 3RN0D 4A11A 2H6NA 4PSXB 1ERJA 2P9LC 5EAPA 3I2NA 1K8KC 3OKYB 2XL3A 3DWLC 3SFZA 1XKSA 1N6DA 4L3GD 1JJUB 3P4FA 3EU7A 2PBIB 4L3HD 1GOTB 4EWRA 3PSCB 2AH0A 3PXWD 3UVMA 4KFMB 2OVRB 4PXWA 4A09A 4GZ8A 1MG3A 3RFHA 2IUVA 4LG8A 2B4EA 4E54A 4J86A 2PM9A 4I79A 2YNOA 1GP2B 4JT5C 5FKRA 1TYQC 2B5MA 5FKTA 1JOFA 4GGDA 3JAMg 1S4UX 5HE3B 5GXIA 3RN1D 4JT6C 2IWFA 2OK4A 5HYNB 3C9CA 3MKQA 4A7JA 2OVPB 4NSXA 3EMHA 4XEIC 2CN2A 3ZWLB 2CO0A 2B5NA 4BUJC 4PBZA 3UVLA 3CFSB 4CY2A 3EWEA 5IT9g 3BWSA 2P9UC 5FLXg 4Y5RD 2I0RA 2AGLA 3SJLD 1K32A 3MMYA 2GC7A 3EI3A 4A0BA 4BH6A 3I89A 2IUPA 4FWWA 2OK6A 3N0DA 3C75H 2CE8A 2MTAH 4CZVA 1YFQA 5K19A 2H9PA 1TBGA 2EBSA 3IJ0A 3OTTA 3F3PA 1N6EA 1OLZA 3AL9A 4CY5A 3FM0A 4UI9R 3F3GA 4ESGA 4J81A 5I5IA 2HESX 4J87A 1XIPA 3OKTA 4R7AB 4CI3A 2G99A 5FXYA 2HYEA 5CXCA 5C2WB 2H68A 4GQ1A 4J8GA 1B9YA 4GQ2P 3NVQA 3I8CA 5THAA 2P9NC 2HKRA 4HDJA 4TZ4A 2BCJB 2I3SA 3CIKB 3RLMD 3EG6A 3IJCA 4U7AA 4AEZA 4PNKB 5AMSA 3F3FA 3U4YA 3CFVA 1PI6A 4GMBA 4ZOYA 3JRPA 5TEEA 3EI3B 5IJ7E 1U2VC 3GREA 4X61B 4L1QD 4FA9D 4CC9A 3J81g 3UKRC 1PEVA 2G9AA 3ORVD 2P9SC 3VH0A 1MG2A 4PC0A 2H9LA 2H14A 3RSEC 4GM8A 3PXTD 5EALA 4J78A 2YB8B 4FB1D 2H6KA 3I7LA 4J8BA 4JSXC 3EI1B 4YVDA 2HJBA 4E5ZA 1N6FA 3PSLA 3SVWD 4E54B 1P22A 3N0EA 4ZOXA 3IIYA 3K27A 3JZNA 1JMXB 2J55H 4A0AA 2IWKA 2AQ5A 1FWXA 1GXRA 2H6QA 4CI8A 5HE2B 4MK0B 1OMWB 3KRXB 2AGZA 3IJ1A 4A0BB 4H5JA 5IGQA 5AFU3 3KRWB 3I7NA 4D6VA 4X3EA 2OIZA 3JZHA 5CXCB 3SBQA 3MXXA 5CYKB 3ULEC 4ZN4A 3I7PA 3I8EA 4ERYA 3JPXA 3DXKC 3FGBA 4N14A 4O3UB 4CY3A 2AGXA 5H14A 1U4CA 2OJYA 2XYIA 2B5LA
chains in the Genus database with same CATH superfamily
1VE7A 3O4HA 3MZKA 4LGNA 4AMZA 2I3TA 4J77A 3SLED 5TF2A 4JSNC 4DNUA 4ZOZA 3ODTA 5EM2B 3FCUA 4QL1A 5EARA 5IC7A 3B7FA 4OWRA 4X63B 3IIWA 1H2XA 4J0WA 4WJKA 4BCCA 4GGAA 5E6SA 1A0RB 4FAND 2JKXA 5AJAA 3EI4B 4OZUA 4Y7RA 3HFQA 1SQ9A 1UOPA 4A08B 4O02A 1GOFA 3V7DB 4JHNA 4JD2C 4QRJA 4A11B 3AH8B 3GC3B 2Z2NA 4ZOVA 5FA5B 3SXTD 2J56H 3SBRA 4GM9A 2VZ1A 5TEFA 1GG2B 3NVNA 3JB9L 5K1CC 3AL8A 5EMLB 3V5WB 4AX4A 3ZDZA 1RI6A 4JXMA 1NR0A 5HQGA 3IUNA 2UZYB 4J84A 3JZGA 3K26A 3RMZD 3E0CA 2HXCA 2J57G 4J79A 3J80g 1I2MB 1MDAH 2I0TA 2UZXB 4U1EI 4J73A 2O9KA 3T3PA 4FA4D 3SBPA 5FQDA 2CNXA 5EMJB 4IRZA 5EAMA 5TDHB 2VC2A 4O1QD 1E8MA 4MMZA 3V4VA 5C9ZB 4IMMA 4QQEA 3SN6B 4JSPC 2H9MA 3PVUB 3EI2B 5GXHA 3MZLA 2H47A 5A2Qg 5H17A 1L0QA 2QC5A 2HJ4A 3IKOA 4GQBB 3I7HA 5HE0B 4XYHA 2CE9A 1NEXB 5B4WA 1H2ZA 3C99A 1SQJA 2AGWA 3PVWB 4Z8LA 4O3TB 4A2MA 3L4OD 5GMKn 1C9IA 1BPOA 4G55A 4DNWA 4FA5D 4A2LA 2P9KC 3OKYA 4CI2A 3UKUC 3RRMC 1UOQA 2AH1A 4J82A 5I5MA 5IGOA 2OVQB 4QAMA 4K3JB 5M5VA 3QHYB 3NIGA 3UVNA 2GNQA 2PM6B 1SHYB 3MKSB 3PE7A 3OL2B 4GGCA 4BL0A 2GC4A 2H9NA 3UR4A 4Z7NA 2HKMA 2YNPA 3C5MA 3I7KA 2CN3A 4L1MA 4IA9A 3OKWA 5KDOB 1VYHC 4ERZA 3UVKA 2PM9B 4BCDA 3RFGA 2H13A 2YBAA 3DXMC 4ERQA 4K3ID 2BBKH 5CXBB 3IUQA 3BG0A 4J0XA 3SMRA 3AL8B 2AGYA 3PXSD 3W15A 3I7OA 5FKQA 4CY1A 2W18A 1PGUA 3EQ8A 3JROA 2QXVA 2IAAA 2TRCB 4AOWA 5EMMB 3SCYA 3VI3A 5C2VB 2CO0C 4QT8A 5FKSA 4BP8A 2YNNA 5CXBA 3GD1I 2H3XA 3GFCA 4PBYA 3AFCA 3NIFA 4PSWB 4E5ZB 4LG9A 2YMUA 3L4MD 2P9PC 3BG1A 3EI1A 5SXMA 2IUQA 3OW8A 3V9FA 2Z2PA 4GM3A 5EM2A 2P9IC 4FA1D 5CYKA 4UM9A 2XL2A 5EMKB 3NVXA 3DSMA 3VA6A 4H5IA 3SWSD 1PBYB 1QFSA 4A09B 1R5MA 2Z2OA 2VDMA 4CZYA 1XHMA 2VDRA 4CZXA 2Q7QA 2VDPA 3DM0A 3SHFA 4D0KA 2PM7B 3EI4A 4O45A 4A0AB 5C86A 5H1MA 1QNIA 3UVOA 1TYEA 4L9OA 3IUJA 2XU7A 1Q47A 4FAVD 5GSAA 4A08A 3K6SA 1E8NA 5M5SA 4CI1A 4G56B 5HE1B 1B9XA 4XYIA 1U8CA 2I0SA 4JSVC 2BKLA 3FRXA 5I5JA 3EI2A 3A0FA 5E6UA 3VGZA 5IJ8E 4X60B 5JWZA 1JMZB 4FHLA 2VDQA 4O9DA 3OL2A 2IURA 4ES0A 3T3MA 4RE6A 3RN0D 4A11A 2H6NA 4G1EA 4PSXB 1ERJA 2P9LC 1UOOA 5EAPA 3I2NA 1K8KC 3OKYB 2XL3A 3DWLC 3SFZA 1XKSA 1N6DA 3K72A 4L3GD 1JJUB 3P4FA 2VDOA 3EU7A 2PBIB 4D9SA 4L3HD 2QZPA 3ZE2A 1GOTB 4EWRA 3PSCB 2AH0A 3PXWD 3UVMA 4KFMB 2OVRB 4PXWA 4A09A 4GZ8A 1MG3A 1O6FA 1H2WA 2IUVA 4LG8A 2B4EA 3RFHA 4BP9A 4J86A 4E54A 5M5RA 3DDUA 2PM9A 4I79A 2YNOA 2HU7A 1GP2B 4JT5C 1JV2A 5FKRA 2WQ8A 1TYQC 2B5MA 5FKTA 5FFGA 1JOFA 4GGDA 2VDKA 3KCIA 3JAMg 1S4UX 5HE3B 4Z7OA 5GXIA 3RN1D 1VZ3A 4JT6C 2IWFA 3K71A 2OK4A 3O4IA 5HYNB 2EIEA 3C9CA 3MKQA 3O4JA 5FFOA 3QI0A 4A7JA 2OVPB 4AN1A 1T2XA 1YR2A 4NSXA 1C9LA 3EMHA 4XEIC 2CN2A 2XZGA 3ZWLB 2CO0A 2B5NA 4BUJC 4PBZA 5E6RA 3UVLA 1M1XA 3CFSB 3EWEA 4CY2A 5IT9g 3BWSA 2P9UC 5FLXg 4Y5RD 1O6GA 2I0RA 2AGLA 4WK2A 3SJLD 1K32A 4WK0A 2HU8A 1VZ2A 3MMYA 3MUOA 2GC7A 3EI3A 4A0BA 4BH6A 3EQ7A 4Z7QA 3I89A 3ZDXA 2IUPA 2EIDA 4FWWA 2OK6A 3N0DA 4JHPC 3C75H 1H2YA 2CE8A 3MVDK 1A12A 2MTAH 2VDNA 4MMXA 4CZVA 1YFQA 2EIBA 5K19A 2H9PA 1TBGA 2EBSA 3IJ0A 3OTTA 3F3PA 2HU5A 1UTCA 2VZ3A 1N6EA 3EQ9A 1OLZA 3AL9A 4CY5A 3FM0A 4UI9R 3F3GA 4ESGA 4J81A 3VI4A 5I5IA 2HESX 2EICA 4J87A 1XIPA 3OKTA 5M5UA 4R7AB 4CI3A 2G99A 5FXYA 2HYEA 5CXCA 5C2WB 4AN0A 2H68A 4GQ1A 4J8GA 4WK4A 1B9YA 4GQ2P 3NVQA 3I8CA 5THAA 3IUMA 1QFMA 2P9NC 5HDBA 2HKRA 4HDJA 4TZ4A 1JTDB 2BCJB 2I3SA 3CIKB 2XE4A 4RE5A 3RLMD 3EG6A 3IJCA 4U7AA 5M5TA 4AEZA 4PNKB 5AMSA 3F3FA 3U4YA 4G1MA 3CFVA 3NIDA 1PI6A 1VE6A 3ZE0A 4GMBA 2XDWA 3JRPA 3MUNA 5TEEA 3EI3B 4ZOYA 1U2VC 5IJ7E 2QR5A 3IULA 3GREA 4X61B 4L1QD 4FA9D 4DNVA 3ZE1A 4NC4A 4CC9A 3J81g 3UKRC 1PEVA 2G9AA 3ORVD 2P9SC 3VH0A 1E5TA 1MG2A 3O4GA 4PC0A 3IJEA 2H9LA 1K3IA 2H14A 3IVMA 3RSEC 4GM8A 3PXTD 4UM8A 5EALA 4J78A 2YB8B 4FB1D 3V4PA 2H6KA 3I7LA 4J8BA 4JSXC 3EI1B 4YVDA 4MMYA 2HJBA 4E5ZA 1N6FA 5M61A 1L5GA 3PSLA 3SVWD 4E54B 1P22A 3N0EA 4ZOXA 3IIYA 3K27A 2VDLA 3JZNA 1JMXB 2J55H 4NENA 4A0AA 2IWKA 2AQ5A 1FWXA 1GXRA 2H6QA 1GOHA 4CI8A 4BCBA 5HE2B 4MK0B 1OMWB 3KRXB 2AGZA 3FCSA 3IJ1A 1GOGA 4A0BB 4H5JA 5IGQA 5AFU3 4NAAA 3KRWB 3I7NA 4D6VA 4X3EA 2OIZA 3JZHA 5CXCB 3SBQA 3MXXA 5CYKB 3IURA 3ZDYA 3ULEC 4ZN4A 4NBMA 3I7PA 3I8EA 4ERYA 5C92A 3JPXA 3DXKC 4O2WA 3FGBA 4N14A 4O3UB 4CY3A 2AGXA 5H14A 1U4CA 3OF7A 4AMYA 2OJYA 2XYIA 2B5LA
chains in the Genus database with same CATH topology
3MZKA 4LGNA 2I3TA 4J77A 3SLED 5TF2A 4JSNC 4ZOZA 3ODTA 5EM2B 4QL1A 5EARA 5IC7A 3B7FA 4OWRA 4X63B 3IIWA 4J0WA 4GGAA 1A0RB 4FAND 5AJAA 3EI4B 4OZUA 4Y7RA 3HFQA 1SQ9A 4A08B 3V7DB 4JD2C 4QRJA 4A11B 3AH8B 2Z2NA 4ZOVA 5FA5B 3SXTD 2J56H 3SBRA 4GM9A 5TEFA 1GG2B 3NVNA 3JB9L 5K1CC 3AL8A 5EMLB 3V5WB 1RI6A 4JXMA 1NR0A 5HQGA 2UZYB 4J84A 3JZGA 3K26A 3RMZD 3E0CA 2HXCA 2J57G 4J79A 3J80g 1MDAH 2I0TA 2UZXB 4U1EI 4J73A 2O9KA 4FA4D 3SBPA 5FQDA 2CNXA 5EMJB 5EAMA 5TDHB 4O1QD 5C9ZB 4IMMA 4QQEA 3SN6B 4JSPC 2H9MA 3PVUB 3EI2B 5GXHA 3MZLA 2H47A 5A2Qg 5H17A 1L0QA 2QC5A 2HJ4A 3IKOA 4GQBB 3I7HA 5HE0B 4XYHA 2CE9A 1NEXB 5B4WA 3C99A 1SQJA 2AGWA 3PVWB 4Z8LA 4O3TB 4A2MA 3L4OD 5GMKn 4FA5D 4A2LA 2P9KC 3OKYA 4CI2A 3UKUC 3RRMC 5I5MA 2AH1A 4J82A 5IGOA 2OVQB 4K3JB 3UVNA 2GNQA 2PM6B 1SHYB 3MKSB 3PE7A 3OL2B 4GGCA 4BL0A 2GC4A 2H9NA 3UR4A 2HKMA 2YNPA 3C5MA 3I7KA 2CN3A 4IA9A 3OKWA 5KDOB 1VYHC 4ERZA 3UVKA 2PM9B 3RFGA 2H13A 2YBAA 3DXMC 4ERQA 4K3ID 2BBKH 5CXBB 3BG0A 4J0XA 3SMRA 3AL8B 2AGYA 3PXSD 3W15A 3I7OA 5FKQA 4CY1A 2W18A 1PGUA 3JROA 2QXVA 2IAAA 2TRCB 4AOWA 5EMMB 3SCYA 5C2VB 2CO0C 4QT8A 5FKSA 2YNNA 5CXBA 2H3XA 3GFCA 4PBYA 3AFCA 4PSWB 4E5ZB 4LG9A 2YMUA 3L4MD 2P9PC 3BG1A 3EI1A 5SXMA 2IUQA 3OW8A 3V9FA 2Z2PA 4GM3A 5EM2A 2P9IC 4FA1D 5CYKA 2XL2A 5EMKB 3NVXA 3DSMA 3VA6A 4H5IA 3SWSD 1PBYB 4A09B 1R5MA 2Z2OA 4CZYA 1XHMA 4CZXA 2Q7QA 3DM0A 3SHFA 4D0KA 2PM7B 3EI4A 4O45A 4A0AB 5H1MA 1QNIA 3UVOA 4L9OA 2XU7A 1Q47A 4FAVD 5GSAA 4A08A 4CI1A 4G56B 5HE1B 1B9XA 4XYIA 2I0SA 4JSVC 3FRXA 5I5JA 3EI2A 3A0FA 3VGZA 5IJ8E 4X60B 5JWZA 1JMZB 4FHLA 4O9DA 3OL2A 2IURA 4ES0A 3RN0D 4A11A 2H6NA 4PSXB 1ERJA 2P9LC 5EAPA 3I2NA 1K8KC 3OKYB 2XL3A 3DWLC 3SFZA 1XKSA 1N6DA 4L3GD 1JJUB 3P4FA 3EU7A 2PBIB 4L3HD 1GOTB 4EWRA 3PSCB 2AH0A 3PXWD 3UVMA 4KFMB 2OVRB 4PXWA 4A09A 4GZ8A 1MG3A 3RFHA 2IUVA 4LG8A 2B4EA 4E54A 4J86A 2PM9A 4I79A 2YNOA 1GP2B 4JT5C 5FKRA 1TYQC 2B5MA 5FKTA 1JOFA 4GGDA 3JAMg 1S4UX 5HE3B 5GXIA 3RN1D 4JT6C 2IWFA 2OK4A 5HYNB 3C9CA 3MKQA 4A7JA 2OVPB 4NSXA 3EMHA 4XEIC 2CN2A 3ZWLB 2CO0A 2B5NA 4BUJC 4PBZA 3UVLA 3CFSB 4CY2A 3EWEA 5IT9g 3BWSA 2P9UC 5FLXg 4Y5RD 2I0RA 2AGLA 3SJLD 1K32A 3MMYA 2GC7A 3EI3A 4A0BA 4BH6A 3I89A 2IUPA 4FWWA 2OK6A 3N0DA 3C75H 2CE8A 2MTAH 4CZVA 1YFQA 5K19A 2H9PA 1TBGA 2EBSA 3IJ0A 3OTTA 3F3PA 1N6EA 1OLZA 3AL9A 4CY5A 3FM0A 4UI9R 3F3GA 4ESGA 4J81A 5I5IA 2HESX 4J87A 1XIPA 3OKTA 4R7AB 4CI3A 2G99A 5FXYA 2HYEA 5CXCA 5C2WB 2H68A 4GQ1A 4J8GA 1B9YA 4GQ2P 3NVQA 3I8CA 5THAA 2P9NC 2HKRA 4HDJA 4TZ4A 2BCJB 2I3SA 3CIKB 3RLMD 3EG6A 3IJCA 4U7AA 4AEZA 4PNKB 5AMSA 3F3FA 3U4YA 3CFVA 1PI6A 4GMBA 4ZOYA 3JRPA 5TEEA 3EI3B 5IJ7E 1U2VC 3GREA 4X61B 4L1QD 4FA9D 4CC9A 3J81g 3UKRC 1PEVA 2G9AA 3ORVD 2P9SC 3VH0A 1MG2A 4PC0A 2H9LA 2H14A 3RSEC 4GM8A 3PXTD 5EALA 4J78A 2YB8B 4FB1D 2H6KA 3I7LA 4J8BA 4JSXC 3EI1B 4YVDA 2HJBA 4E5ZA 1N6FA 3PSLA 3SVWD 4E54B 1P22A 3N0EA 4ZOXA 3IIYA 3K27A 3JZNA 1JMXB 2J55H 4A0AA 2IWKA 2AQ5A 1FWXA 1GXRA 2H6QA 4CI8A 5HE2B 4MK0B 1OMWB 3KRXB 2AGZA 3IJ1A 4A0BB 4H5JA 5IGQA 5AFU3 3KRWB 3I7NA 4D6VA 4X3EA 2OIZA 3JZHA 5CXCB 3SBQA 3MXXA 5CYKB 3ULEC 4ZN4A 3I7PA 3I8EA 4ERYA 3JPXA 3DXKC 3FGBA 4N14A 4O3UB 4CY3A 2AGXA 5H14A 1U4CA 2OJYA 2XYIA 2B5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZK A;  4LGN A;  2I3T A;  4J77 A;  3SLE D;  5TF2 A;  4JSN C;  4ZOZ A;  3ODT A;  5EM2 B;  4QL1 A;  5EAR A;  5IC7 A;  3B7F A;  4OWR A;  4X63 B;  3IIW A;  4J0W A;  4GGA A;  1A0R B;  4FAN D;  5AJA A;  3EI4 B;  4OZU A;  4Y7R A;  3HFQ A;  1SQ9 A;  4A08 B;  3V7D B;  4JD2 C;  4QRJ A;  4A11 B;  3AH8 B;  2Z2N A;  4ZOV A;  5FA5 B;  3SXT D;  2J56 H;  3SBR A;  4GM9 A;  5TEF A;  1GG2 B;  3NVN A;  3JB9 L;  5K1C C;  3AL8 A;  5EML B;  3V5W B;  1RI6 A;  4JXM A;  1NR0 A;  5HQG A;  2UZY B;  4J84 A;  3JZG A;  3K26 A;  3RMZ D;  3E0C A;  2HXC A;  2J57 G;  4J79 A;  3J80 g;  1MDA H;  2I0T A;  2UZX B;  4U1E I;  4J73 A;  2O9K A;  4FA4 D;  3SBP A;  5FQD A;  2CNX A;  5EMJ B;  5EAM A;  5TDH B;  4O1Q D;  5C9Z B;  4IMM A;  4QQE A;  3SN6 B;  4JSP C;  2H9M A;  3PVU B;  3EI2 B;  5GXH A;  3MZL A;  2H47 A;  5A2Q g;  5H17 A;  1L0Q A;  2QC5 A;  2HJ4 A;  3IKO A;  4GQB B;  3I7H A;  5HE0 B;  4XYH A;  2CE9 A;  1NEX B;  5B4W A;  3C99 A;  1SQJ A;  2AGW A;  3PVW B;  4Z8L A;  4O3T B;  4A2M A;  3L4O D;  5GMK n;  4FA5 D;  4A2L A;  2P9K C;  3OKY A;  4CI2 A;  3UKU C;  3RRM C;  5I5M A;  2AH1 A;  4J82 A;  5IGO A;  2OVQ B;  4K3J B;  3UVN A;  2GNQ A;  2PM6 B;  1SHY B;  3MKS B;  3PE7 A;  3OL2 B;  4GGC A;  4BL0 A;  2GC4 A;  2H9N A;  3UR4 A;  2HKM A;  2YNP A;  3C5M A;  3I7K A;  2CN3 A;  4IA9 A;  3OKW A;  5KDO B;  1VYH C;  4ERZ A;  3UVK A;  2PM9 B;  3RFG A;  2H13 A;  2YBA A;  3DXM C;  4ERQ A;  4K3I D;  2BBK H;  5CXB B;  3BG0 A;  4J0X A;  3SMR A;  3AL8 B;  2AGY A;  3PXS D;  3W15 A;  3I7O A;  5FKQ A;  4CY1 A;  2W18 A;  1PGU A;  3JRO A;  2QXV A;  2IAA A;  2TRC B;  4AOW A;  5EMM B;  3SCY A;  5C2V B;  2CO0 C;  4QT8 A;  5FKS A;  2YNN A;  5CXB A;  2H3X A;  3GFC A;  4PBY A;  3AFC A;  4PSW B;  4E5Z B;  4LG9 A;  2YMU A;  3L4M D;  2P9P C;  3BG1 A;  3EI1 A;  5SXM A;  2IUQ A;  3OW8 A;  3V9F A;  2Z2P A;  4GM3 A;  5EM2 A;  2P9I C;  4FA1 D;  5CYK A;  2XL2 A;  5EMK B;  3NVX A;  3DSM A;  3VA6 A;  4H5I A;  3SWS D;  1PBY B;  4A09 B;  1R5M A;  2Z2O A;  4CZY A;  1XHM A;  4CZX A;  2Q7Q A;  3DM0 A;  3SHF A;  4D0K A;  2PM7 B;  3EI4 A;  4O45 A;  4A0A B;  5H1M A;  1QNI A;  3UVO A;  4L9O A;  2XU7 A;  1Q47 A;  4FAV D;  5GSA A;  4A08 A;  4CI1 A;  4G56 B;  5HE1 B;  1B9X A;  4XYI A;  2I0S A;  4JSV C;  3FRX A;  5I5J A;  3EI2 A;  3A0F A;  3VGZ A;  5IJ8 E;  4X60 B;  5JWZ A;  1JMZ B;  4FHL A;  4O9D A;  3OL2 A;  2IUR A;  4ES0 A;  3RN0 D;  4A11 A;  2H6N A;  4PSX B;  1ERJ A;  2P9L C;  5EAP A;  3I2N A;  1K8K C;  3OKY B;  2XL3 A;  3DWL C;  3SFZ A;  1XKS A;  1N6D A;  4L3G D;  1JJU B;  3P4F A;  3EU7 A;  2PBI B;  4L3H D;  1GOT B;  4EWR A;  3PSC B;  2AH0 A;  3PXW D;  3UVM A;  4KFM B;  2OVR B;  4PXW A;  4A09 A;  4GZ8 A;  1MG3 A;  3RFH A;  2IUV A;  4LG8 A;  2B4E A;  4E54 A;  4J86 A;  2PM9 A;  4I79 A;  2YNO A;  1GP2 B;  4JT5 C;  5FKR A;  1TYQ C;  2B5M A;  5FKT A;  1JOF A;  4GGD A;  3JAM g;  1S4U X;  5HE3 B;  5GXI A;  3RN1 D;  4JT6 C;  2IWF A;  2OK4 A;  5HYN B;  3C9C A;  3MKQ A;  4A7J A;  2OVP B;  4NSX A;  3EMH A;  4XEI C;  2CN2 A;  3ZWL B;  2CO0 A;  2B5N A;  4BUJ C;  4PBZ A;  3UVL A;  3CFS B;  4CY2 A;  3EWE A;  5IT9 g;  3BWS A;  2P9U C;  5FLX g;  4Y5R D;  2I0R A;  2AGL A;  3SJL D;  1K32 A;  3MMY A;  2GC7 A;  3EI3 A;  4A0B A;  4BH6 A;  3I89 A;  2IUP A;  4FWW A;  2OK6 A;  3N0D A;  3C75 H;  2CE8 A;  2MTA H;  4CZV A;  1YFQ A;  5K19 A;  2H9P A;  1TBG A;  2EBS A;  3IJ0 A;  3OTT A;  3F3P A;  1N6E A;  1OLZ A;  3AL9 A;  4CY5 A;  3FM0 A;  4UI9 R;  3F3G A;  4ESG A;  4J81 A;  5I5I A;  2HES X;  4J87 A;  1XIP A;  3OKT A;  4R7A B;  4CI3 A;  2G99 A;  5FXY A;  2HYE A;  5CXC A;  5C2W B;  2H68 A;  4GQ1 A;  4J8G A;  1B9Y A;  4GQ2 P;  3NVQ A;  3I8C A;  5THA A;  2P9N C;  2HKR A;  4HDJ A;  4TZ4 A;  2BCJ B;  2I3S A;  3CIK B;  3RLM D;  3EG6 A;  3IJC A;  4U7A A;  4AEZ A;  4PNK B;  5AMS A;  3F3F A;  3U4Y A;  3CFV A;  1PI6 A;  4GMB A;  4ZOY A;  3JRP A;  5TEE A;  3EI3 B;  5IJ7 E;  1U2V C;  3GRE A;  4X61 B;  4L1Q D;  4FA9 D;  4CC9 A;  3J81 g;  3UKR C;  1PEV A;  2G9A A;  3ORV D;  2P9S C;  3VH0 A;  1MG2 A;  4PC0 A;  2H9L A;  2H14 A;  3RSE C;  4GM8 A;  3PXT D;  5EAL A;  4J78 A;  2YB8 B;  4FB1 D;  2H6K A;  3I7L A;  4J8B A;  4JSX C;  3EI1 B;  4YVD A;  2HJB A;  4E5Z A;  1N6F A;  3PSL A;  3SVW D;  4E54 B;  1P22 A;  3N0E A;  4ZOX A;  3IIY A;  3K27 A;  3JZN A;  1JMX B;  2J55 H;  4A0A A;  2IWK A;  2AQ5 A;  1FWX A;  1GXR A;  2H6Q A;  4CI8 A;  5HE2 B;  4MK0 B;  1OMW B;  3KRX B;  2AGZ A;  3IJ1 A;  4A0B B;  4H5J A;  5IGQ A;  5AFU 3;  3KRW B;  3I7N A;  4D6V A;  4X3E A;  2OIZ A;  3JZH A;  5CXC B;  3SBQ A;  3MXX A;  5CYK B;  3ULE C;  4ZN4 A;  3I7P A;  3I8E A;  4ERY A;  3JPX A;  3DXK C;  3FGB A;  4N14 A;  4O3U B;  4CY3 A;  2AGX A;  5H14 A;  1U4C A;  2OJY A;  2XYI A;  2B5L A; 
#chains in the Genus database with same CATH topology
 1VE7 A;  3O4H A;  3MZK A;  4LGN A;  4AMZ A;  2I3T A;  4J77 A;  3SLE D;  5TF2 A;  4JSN C;  4DNU A;  4ZOZ A;  3ODT A;  5EM2 B;  3FCU A;  4QL1 A;  5EAR A;  5IC7 A;  3B7F A;  4OWR A;  4X63 B;  3IIW A;  1H2X A;  4J0W A;  4WJK A;  4BCC A;  4GGA A;  5E6S A;  1A0R B;  4FAN D;  2JKX A;  5AJA A;  3EI4 B;  4OZU A;  4Y7R A;  3HFQ A;  1SQ9 A;  1UOP A;  4A08 B;  4O02 A;  1GOF A;  3V7D B;  4JHN A;  4JD2 C;  4QRJ A;  4A11 B;  3AH8 B;  3GC3 B;  2Z2N A;  4ZOV A;  5FA5 B;  3SXT D;  2J56 H;  3SBR A;  4GM9 A;  2VZ1 A;  5TEF A;  1GG2 B;  3NVN A;  3JB9 L;  5K1C C;  3AL8 A;  5EML B;  3V5W B;  4AX4 A;  3ZDZ A;  1RI6 A;  4JXM A;  1NR0 A;  5HQG A;  3IUN A;  2UZY B;  4J84 A;  3JZG A;  3K26 A;  3RMZ D;  3E0C A;  2HXC A;  2J57 G;  4J79 A;  3J80 g;  1I2M B;  1MDA H;  2I0T A;  2UZX B;  4U1E I;  4J73 A;  2O9K A;  3T3P A;  4FA4 D;  3SBP A;  5FQD A;  2CNX A;  5EMJ B;  4IRZ A;  5EAM A;  5TDH B;  2VC2 A;  4O1Q D;  1E8M A;  4MMZ A;  3V4V A;  5C9Z B;  4IMM A;  4QQE A;  3SN6 B;  4JSP C;  2H9M A;  3PVU B;  3EI2 B;  5GXH A;  3MZL A;  2H47 A;  5A2Q g;  5H17 A;  1L0Q A;  2QC5 A;  2HJ4 A;  3IKO A;  4GQB B;  3I7H A;  5HE0 B;  4XYH A;  2CE9 A;  1NEX B;  5B4W A;  1H2Z A;  3C99 A;  1SQJ A;  2AGW A;  3PVW B;  4Z8L A;  4O3T B;  4A2M A;  3L4O D;  5GMK n;  1C9I A;  1BPO A;  4G55 A;  4DNW A;  4FA5 D;  4A2L A;  2P9K C;  3OKY A;  4CI2 A;  3UKU C;  3RRM C;  1UOQ A;  2AH1 A;  4J82 A;  5I5M A;  5IGO A;  2OVQ B;  4QAM A;  4K3J B;  5M5V A;  3QHY B;  3NIG A;  3UVN A;  2GNQ A;  2PM6 B;  1SHY B;  3MKS B;  3PE7 A;  3OL2 B;  4GGC A;  4BL0 A;  2GC4 A;  2H9N A;  3UR4 A;  4Z7N A;  2HKM A;  2YNP A;  3C5M A;  3I7K A;  2CN3 A;  4L1M A;  4IA9 A;  3OKW A;  5KDO B;  1VYH C;  4ERZ A;  3UVK A;  2PM9 B;  4BCD A;  3RFG A;  2H13 A;  2YBA A;  3DXM C;  4ERQ A;  4K3I D;  2BBK H;  5CXB B;  3IUQ A;  3BG0 A;  4J0X A;  3SMR A;  3AL8 B;  2AGY A;  3PXS D;  3W15 A;  3I7O A;  5FKQ A;  4CY1 A;  2W18 A;  1PGU A;  3EQ8 A;  3JRO A;  2QXV A;  2IAA A;  2TRC B;  4AOW A;  5EMM B;  3SCY A;  3VI3 A;  5C2V B;  2CO0 C;  4QT8 A;  5FKS A;  4BP8 A;  2YNN A;  5CXB A;  3GD1 I;  2H3X A;  3GFC A;  4PBY A;  3AFC A;  3NIF A;  4PSW B;  4E5Z B;  4LG9 A;  2YMU A;  3L4M D;  2P9P C;  3BG1 A;  3EI1 A;  5SXM A;  2IUQ A;  3OW8 A;  3V9F A;  2Z2P A;  4GM3 A;  5EM2 A;  2P9I C;  4FA1 D;  5CYK A;  4UM9 A;  2XL2 A;  5EMK B;  3NVX A;  3DSM A;  3VA6 A;  4H5I A;  3SWS D;  1PBY B;  1QFS A;  4A09 B;  1R5M A;  2Z2O A;  2VDM A;  4CZY A;  1XHM A;  2VDR A;  4CZX A;  2Q7Q A;  2VDP A;  3DM0 A;  3SHF A;  4D0K A;  2PM7 B;  3EI4 A;  4O45 A;  4A0A B;  5C86 A;  5H1M A;  1QNI A;  3UVO A;  1TYE A;  4L9O A;  3IUJ A;  2XU7 A;  1Q47 A;  4FAV D;  5GSA A;  4A08 A;  3K6S A;  1E8N A;  5M5S A;  4CI1 A;  4G56 B;  5HE1 B;  1B9X A;  4XYI A;  1U8C A;  2I0S A;  4JSV C;  2BKL A;  3FRX A;  5I5J A;  3EI2 A;  3A0F A;  5E6U A;  3VGZ A;  5IJ8 E;  4X60 B;  5JWZ A;  1JMZ B;  4FHL A;  2VDQ A;  4O9D A;  3OL2 A;  2IUR A;  4ES0 A;  3T3M A;  4RE6 A;  3RN0 D;  4A11 A;  2H6N A;  4G1E A;  4PSX B;  1ERJ A;  2P9L C;  1UOO A;  5EAP A;  3I2N A;  1K8K C;  3OKY B;  2XL3 A;  3DWL C;  3SFZ A;  1XKS A;  1N6D A;  3K72 A;  4L3G D;  1JJU B;  3P4F A;  2VDO A;  3EU7 A;  2PBI B;  4D9S A;  4L3H D;  2QZP A;  3ZE2 A;  1GOT B;  4EWR A;  3PSC B;  2AH0 A;  3PXW D;  3UVM A;  4KFM B;  2OVR B;  4PXW A;  4A09 A;  4GZ8 A;  1MG3 A;  1O6F A;  1H2W A;  2IUV A;  4LG8 A;  2B4E A;  3RFH A;  4BP9 A;  4J86 A;  4E54 A;  5M5R A;  3DDU A;  2PM9 A;  4I79 A;  2YNO A;  2HU7 A;  1GP2 B;  4JT5 C;  1JV2 A;  5FKR A;  2WQ8 A;  1TYQ C;  2B5M A;  5FKT A;  5FFG A;  1JOF A;  4GGD A;  2VDK A;  3KCI A;  3JAM g;  1S4U X;  5HE3 B;  4Z7O A;  5GXI A;  3RN1 D;  1VZ3 A;  4JT6 C;  2IWF A;  3K71 A;  2OK4 A;  3O4I A;  5HYN B;  2EIE A;  3C9C A;  3MKQ A;  3O4J A;  5FFO A;  3QI0 A;  4A7J A;  2OVP B;  4AN1 A;  1T2X A;  1YR2 A;  4NSX A;  1C9L A;  3EMH A;  4XEI C;  2CN2 A;  2XZG A;  3ZWL B;  2CO0 A;  2B5N A;  4BUJ C;  4PBZ A;  5E6R A;  3UVL A;  1M1X A;  3CFS B;  3EWE A;  4CY2 A;  5IT9 g;  3BWS A;  2P9U C;  5FLX g;  4Y5R D;  1O6G A;  2I0R A;  2AGL A;  4WK2 A;  3SJL D;  1K32 A;  4WK0 A;  2HU8 A;  1VZ2 A;  3MMY A;  3MUO A;  2GC7 A;  3EI3 A;  4A0B A;  4BH6 A;  3EQ7 A;  4Z7Q A;  3I89 A;  3ZDX A;  2IUP A;  2EID A;  4FWW A;  2OK6 A;  3N0D A;  4JHP C;  3C75 H;  1H2Y A;  2CE8 A;  3MVD K;  1A12 A;  2MTA H;  2VDN A;  4MMX A;  4CZV A;  1YFQ A;  2EIB A;  5K19 A;  2H9P A;  1TBG A;  2EBS A;  3IJ0 A;  3OTT A;  3F3P A;  2HU5 A;  1UTC A;  2VZ3 A;  1N6E A;  3EQ9 A;  1OLZ A;  3AL9 A;  4CY5 A;  3FM0 A;  4UI9 R;  3F3G A;  4ESG A;  4J81 A;  3VI4 A;  5I5I A;  2HES X;  2EIC A;  4J87 A;  1XIP A;  3OKT A;  5M5U A;  4R7A B;  4CI3 A;  2G99 A;  5FXY A;  2HYE A;  5CXC A;  5C2W B;  4AN0 A;  2H68 A;  4GQ1 A;  4J8G A;  4WK4 A;  1B9Y A;  4GQ2 P;  3NVQ A;  3I8C A;  5THA A;  3IUM A;  1QFM A;  2P9N C;  5HDB A;  2HKR A;  4HDJ A;  4TZ4 A;  1JTD B;  2BCJ B;  2I3S A;  3CIK B;  2XE4 A;  4RE5 A;  3RLM D;  3EG6 A;  3IJC A;  4U7A A;  5M5T A;  4AEZ A;  4PNK B;  5AMS A;  3F3F A;  3U4Y A;  4G1M A;  3CFV A;  3NID A;  1PI6 A;  1VE6 A;  3ZE0 A;  4GMB A;  2XDW A;  3JRP A;  3MUN A;  5TEE A;  3EI3 B;  4ZOY A;  1U2V C;  5IJ7 E;  2QR5 A;  3IUL A;  3GRE A;  4X61 B;  4L1Q D;  4FA9 D;  4DNV A;  3ZE1 A;  4NC4 A;  4CC9 A;  3J81 g;  3UKR C;  1PEV A;  2G9A A;  3ORV D;  2P9S C;  3VH0 A;  1E5T A;  1MG2 A;  3O4G A;  4PC0 A;  3IJE A;  2H9L A;  1K3I A;  2H14 A;  3IVM A;  3RSE C;  4GM8 A;  3PXT D;  4UM8 A;  5EAL A;  4J78 A;  2YB8 B;  4FB1 D;  3V4P A;  2H6K A;  3I7L A;  4J8B A;  4JSX C;  3EI1 B;  4YVD A;  4MMY A;  2HJB A;  4E5Z A;  1N6F A;  5M61 A;  1L5G A;  3PSL A;  3SVW D;  4E54 B;  1P22 A;  3N0E A;  4ZOX A;  3IIY A;  3K27 A;  2VDL A;  3JZN A;  1JMX B;  2J55 H;  4NEN A;  4A0A A;  2IWK A;  2AQ5 A;  1FWX A;  1GXR A;  2H6Q A;  1GOH A;  4CI8 A;  4BCB A;  5HE2 B;  4MK0 B;  1OMW B;  3KRX B;  2AGZ A;  3FCS A;  3IJ1 A;  1GOG A;  4A0B B;  4H5J A;  5IGQ A;  5AFU 3;  4NAA A;  3KRW B;  3I7N A;  4D6V A;  4X3E A;  2OIZ A;  3JZH A;  5CXC B;  3SBQ A;  3MXX A;  5CYK B;  3IUR A;  3ZDY A;  3ULE C;  4ZN4 A;  4NBM A;  3I7P A;  3I8E A;  4ERY A;  5C92 A;  3JPX A;  3DXK C;  4O2W A;  3FGB A;  4N14 A;  4O3U B;  4CY3 A;  2AGX A;  5H14 A;  1U4C A;  3OF7 A;  4AMY A;  2OJY A;  2XYI A;  2B5L A; 
#chains in the Genus database with same CATH homology
 3MZK A;  4LGN A;  2I3T A;  4J77 A;  3SLE D;  5TF2 A;  4JSN C;  4ZOZ A;  3ODT A;  5EM2 B;  4QL1 A;  5EAR A;  5IC7 A;  3B7F A;  4OWR A;  4X63 B;  3IIW A;  4J0W A;  4GGA A;  1A0R B;  4FAN D;  5AJA A;  3EI4 B;  4OZU A;  4Y7R A;  3HFQ A;  1SQ9 A;  4A08 B;  3V7D B;  4JD2 C;  4QRJ A;  4A11 B;  3AH8 B;  2Z2N A;  4ZOV A;  5FA5 B;  3SXT D;  2J56 H;  3SBR A;  4GM9 A;  5TEF A;  1GG2 B;  3NVN A;  3JB9 L;  5K1C C;  3AL8 A;  5EML B;  3V5W B;  1RI6 A;  4JXM A;  1NR0 A;  5HQG A;  2UZY B;  4J84 A;  3JZG A;  3K26 A;  3RMZ D;  3E0C A;  2HXC A;  2J57 G;  4J79 A;  3J80 g;  1MDA H;  2I0T A;  2UZX B;  4U1E I;  4J73 A;  2O9K A;  4FA4 D;  3SBP A;  5FQD A;  2CNX A;  5EMJ B;  5EAM A;  5TDH B;  4O1Q D;  5C9Z B;  4IMM A;  4QQE A;  3SN6 B;  4JSP C;  2H9M A;  3PVU B;  3EI2 B;  5GXH A;  3MZL A;  2H47 A;  5A2Q g;  5H17 A;  1L0Q A;  2QC5 A;  2HJ4 A;  3IKO A;  4GQB B;  3I7H A;  5HE0 B;  4XYH A;  2CE9 A;  1NEX B;  5B4W A;  3C99 A;  1SQJ A;  2AGW A;  3PVW B;  4Z8L A;  4O3T B;  4A2M A;  3L4O D;  5GMK n;  4FA5 D;  4A2L A;  2P9K C;  3OKY A;  4CI2 A;  3UKU C;  3RRM C;  5I5M A;  2AH1 A;  4J82 A;  5IGO A;  2OVQ B;  4K3J B;  3UVN A;  2GNQ A;  2PM6 B;  1SHY B;  3MKS B;  3PE7 A;  3OL2 B;  4GGC A;  4BL0 A;  2GC4 A;  2H9N A;  3UR4 A;  2HKM A;  2YNP A;  3C5M A;  3I7K A;  2CN3 A;  4IA9 A;  3OKW A;  5KDO B;  1VYH C;  4ERZ A;  3UVK A;  2PM9 B;  3RFG A;  2H13 A;  2YBA A;  3DXM C;  4ERQ A;  4K3I D;  2BBK H;  5CXB B;  3BG0 A;  4J0X A;  3SMR A;  3AL8 B;  2AGY A;  3PXS D;  3W15 A;  3I7O A;  5FKQ A;  4CY1 A;  2W18 A;  1PGU A;  3JRO A;  2QXV A;  2IAA A;  2TRC B;  4AOW A;  5EMM B;  3SCY A;  5C2V B;  2CO0 C;  4QT8 A;  5FKS A;  2YNN A;  5CXB A;  2H3X A;  3GFC A;  4PBY A;  3AFC A;  4PSW B;  4E5Z B;  4LG9 A;  2YMU A;  3L4M D;  2P9P C;  3BG1 A;  3EI1 A;  5SXM A;  2IUQ A;  3OW8 A;  3V9F A;  2Z2P A;  4GM3 A;  5EM2 A;  2P9I C;  4FA1 D;  5CYK A;  2XL2 A;  5EMK B;  3NVX A;  3DSM A;  3VA6 A;  4H5I A;  3SWS D;  1PBY B;  4A09 B;  1R5M A;  2Z2O A;  4CZY A;  1XHM A;  4CZX A;  2Q7Q A;  3DM0 A;  3SHF A;  4D0K A;  2PM7 B;  3EI4 A;  4O45 A;  4A0A B;  5H1M A;  1QNI A;  3UVO A;  4L9O A;  2XU7 A;  1Q47 A;  4FAV D;  5GSA A;  4A08 A;  4CI1 A;  4G56 B;  5HE1 B;  1B9X A;  4XYI A;  2I0S A;  4JSV C;  3FRX A;  5I5J A;  3EI2 A;  3A0F A;  3VGZ A;  5IJ8 E;  4X60 B;  5JWZ A;  1JMZ B;  4FHL A;  4O9D A;  3OL2 A;  2IUR A;  4ES0 A;  3RN0 D;  4A11 A;  2H6N A;  4PSX B;  1ERJ A;  2P9L C;  5EAP A;  3I2N A;  1K8K C;  3OKY B;  2XL3 A;  3DWL C;  3SFZ A;  1XKS A;  1N6D A;  4L3G D;  1JJU B;  3P4F A;  3EU7 A;  2PBI B;  4L3H D;  1GOT B;  4EWR A;  3PSC B;  2AH0 A;  3PXW D;  3UVM A;  4KFM B;  2OVR B;  4PXW A;  4A09 A;  4GZ8 A;  1MG3 A;  3RFH A;  2IUV A;  4LG8 A;  2B4E A;  4E54 A;  4J86 A;  2PM9 A;  4I79 A;  2YNO A;  1GP2 B;  4JT5 C;  5FKR A;  1TYQ C;  2B5M A;  5FKT A;  1JOF A;  4GGD A;  3JAM g;  1S4U X;  5HE3 B;  5GXI A;  3RN1 D;  4JT6 C;  2IWF A;  2OK4 A;  5HYN B;  3C9C A;  3MKQ A;  4A7J A;  2OVP B;  4NSX A;  3EMH A;  4XEI C;  2CN2 A;  3ZWL B;  2CO0 A;  2B5N A;  4BUJ C;  4PBZ A;  3UVL A;  3CFS B;  4CY2 A;  3EWE A;  5IT9 g;  3BWS A;  2P9U C;  5FLX g;  4Y5R D;  2I0R A;  2AGL A;  3SJL D;  1K32 A;  3MMY A;  2GC7 A;  3EI3 A;  4A0B A;  4BH6 A;  3I89 A;  2IUP A;  4FWW A;  2OK6 A;  3N0D A;  3C75 H;  2CE8 A;  2MTA H;  4CZV A;  1YFQ A;  5K19 A;  2H9P A;  1TBG A;  2EBS A;  3IJ0 A;  3OTT A;  3F3P A;  1N6E A;  1OLZ A;  3AL9 A;  4CY5 A;  3FM0 A;  4UI9 R;  3F3G A;  4ESG A;  4J81 A;  5I5I A;  2HES X;  4J87 A;  1XIP A;  3OKT A;  4R7A B;  4CI3 A;  2G99 A;  5FXY A;  2HYE A;  5CXC A;  5C2W B;  2H68 A;  4GQ1 A;  4J8G A;  1B9Y A;  4GQ2 P;  3NVQ A;  3I8C A;  5THA A;  2P9N C;  2HKR A;  4HDJ A;  4TZ4 A;  2BCJ B;  2I3S A;  3CIK B;  3RLM D;  3EG6 A;  3IJC A;  4U7A A;  4AEZ A;  4PNK B;  5AMS A;  3F3F A;  3U4Y A;  3CFV A;  1PI6 A;  4GMB A;  4ZOY A;  3JRP A;  5TEE A;  3EI3 B;  5IJ7 E;  1U2V C;  3GRE A;  4X61 B;  4L1Q D;  4FA9 D;  4CC9 A;  3J81 g;  3UKR C;  1PEV A;  2G9A A;  3ORV D;  2P9S C;  3VH0 A;  1MG2 A;  4PC0 A;  2H9L A;  2H14 A;  3RSE C;  4GM8 A;  3PXT D;  5EAL A;  4J78 A;  2YB8 B;  4FB1 D;  2H6K A;  3I7L A;  4J8B A;  4JSX C;  3EI1 B;  4YVD A;  2HJB A;  4E5Z A;  1N6F A;  3PSL A;  3SVW D;  4E54 B;  1P22 A;  3N0E A;  4ZOX A;  3IIY A;  3K27 A;  3JZN A;  1JMX B;  2J55 H;  4A0A A;  2IWK A;  2AQ5 A;  1FWX A;  1GXR A;  2H6Q A;  4CI8 A;  5HE2 B;  4MK0 B;  1OMW B;  3KRX B;  2AGZ A;  3IJ1 A;  4A0B B;  4H5J A;  5IGQ A;  5AFU 3;  3KRW B;  3I7N A;  4D6V A;  4X3E A;  2OIZ A;  3JZH A;  5CXC B;  3SBQ A;  3MXX A;  5CYK B;  3ULE C;  4ZN4 A;  3I7P A;  3I8E A;  4ERY A;  3JPX A;  3DXK C;  3FGB A;  4N14 A;  4O3U B;  4CY3 A;  2AGX A;  5H14 A;  1U4C A;  2OJY A;  2XYI A;  2B5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...