2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
4LG8A 3JB9L 3SCYA 2OVRB 4U1EI 2OJYA 3L4OD 2IAAA 4E5ZA 5FQDA 4J73A 1FWXA 4OZUA 4N14A 3U4YA 1N6EA 5CXCA 3A0FA 3MKQA 4O9DA 4A7JA 5AFU3 3PSCB 2H6KA 2PBIB 4L1QD 3C75H 1MG3A 1K32A 4JSPC 4CI8A 5GSAA 2W18A 3SVWD 3IKOA 3DSMA 5IGOA 4K3ID 3EI4A 1R5MA 4XEIC 1B9XA 3MZKA 3CFSB 3JZNA 4E54B 1YFQA 3EI2A 3CIKB 4NSXA 4E5ZB 2I3TA 4CZVA 2HJBA 3AL8A 2AGZA 3VH0A 3NVXA 5TF2A 2YNPA 5TEFA 5AMSA 3UKUC 3NVNA 4BL0A 1OLZA 3N0DA 2I3SA 3MKSB 5EMLB 3EMHA 4GQ1A 3J80g 3CFVA 2I0RA 1XIPA 2B5LA 4X3EA 3AL9A 1K8KC 1PGUA 3I7HA 5EALA 4D6VA 2H9LA 4ZOZA 2CO0A 3UVMA 5HE2B 2H9PA 2OVPB 4CY3A 3PVUB 4D0KA 3IIYA 1XKSA 3DXMC 2QC5A 4ZOYA 2I0TA 4OWRA 2H6QA 3EI1A 4LGNA 3OW8A 3RFGA 4Z8LA 3I8CA 2I0SA 4JSNC 3KRXB 4PBYA 2CE9A 2GC7A 4JXMA 2CE8A 4X61B 3P4FA 5CXBB 4A11A 3SXTD 4YVDA 2IWKA 4QL1A 4O3UB 3KRWB 4H5JA 3IJCA 4KFMB 2H6NA 4UI9R 2Z2PA 2YB8B 5AJAA 3UKRC 5GMKn 3I7LA 2J55H 4XYIA 3OKYB 3F3FA 3EG6A 4QRJA 5K1CC 1PBYB 5FLXg 3JRPA 4J77A 2OK4A 4GGDA 4J86A 3VGZA 2H47A 4I79A 5K19A 5TDHB 4GGCA 3ODTA 4FWWA 4TZ4A 4LG9A 5FXYA 4JSXC 5IGQA 4A11B 2G99A 3DWLC 4CC9A 4ZOVA 3F3GA 4J78A 5CYKB 4JT6C 3RSEC 3C99A 1QNIA 2PM9B 5EMKB 4QT8A 3JAMg 3BWSA 4GMBA 2Z2OA 4PXWA 4GZ8A 3RFHA 3DXKC 4FAND 4FAVD 3ORVD 3SWSD 1ERJA 1JMZB 4CY5A 2HKRA 3EI2B 3FGBA 2H9MA 2P9UC 3UR4A 3I89A 3AFCA 5H14A 2AGWA 3RN1D 2IUVA 4CZYA 5TEEA 2P9NC 4ERZA 4Y5RD 2CO0C 3C5MA 3PXWD 3W15A 3E0CA 4FA4D 1JMXB 1U4CA 5EARA 5JWZA 4J87A 2HJ4A 1MDAH 3C9CA 4U7AA 3K26A 3SHFA 1PEVA 3F3PA 5H1MA 5FKRA 3EWEA 3VA6A 3EI4B 5FKSA 3I7OA 2HXCA 4A08A 3SN6B 3PVWB 4PNKB 5IJ8E 3I7KA 4A09B 1TYQC 5IT9g 5EAMA 3I7PA 3OTTA 4CY2A 1GG2B 3IJ1A 1L0QA 4GGAA 2GNQA 3RRMC 1RI6A 4XYHA 4ZN4A 5C2VB 5HE0B 3OKTA 5I5MA 5C9ZB 1N6DA 3L4MD 1A0RB 1OMWB 3AL8B 2IUQA 3GREA 3OKWA 1MG2A 2P9PC 3BG0A 4FB1D 4AOWA 1TBGA 4PSWB 2XL3A 2H13A 2UZXB 4J82A 1JOFA 4MK0B 1S4UX 2H3XA 2TRCB 2B4EA 1SHYB 5IJ7E 2HYEA 5HE3B 1Q47A 4FA1D 3OKYA 1SQ9A 4L3GD 2H68A 3EI1B 1GOTB 3K27A 4IMMA 3FM0A 3IJ0A 5SXMA 4R7AB 4HDJA 2HESX 2XU7A 4A2LA 3UVOA 3PE7A 4J8BA 5FA5B 4G56B 2YMUA 4CI2A 4CZXA 2AGXA 2P9SC 4CI3A 3HFQA 4ES0A 3I2NA 2BCJB 3UVKA 1P22A 4GQBB 4EWRA 2P9LC 5CXBA 5CXCB 4J0XA 4FA9D 3EU7A 4JT5C 3PSLA 4FA5D 2HKMA 2AH1A 4PBZA 2J56H 3I8EA 4X63B 2H9NA 2P9KC 3MXXA 5HE1B 3OL2A 4A09A 2B5MA 2Z2NA 4FHLA 5FKQA 3MMYA 4O3TB 4ERYA 4A0AA 1GXRA 3MZLA 2XL2A 4A0BA 1N6FA 3PXTD 2O9KA 2EBSA 4BUJC 1GP2B 4GM3A 2G9AA 4K3JB 3EI3A 4AEZA 2PM9A 3PXSD 2OK6A 4J79A 3JROA 3BG1A 3RMZD 2UZYB 3OL2B 4ERQA 3N0EA 3UVNA 2P9IC 3ZWLB 5C2WB 3AH8B 2MTAH 2Q7QA 1SQJA 4J0WA 4JD2C 5I5JA 5HQGA 2IWFA 5EM2B 4H5IA 2BBKH 4J84A 3IIWA 5FKTA 2PM6B 2H14A 4A0BB 2PM7B 5H17A 2QXVA 3J81g 2IURA 3SBQA 3RLMD 4Y7RA 3SMRA 2CNXA 1VYHC 1NEXB 2AH0A 5A2Qg 4A08B 4BH6A 4GM8A 4J8GA 4JSVC 4IA9A 5EM2A 3UVLA 2AQ5A 3ULEC 3NVQA 2GC4A 3JPXA 2YNOA 5GXIA 4GQ2P 4A0AB 3GFCA 4O45A 3SBRA 2OIZA 2IUPA 2CN2A 4PSXB 1XHMA 1NR0A 2XYIA 2YNNA 4J81A 5EMJB 4X60B 1U2VC 3I7NA 2AGYA 3V7DB 5IC7A 5GXHA 2J57G 1B9YA 2CN3A 3EI3B 3FRXA 3SLED 4ESGA 5HYNB 5EMMB 4ZOXA 4PC0A 3V9FA 4A2MA 3B7FA 4L3HD 2YBAA 5EAPA 4CI1A 4GM9A 4L9OA 4QQEA 5CYKA 4CY1A 2AGLA 2OVQB 5KDOB 4E54A 3SFZA 3V5WB 5B4WA 4O1QD 3JZGA 3JZHA 3SBPA 5THAA 1PI6A 3DM0A 1JJUB 2B5NA 3SJLD 3RN0D 5I5IA
chains in the Genus database with same CATH superfamily
4LG8A 3JB9L 3SCYA 2OVRB 4U1EI 3QHYB 2OJYA 3L4OD 2IAAA 4BCDA 4E5ZA 5FQDA 4J73A 1FWXA 4OZUA 4O02A 4N14A 3U4YA 1N6EA 5CXCA 3A0FA 3MKQA 4O9DA 2XDWA 4A7JA 1UTCA 5AFU3 3PSCB 2H6KA 2PBIB 4L1QD 3C75H 3T3PA 1E5TA 1K32A 1MG3A 3IULA 4JSPC 4CI8A 5M5TA 5GSAA 2W18A 3SVWD 3IKOA 3DSMA 5IGOA 1GOHA 4BCBA 4K3ID 3EI4A 1R5MA 4XEIC 1B9XA 3MZKA 3CFSB 3JZNA 4E54B 1YFQA 3EI2A 3CIKB 4NSXA 1UOPA 4E5ZB 2I3TA 4CZVA 2HJBA 3AL8A 2AGZA 3VH0A 3NVXA 5TF2A 1TYEA 2YNPA 2HU7A 5TEFA 5AMSA 1JTDB 3UKUC 1C9LA 3IUNA 1VZ2A 3NVNA 4BL0A 1OLZA 3N0DA 2I3SA 3MKSB 5EMLB 3EMHA 4GQ1A 1QFSA 3J80g 3EQ8A 3ZDZA 3CFVA 2I0RA 4NENA 1XIPA 2B5LA 4X3EA 3AL9A 1K8KC 1PGUA 3I7HA 2XE4A 5EALA 4D6VA 5HDBA 3DDUA 2H9LA 2XZGA 4ZOZA 2CO0A 2VDOA 3UVMA 5HE2B 2H9PA 2OVPB 4CY3A 3PVUB 4D0KA 3IIYA 1XKSA 3DXMC 1H2YA 2QC5A 4ZOYA 2I0TA 4OWRA 2H6QA 3EI1A 4LGNA 3OW8A 1H2XA 3RFGA 5FFGA 2VDRA 4Z8LA 3I8CA 2I0SA 3O4JA 2VDKA 4JSNC 4WJKA 3KRXB 5M5UA 4PBYA 1I2MB 4BCCA 2CE9A 2GC7A 2VDMA 4JXMA 2CE8A 4X61B 3P4FA 5CXBB 4A11A 3O4HA 3SXTD 3K71A 4YVDA 4G1MA 3FCUA 1YR2A 2IWKA 3NIFA 4QL1A 4O3UB 5M61A 3KRWB 4H5JA 3IJCA 4KFMB 2H6NA 4UI9R 2Z2PA 2YB8B 1H2WA 5AJAA 3UKRC 3NIGA 3ZE0A 5GMKn 3I7LA 2J55H 4XYIA 3OKYB 3QI0A 3F3FA 3EG6A 1O6FA 3V4PA 4QRJA 5K1CC 1PBYB 1UOQA 3KCIA 4JHPC 2VDQA 5FLXg 3JRPA 4J77A 2OK4A 4GGDA 4J86A 3K72A 2BKLA 3VGZA 2H47A 4I79A 5K19A 5TDHB 4GGCA 3VI3A 3ODTA 4FWWA 4TZ4A 4LG9A 5FXYA 4QAMA 1BPOA 3T3MA 4JSXC 5M5VA 5IGQA 4A11B 3VI4A 2G99A 3DWLC 4CC9A 4ZOVA 3F3GA 4J78A 5CYKB 4JT6C 3RSEC 2HU8A 3C99A 2QR5A 1QNIA 2PM9B 5EMKB 4QT8A 3JAMg 4RE5A 3BWSA 4GMBA 2Z2OA 4PXWA 4GZ8A 3RFHA 3DXKC 4FAND 4FAVD 3ORVD 3SWSD 1ERJA 1JMZB 4CY5A 3EQ9A 2HKRA 3EI2B 4JHNA 3FGBA 2H9MA 2P9UC 3UR4A 3GD1I 3I89A 3AFCA 5H14A 2AGWA 4DNWA 3RN1D 2IUVA 3V4VA 3IJEA 4CZYA 5TEEA 2P9NC 1VE6A 4ERZA 4Y5RD 2CO0C 3C5MA 3PXWD 3W15A 3E0CA 4FA4D 1JMXB 1U4CA 5EARA 5JWZA 4J87A 2HJ4A 1MDAH 1QFMA 3C9CA 4MMXA 4U7AA 3K26A 3SHFA 1PEVA 3F3PA 5H1MA 4AN0A 5FKRA 3EWEA 3VA6A 3EI4B 2JKXA 1T2XA 5FKSA 3I7OA 2HXCA 2VDPA 4A08A 1L5GA 3SN6B 4Z7QA 3PVWB 4PNKB 5IJ8E 3EQ7A 3I7KA 4A09B 1TYQC 5IT9g 5EAMA 3I7PA 2VDLA 1E8NA 3OTTA 4CY2A 1GG2B 3IJ1A 1L0QA 1O6GA 4GGAA 2GNQA 2EIBA 3RRMC 4AMYA 1RI6A 4XYHA 4ZN4A 4DNUA 2EICA 5C2VB 5HE0B 4AMZA 3OKTA 5I5MA 5C9ZB 1N6DA 3L4MD 1A0RB 1OMWB 3AL8B 2IUQA 3GREA 3OKWA 1MG2A 2P9PC 3BG0A 4FB1D 4AOWA 1TBGA 4PSWB 2XL3A 2H13A 2UZXB 3O4GA 2EIDA 4J82A 4DNVA 1JOFA 1K3IA 4WK2A 4MK0B 1S4UX 2H3XA 2EIEA 2TRCB 2B4EA 1SHYB 5IJ7E 2HYEA 5E6UA 4AX4A 3IURA 5HE3B 1Q47A 4FA1D 3OKYA 1SQ9A 4L3GD 2H68A 4Z7OA 3EI1B 1GOTB 3K27A 4IMMA 4WK4A 3FM0A 3IJ0A 5SXMA 5M5RA 4Z7NA 4R7AB 4HDJA 2HESX 2XU7A 4A2LA 3UVOA 3PE7A 4J8BA 5FA5B 4G56B 3ZDYA 2YMUA 4CI2A 5M5SA 4BP9A 1GOGA 2VZ3A 4CZXA 2AGXA 2P9SC 4CI3A 3HFQA 4ES0A 3I2NA 1UOOA 4D9SA 2BCJB 3UVKA 1P22A 4GQBB 4EWRA 2P9LC 5CXBA 1A12A 4UM8A 5CXCB 2VC2A 4J0XA 4FA9D 3EU7A 1JV2A 4JT5C 3PSLA 4FA5D 2HKMA 3FCSA 2AH1A 1U8CA 4PBZA 2J56H 3I8EA 3MXXA 2H9NA 2P9KC 4X63B 5HE1B 3OL2A 4A09A 2B5MA 2Z2NA 2QZPA 4FHLA 5FKQA 3MMYA 4O3TB 4ERYA 4A0AA 1GXRA 3MZLA 2XL2A 4A0BA 4NAAA 4MMYA 4NBMA 3GC3B 1N6FA 3PXTD 2O9KA 2EBSA 4BUJC 1GP2B 4GM3A 2G9AA 2VZ1A 4K3JB 3EI3A 3NIDA 3IUJA 4AEZA 2PM9A 3PXSD 2OK6A 4J79A 3JROA 3BG1A 3RMZD 2UZYB 2VDNA 3OL2B 4AN1A 4ERQA 3N0EA 4RE6A 3UVNA 2P9IC 3ZWLB 5C2WB 1C9IA 3AH8B 2MTAH 2Q7QA 1M1XA 1SQJA 4J0WA 4JD2C 5I5JA 5HQGA 2IWFA 5EM2B 4H5IA 2BBKH 5C92A 4J84A 3MUOA 3IIWA 5FKTA 2PM6B 2H14A 4UM9A 4A0BB 2PM7B 5H17A 2QXVA 3O4IA 1E8MA 4O2WA 5E6SA 3J81g 1H2ZA 2IURA 3OF7A 2HU5A 3SBQA 3RLMD 4Y7RA 3SMRA 1VYHC 2CNXA 1NEXB 2AH0A 5A2Qg 2WQ8A 4MMZA 4A08B 4BH6A 4GM8A 4J8GA 4JSVC 4IA9A 5EM2A 4IRZA 3UVLA 2AQ5A 3ULEC 3NVQA 1VZ3A 2GC4A 3JPXA 2YNOA 5GXIA 4GQ2P 4A0AB 3GFCA 4O45A 3SBRA 2OIZA 4BP8A 2IUPA 2CN2A 4G55A 4PSXB 4WK0A 1XHMA 1NR0A 2XYIA 2YNNA 4J81A 5EMJB 4X60B 5FFOA 5C86A 1U2VC 3I7NA 2AGYA 3V7DB 5IC7A 5GXHA 2J57G 1B9YA 2CN3A 1VE7A 3EI3B 3FRXA 4G1EA 3SLED 1GOFA 4ESGA 5HYNB 5EMMB 3ZE1A 4ZOXA 4PC0A 3V9FA 4A2MA 3B7FA 4L3HD 3IVMA 2YBAA 3ZDXA 5EAPA 4CI1A 3IUQA 4GM9A 4L9OA 4L1MA 4QQEA 3IUMA 5CYKA 4CY1A 2AGLA 2OVQB 3MVDK 5KDOB 4NC4A 5E6RA 4E54A 3SFZA 3V5WB 3MUNA 5B4WA 3ZE2A 3K6SA 4O1QD 3JZGA 3JZHA 3SBPA 5THAA 1PI6A 3DM0A 1JJUB 2B5NA 3SJLD 3RN0D 5I5IA
chains in the Genus database with same CATH topology
4LG8A 3JB9L 3SCYA 2OVRB 4U1EI 2OJYA 3L4OD 2IAAA 4E5ZA 5FQDA 4J73A 1FWXA 4OZUA 4N14A 3U4YA 1N6EA 5CXCA 3A0FA 3MKQA 4O9DA 4A7JA 5AFU3 3PSCB 2H6KA 2PBIB 4L1QD 3C75H 1MG3A 1K32A 4JSPC 4CI8A 5GSAA 2W18A 3SVWD 3IKOA 3DSMA 5IGOA 4K3ID 3EI4A 1R5MA 4XEIC 1B9XA 3MZKA 3CFSB 3JZNA 4E54B 1YFQA 3EI2A 3CIKB 4NSXA 4E5ZB 2I3TA 4CZVA 2HJBA 3AL8A 2AGZA 3VH0A 3NVXA 5TF2A 2YNPA 5TEFA 5AMSA 3UKUC 3NVNA 4BL0A 1OLZA 3N0DA 2I3SA 3MKSB 5EMLB 3EMHA 4GQ1A 3J80g 3CFVA 2I0RA 1XIPA 2B5LA 4X3EA 3AL9A 1K8KC 1PGUA 3I7HA 5EALA 4D6VA 2H9LA 4ZOZA 2CO0A 3UVMA 5HE2B 2H9PA 2OVPB 4CY3A 3PVUB 4D0KA 3IIYA 1XKSA 3DXMC 2QC5A 4ZOYA 2I0TA 4OWRA 2H6QA 3EI1A 4LGNA 3OW8A 3RFGA 4Z8LA 3I8CA 2I0SA 4JSNC 3KRXB 4PBYA 2CE9A 2GC7A 4JXMA 2CE8A 4X61B 3P4FA 5CXBB 4A11A 3SXTD 4YVDA 2IWKA 4QL1A 4O3UB 3KRWB 4H5JA 3IJCA 4KFMB 2H6NA 4UI9R 2Z2PA 2YB8B 5AJAA 3UKRC 5GMKn 3I7LA 2J55H 4XYIA 3OKYB 3F3FA 3EG6A 4QRJA 5K1CC 1PBYB 5FLXg 3JRPA 4J77A 2OK4A 4GGDA 4J86A 3VGZA 2H47A 4I79A 5K19A 5TDHB 4GGCA 3ODTA 4FWWA 4TZ4A 4LG9A 5FXYA 4JSXC 5IGQA 4A11B 2G99A 3DWLC 4CC9A 4ZOVA 3F3GA 4J78A 5CYKB 4JT6C 3RSEC 3C99A 1QNIA 2PM9B 5EMKB 4QT8A 3JAMg 3BWSA 4GMBA 2Z2OA 4PXWA 4GZ8A 3RFHA 3DXKC 4FAND 4FAVD 3ORVD 3SWSD 1ERJA 1JMZB 4CY5A 2HKRA 3EI2B 3FGBA 2H9MA 2P9UC 3UR4A 3I89A 3AFCA 5H14A 2AGWA 3RN1D 2IUVA 4CZYA 5TEEA 2P9NC 4ERZA 4Y5RD 2CO0C 3C5MA 3PXWD 3W15A 3E0CA 4FA4D 1JMXB 1U4CA 5EARA 5JWZA 4J87A 2HJ4A 1MDAH 3C9CA 4U7AA 3K26A 3SHFA 1PEVA 3F3PA 5H1MA 5FKRA 3EWEA 3VA6A 3EI4B 5FKSA 3I7OA 2HXCA 4A08A 3SN6B 3PVWB 4PNKB 5IJ8E 3I7KA 4A09B 1TYQC 5IT9g 5EAMA 3I7PA 3OTTA 4CY2A 1GG2B 3IJ1A 1L0QA 4GGAA 2GNQA 3RRMC 1RI6A 4XYHA 4ZN4A 5C2VB 5HE0B 3OKTA 5I5MA 5C9ZB 1N6DA 3L4MD 1A0RB 1OMWB 3AL8B 2IUQA 3GREA 3OKWA 1MG2A 2P9PC 3BG0A 4FB1D 4AOWA 1TBGA 4PSWB 2XL3A 2H13A 2UZXB 4J82A 1JOFA 4MK0B 1S4UX 2H3XA 2TRCB 2B4EA 1SHYB 5IJ7E 2HYEA 5HE3B 1Q47A 4FA1D 3OKYA 1SQ9A 4L3GD 2H68A 3EI1B 1GOTB 3K27A 4IMMA 3FM0A 3IJ0A 5SXMA 4R7AB 4HDJA 2HESX 2XU7A 4A2LA 3UVOA 3PE7A 4J8BA 5FA5B 4G56B 2YMUA 4CI2A 4CZXA 2AGXA 2P9SC 4CI3A 3HFQA 4ES0A 3I2NA 2BCJB 3UVKA 1P22A 4GQBB 4EWRA 2P9LC 5CXBA 5CXCB 4J0XA 4FA9D 3EU7A 4JT5C 3PSLA 4FA5D 2HKMA 2AH1A 4PBZA 2J56H 3I8EA 4X63B 2H9NA 2P9KC 3MXXA 5HE1B 3OL2A 4A09A 2B5MA 2Z2NA 4FHLA 5FKQA 3MMYA 4O3TB 4ERYA 4A0AA 1GXRA 3MZLA 2XL2A 4A0BA 1N6FA 3PXTD 2O9KA 2EBSA 4BUJC 1GP2B 4GM3A 2G9AA 4K3JB 3EI3A 4AEZA 2PM9A 3PXSD 2OK6A 4J79A 3JROA 3BG1A 3RMZD 2UZYB 3OL2B 4ERQA 3N0EA 3UVNA 2P9IC 3ZWLB 5C2WB 3AH8B 2MTAH 2Q7QA 1SQJA 4J0WA 4JD2C 5I5JA 5HQGA 2IWFA 5EM2B 4H5IA 2BBKH 4J84A 3IIWA 5FKTA 2PM6B 2H14A 4A0BB 2PM7B 5H17A 2QXVA 3J81g 2IURA 3SBQA 3RLMD 4Y7RA 3SMRA 2CNXA 1VYHC 1NEXB 2AH0A 5A2Qg 4A08B 4BH6A 4GM8A 4J8GA 4JSVC 4IA9A 5EM2A 3UVLA 2AQ5A 3ULEC 3NVQA 2GC4A 3JPXA 2YNOA 5GXIA 4GQ2P 4A0AB 3GFCA 4O45A 3SBRA 2OIZA 2IUPA 2CN2A 4PSXB 1XHMA 1NR0A 2XYIA 2YNNA 4J81A 5EMJB 4X60B 1U2VC 3I7NA 2AGYA 3V7DB 5IC7A 5GXHA 2J57G 1B9YA 2CN3A 3EI3B 3FRXA 3SLED 4ESGA 5HYNB 5EMMB 4ZOXA 4PC0A 3V9FA 4A2MA 3B7FA 4L3HD 2YBAA 5EAPA 4CI1A 4GM9A 4L9OA 4QQEA 5CYKA 4CY1A 2AGLA 2OVQB 5KDOB 4E54A 3SFZA 3V5WB 5B4WA 4O1QD 3JZGA 3JZHA 3SBPA 5THAA 1PI6A 3DM0A 1JJUB 2B5NA 3SJLD 3RN0D 5I5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG8 A;  3JB9 L;  3SCY A;  2OVR B;  4U1E I;  2OJY A;  3L4O D;  2IAA A;  4E5Z A;  5FQD A;  4J73 A;  1FWX A;  4OZU A;  4N14 A;  3U4Y A;  1N6E A;  5CXC A;  3A0F A;  3MKQ A;  4O9D A;  4A7J A;  5AFU 3;  3PSC B;  2H6K A;  2PBI B;  4L1Q D;  3C75 H;  1MG3 A;  1K32 A;  4JSP C;  4CI8 A;  5GSA A;  2W18 A;  3SVW D;  3IKO A;  3DSM A;  5IGO A;  4K3I D;  3EI4 A;  1R5M A;  4XEI C;  1B9X A;  3MZK A;  3CFS B;  3JZN A;  4E54 B;  1YFQ A;  3EI2 A;  3CIK B;  4NSX A;  4E5Z B;  2I3T A;  4CZV A;  2HJB A;  3AL8 A;  2AGZ A;  3VH0 A;  3NVX A;  5TF2 A;  2YNP A;  5TEF A;  5AMS A;  3UKU C;  3NVN A;  4BL0 A;  1OLZ A;  3N0D A;  2I3S A;  3MKS B;  5EML B;  3EMH A;  4GQ1 A;  3J80 g;  3CFV A;  2I0R A;  1XIP A;  2B5L A;  4X3E A;  3AL9 A;  1K8K C;  1PGU A;  3I7H A;  5EAL A;  4D6V A;  2H9L A;  4ZOZ A;  2CO0 A;  3UVM A;  5HE2 B;  2H9P A;  2OVP B;  4CY3 A;  3PVU B;  4D0K A;  3IIY A;  1XKS A;  3DXM C;  2QC5 A;  4ZOY A;  2I0T A;  4OWR A;  2H6Q A;  3EI1 A;  4LGN A;  3OW8 A;  3RFG A;  4Z8L A;  3I8C A;  2I0S A;  4JSN C;  3KRX B;  4PBY A;  2CE9 A;  2GC7 A;  4JXM A;  2CE8 A;  4X61 B;  3P4F A;  5CXB B;  4A11 A;  3SXT D;  4YVD A;  2IWK A;  4QL1 A;  4O3U B;  3KRW B;  4H5J A;  3IJC A;  4KFM B;  2H6N A;  4UI9 R;  2Z2P A;  2YB8 B;  5AJA A;  3UKR C;  5GMK n;  3I7L A;  2J55 H;  4XYI A;  3OKY B;  3F3F A;  3EG6 A;  4QRJ A;  5K1C C;  1PBY B;  5FLX g;  3JRP A;  4J77 A;  2OK4 A;  4GGD A;  4J86 A;  3VGZ A;  2H47 A;  4I79 A;  5K19 A;  5TDH B;  4GGC A;  3ODT A;  4FWW A;  4TZ4 A;  4LG9 A;  5FXY A;  4JSX C;  5IGQ A;  4A11 B;  2G99 A;  3DWL C;  4CC9 A;  4ZOV A;  3F3G A;  4J78 A;  5CYK B;  4JT6 C;  3RSE C;  3C99 A;  1QNI A;  2PM9 B;  5EMK B;  4QT8 A;  3JAM g;  3BWS A;  4GMB A;  2Z2O A;  4PXW A;  4GZ8 A;  3RFH A;  3DXK C;  4FAN D;  4FAV D;  3ORV D;  3SWS D;  1ERJ A;  1JMZ B;  4CY5 A;  2HKR A;  3EI2 B;  3FGB A;  2H9M A;  2P9U C;  3UR4 A;  3I89 A;  3AFC A;  5H14 A;  2AGW A;  3RN1 D;  2IUV A;  4CZY A;  5TEE A;  2P9N C;  4ERZ A;  4Y5R D;  2CO0 C;  3C5M A;  3PXW D;  3W15 A;  3E0C A;  4FA4 D;  1JMX B;  1U4C A;  5EAR A;  5JWZ A;  4J87 A;  2HJ4 A;  1MDA H;  3C9C A;  4U7A A;  3K26 A;  3SHF A;  1PEV A;  3F3P A;  5H1M A;  5FKR A;  3EWE A;  3VA6 A;  3EI4 B;  5FKS A;  3I7O A;  2HXC A;  4A08 A;  3SN6 B;  3PVW B;  4PNK B;  5IJ8 E;  3I7K A;  4A09 B;  1TYQ C;  5IT9 g;  5EAM A;  3I7P A;  3OTT A;  4CY2 A;  1GG2 B;  3IJ1 A;  1L0Q A;  4GGA A;  2GNQ A;  3RRM C;  1RI6 A;  4XYH A;  4ZN4 A;  5C2V B;  5HE0 B;  3OKT A;  5I5M A;  5C9Z B;  1N6D A;  3L4M D;  1A0R B;  1OMW B;  3AL8 B;  2IUQ A;  3GRE A;  3OKW A;  1MG2 A;  2P9P C;  3BG0 A;  4FB1 D;  4AOW A;  1TBG A;  4PSW B;  2XL3 A;  2H13 A;  2UZX B;  4J82 A;  1JOF A;  4MK0 B;  1S4U X;  2H3X A;  2TRC B;  2B4E A;  1SHY B;  5IJ7 E;  2HYE A;  5HE3 B;  1Q47 A;  4FA1 D;  3OKY A;  1SQ9 A;  4L3G D;  2H68 A;  3EI1 B;  1GOT B;  3K27 A;  4IMM A;  3FM0 A;  3IJ0 A;  5SXM A;  4R7A B;  4HDJ A;  2HES X;  2XU7 A;  4A2L A;  3UVO A;  3PE7 A;  4J8B A;  5FA5 B;  4G56 B;  2YMU A;  4CI2 A;  4CZX A;  2AGX A;  2P9S C;  4CI3 A;  3HFQ A;  4ES0 A;  3I2N A;  2BCJ B;  3UVK A;  1P22 A;  4GQB B;  4EWR A;  2P9L C;  5CXB A;  5CXC B;  4J0X A;  4FA9 D;  3EU7 A;  4JT5 C;  3PSL A;  4FA5 D;  2HKM A;  2AH1 A;  4PBZ A;  2J56 H;  3I8E A;  4X63 B;  2H9N A;  2P9K C;  3MXX A;  5HE1 B;  3OL2 A;  4A09 A;  2B5M A;  2Z2N A;  4FHL A;  5FKQ A;  3MMY A;  4O3T B;  4ERY A;  4A0A A;  1GXR A;  3MZL A;  2XL2 A;  4A0B A;  1N6F A;  3PXT D;  2O9K A;  2EBS A;  4BUJ C;  1GP2 B;  4GM3 A;  2G9A A;  4K3J B;  3EI3 A;  4AEZ A;  2PM9 A;  3PXS D;  2OK6 A;  4J79 A;  3JRO A;  3BG1 A;  3RMZ D;  2UZY B;  3OL2 B;  4ERQ A;  3N0E A;  3UVN A;  2P9I C;  3ZWL B;  5C2W B;  3AH8 B;  2MTA H;  2Q7Q A;  1SQJ A;  4J0W A;  4JD2 C;  5I5J A;  5HQG A;  2IWF A;  5EM2 B;  4H5I A;  2BBK H;  4J84 A;  3IIW A;  5FKT A;  2PM6 B;  2H14 A;  4A0B B;  2PM7 B;  5H17 A;  2QXV A;  3J81 g;  2IUR A;  3SBQ A;  3RLM D;  4Y7R A;  3SMR A;  2CNX A;  1VYH C;  1NEX B;  2AH0 A;  5A2Q g;  4A08 B;  4BH6 A;  4GM8 A;  4J8G A;  4JSV C;  4IA9 A;  5EM2 A;  3UVL A;  2AQ5 A;  3ULE C;  3NVQ A;  2GC4 A;  3JPX A;  2YNO A;  5GXI A;  4GQ2 P;  4A0A B;  3GFC A;  4O45 A;  3SBR A;  2OIZ A;  2IUP A;  2CN2 A;  4PSX B;  1XHM A;  1NR0 A;  2XYI A;  2YNN A;  4J81 A;  5EMJ B;  4X60 B;  1U2V C;  3I7N A;  2AGY A;  3V7D B;  5IC7 A;  5GXH A;  2J57 G;  1B9Y A;  2CN3 A;  3EI3 B;  3FRX A;  3SLE D;  4ESG A;  5HYN B;  5EMM B;  4ZOX A;  4PC0 A;  3V9F A;  4A2M A;  3B7F A;  4L3H D;  2YBA A;  5EAP A;  4CI1 A;  4GM9 A;  4L9O A;  4QQE A;  5CYK A;  4CY1 A;  2AGL A;  2OVQ B;  5KDO B;  4E54 A;  3SFZ A;  3V5W B;  5B4W A;  4O1Q D;  3JZG A;  3JZH A;  3SBP A;  5THA A;  1PI6 A;  3DM0 A;  1JJU B;  2B5N A;  3SJL D;  3RN0 D;  5I5I A; 
#chains in the Genus database with same CATH topology
 4LG8 A;  3JB9 L;  3SCY A;  2OVR B;  4U1E I;  3QHY B;  2OJY A;  3L4O D;  2IAA A;  4BCD A;  4E5Z A;  5FQD A;  4J73 A;  1FWX A;  4OZU A;  4O02 A;  4N14 A;  3U4Y A;  1N6E A;  5CXC A;  3A0F A;  3MKQ A;  4O9D A;  2XDW A;  4A7J A;  1UTC A;  5AFU 3;  3PSC B;  2H6K A;  2PBI B;  4L1Q D;  3C75 H;  3T3P A;  1E5T A;  1K32 A;  1MG3 A;  3IUL A;  4JSP C;  4CI8 A;  5M5T A;  5GSA A;  2W18 A;  3SVW D;  3IKO A;  3DSM A;  5IGO A;  1GOH A;  4BCB A;  4K3I D;  3EI4 A;  1R5M A;  4XEI C;  1B9X A;  3MZK A;  3CFS B;  3JZN A;  4E54 B;  1YFQ A;  3EI2 A;  3CIK B;  4NSX A;  1UOP A;  4E5Z B;  2I3T A;  4CZV A;  2HJB A;  3AL8 A;  2AGZ A;  3VH0 A;  3NVX A;  5TF2 A;  1TYE A;  2YNP A;  2HU7 A;  5TEF A;  5AMS A;  1JTD B;  3UKU C;  1C9L A;  3IUN A;  1VZ2 A;  3NVN A;  4BL0 A;  1OLZ A;  3N0D A;  2I3S A;  3MKS B;  5EML B;  3EMH A;  4GQ1 A;  1QFS A;  3J80 g;  3EQ8 A;  3ZDZ A;  3CFV A;  2I0R A;  4NEN A;  1XIP A;  2B5L A;  4X3E A;  3AL9 A;  1K8K C;  1PGU A;  3I7H A;  2XE4 A;  5EAL A;  4D6V A;  5HDB A;  3DDU A;  2H9L A;  2XZG A;  4ZOZ A;  2CO0 A;  2VDO A;  3UVM A;  5HE2 B;  2H9P A;  2OVP B;  4CY3 A;  3PVU B;  4D0K A;  3IIY A;  1XKS A;  3DXM C;  1H2Y A;  2QC5 A;  4ZOY A;  2I0T A;  4OWR A;  2H6Q A;  3EI1 A;  4LGN A;  3OW8 A;  1H2X A;  3RFG A;  5FFG A;  2VDR A;  4Z8L A;  3I8C A;  2I0S A;  3O4J A;  2VDK A;  4JSN C;  4WJK A;  3KRX B;  5M5U A;  4PBY A;  1I2M B;  4BCC A;  2CE9 A;  2GC7 A;  2VDM A;  4JXM A;  2CE8 A;  4X61 B;  3P4F A;  5CXB B;  4A11 A;  3O4H A;  3SXT D;  3K71 A;  4YVD A;  4G1M A;  3FCU A;  1YR2 A;  2IWK A;  3NIF A;  4QL1 A;  4O3U B;  5M61 A;  3KRW B;  4H5J A;  3IJC A;  4KFM B;  2H6N A;  4UI9 R;  2Z2P A;  2YB8 B;  1H2W A;  5AJA A;  3UKR C;  3NIG A;  3ZE0 A;  5GMK n;  3I7L A;  2J55 H;  4XYI A;  3OKY B;  3QI0 A;  3F3F A;  3EG6 A;  1O6F A;  3V4P A;  4QRJ A;  5K1C C;  1PBY B;  1UOQ A;  3KCI A;  4JHP C;  2VDQ A;  5FLX g;  3JRP A;  4J77 A;  2OK4 A;  4GGD A;  4J86 A;  3K72 A;  2BKL A;  3VGZ A;  2H47 A;  4I79 A;  5K19 A;  5TDH B;  4GGC A;  3VI3 A;  3ODT A;  4FWW A;  4TZ4 A;  4LG9 A;  5FXY A;  4QAM A;  1BPO A;  3T3M A;  4JSX C;  5M5V A;  5IGQ A;  4A11 B;  3VI4 A;  2G99 A;  3DWL C;  4CC9 A;  4ZOV A;  3F3G A;  4J78 A;  5CYK B;  4JT6 C;  3RSE C;  2HU8 A;  3C99 A;  2QR5 A;  1QNI A;  2PM9 B;  5EMK B;  4QT8 A;  3JAM g;  4RE5 A;  3BWS A;  4GMB A;  2Z2O A;  4PXW A;  4GZ8 A;  3RFH A;  3DXK C;  4FAN D;  4FAV D;  3ORV D;  3SWS D;  1ERJ A;  1JMZ B;  4CY5 A;  3EQ9 A;  2HKR A;  3EI2 B;  4JHN A;  3FGB A;  2H9M A;  2P9U C;  3UR4 A;  3GD1 I;  3I89 A;  3AFC A;  5H14 A;  2AGW A;  4DNW A;  3RN1 D;  2IUV A;  3V4V A;  3IJE A;  4CZY A;  5TEE A;  2P9N C;  1VE6 A;  4ERZ A;  4Y5R D;  2CO0 C;  3C5M A;  3PXW D;  3W15 A;  3E0C A;  4FA4 D;  1JMX B;  1U4C A;  5EAR A;  5JWZ A;  4J87 A;  2HJ4 A;  1MDA H;  1QFM A;  3C9C A;  4MMX A;  4U7A A;  3K26 A;  3SHF A;  1PEV A;  3F3P A;  5H1M A;  4AN0 A;  5FKR A;  3EWE A;  3VA6 A;  3EI4 B;  2JKX A;  1T2X A;  5FKS A;  3I7O A;  2HXC A;  2VDP A;  4A08 A;  1L5G A;  3SN6 B;  4Z7Q A;  3PVW B;  4PNK B;  5IJ8 E;  3EQ7 A;  3I7K A;  4A09 B;  1TYQ C;  5IT9 g;  5EAM A;  3I7P A;  2VDL A;  1E8N A;  3OTT A;  4CY2 A;  1GG2 B;  3IJ1 A;  1L0Q A;  1O6G A;  4GGA A;  2GNQ A;  2EIB A;  3RRM C;  4AMY A;  1RI6 A;  4XYH A;  4ZN4 A;  4DNU A;  2EIC A;  5C2V B;  5HE0 B;  4AMZ A;  3OKT A;  5I5M A;  5C9Z B;  1N6D A;  3L4M D;  1A0R B;  1OMW B;  3AL8 B;  2IUQ A;  3GRE A;  3OKW A;  1MG2 A;  2P9P C;  3BG0 A;  4FB1 D;  4AOW A;  1TBG A;  4PSW B;  2XL3 A;  2H13 A;  2UZX B;  3O4G A;  2EID A;  4J82 A;  4DNV A;  1JOF A;  1K3I A;  4WK2 A;  4MK0 B;  1S4U X;  2H3X A;  2EIE A;  2TRC B;  2B4E A;  1SHY B;  5IJ7 E;  2HYE A;  5E6U A;  4AX4 A;  3IUR A;  5HE3 B;  1Q47 A;  4FA1 D;  3OKY A;  1SQ9 A;  4L3G D;  2H68 A;  4Z7O A;  3EI1 B;  1GOT B;  3K27 A;  4IMM A;  4WK4 A;  3FM0 A;  3IJ0 A;  5SXM A;  5M5R A;  4Z7N A;  4R7A B;  4HDJ A;  2HES X;  2XU7 A;  4A2L A;  3UVO A;  3PE7 A;  4J8B A;  5FA5 B;  4G56 B;  3ZDY A;  2YMU A;  4CI2 A;  5M5S A;  4BP9 A;  1GOG A;  2VZ3 A;  4CZX A;  2AGX A;  2P9S C;  4CI3 A;  3HFQ A;  4ES0 A;  3I2N A;  1UOO A;  4D9S A;  2BCJ B;  3UVK A;  1P22 A;  4GQB B;  4EWR A;  2P9L C;  5CXB A;  1A12 A;  4UM8 A;  5CXC B;  2VC2 A;  4J0X A;  4FA9 D;  3EU7 A;  1JV2 A;  4JT5 C;  3PSL A;  4FA5 D;  2HKM A;  3FCS A;  2AH1 A;  1U8C A;  4PBZ A;  2J56 H;  3I8E A;  3MXX A;  2H9N A;  2P9K C;  4X63 B;  5HE1 B;  3OL2 A;  4A09 A;  2B5M A;  2Z2N A;  2QZP A;  4FHL A;  5FKQ A;  3MMY A;  4O3T B;  4ERY A;  4A0A A;  1GXR A;  3MZL A;  2XL2 A;  4A0B A;  4NAA A;  4MMY A;  4NBM A;  3GC3 B;  1N6F A;  3PXT D;  2O9K A;  2EBS A;  4BUJ C;  1GP2 B;  4GM3 A;  2G9A A;  2VZ1 A;  4K3J B;  3EI3 A;  3NID A;  3IUJ A;  4AEZ A;  2PM9 A;  3PXS D;  2OK6 A;  4J79 A;  3JRO A;  3BG1 A;  3RMZ D;  2UZY B;  2VDN A;  3OL2 B;  4AN1 A;  4ERQ A;  3N0E A;  4RE6 A;  3UVN A;  2P9I C;  3ZWL B;  5C2W B;  1C9I A;  3AH8 B;  2MTA H;  2Q7Q A;  1M1X A;  1SQJ A;  4J0W A;  4JD2 C;  5I5J A;  5HQG A;  2IWF A;  5EM2 B;  4H5I A;  2BBK H;  5C92 A;  4J84 A;  3MUO A;  3IIW A;  5FKT A;  2PM6 B;  2H14 A;  4UM9 A;  4A0B B;  2PM7 B;  5H17 A;  2QXV A;  3O4I A;  1E8M A;  4O2W A;  5E6S A;  3J81 g;  1H2Z A;  2IUR A;  3OF7 A;  2HU5 A;  3SBQ A;  3RLM D;  4Y7R A;  3SMR A;  1VYH C;  2CNX A;  1NEX B;  2AH0 A;  5A2Q g;  2WQ8 A;  4MMZ A;  4A08 B;  4BH6 A;  4GM8 A;  4J8G A;  4JSV C;  4IA9 A;  5EM2 A;  4IRZ A;  3UVL A;  2AQ5 A;  3ULE C;  3NVQ A;  1VZ3 A;  2GC4 A;  3JPX A;  2YNO A;  5GXI A;  4GQ2 P;  4A0A B;  3GFC A;  4O45 A;  3SBR A;  2OIZ A;  4BP8 A;  2IUP A;  2CN2 A;  4G55 A;  4PSX B;  4WK0 A;  1XHM A;  1NR0 A;  2XYI A;  2YNN A;  4J81 A;  5EMJ B;  4X60 B;  5FFO A;  5C86 A;  1U2V C;  3I7N A;  2AGY A;  3V7D B;  5IC7 A;  5GXH A;  2J57 G;  1B9Y A;  2CN3 A;  1VE7 A;  3EI3 B;  3FRX A;  4G1E A;  3SLE D;  1GOF A;  4ESG A;  5HYN B;  5EMM B;  3ZE1 A;  4ZOX A;  4PC0 A;  3V9F A;  4A2M A;  3B7F A;  4L3H D;  3IVM A;  2YBA A;  3ZDX A;  5EAP A;  4CI1 A;  3IUQ A;  4GM9 A;  4L9O A;  4L1M A;  4QQE A;  3IUM A;  5CYK A;  4CY1 A;  2AGL A;  2OVQ B;  3MVD K;  5KDO B;  4NC4 A;  5E6R A;  4E54 A;  3SFZ A;  3V5W B;  3MUN A;  5B4W A;  3ZE2 A;  3K6S A;  4O1Q D;  3JZG A;  3JZH A;  3SBP A;  5THA A;  1PI6 A;  3DM0 A;  1JJU B;  2B5N A;  3SJL D;  3RN0 D;  5I5I A; 
#chains in the Genus database with same CATH homology
 4LG8 A;  3JB9 L;  3SCY A;  2OVR B;  4U1E I;  2OJY A;  3L4O D;  2IAA A;  4E5Z A;  5FQD A;  4J73 A;  1FWX A;  4OZU A;  4N14 A;  3U4Y A;  1N6E A;  5CXC A;  3A0F A;  3MKQ A;  4O9D A;  4A7J A;  5AFU 3;  3PSC B;  2H6K A;  2PBI B;  4L1Q D;  3C75 H;  1MG3 A;  1K32 A;  4JSP C;  4CI8 A;  5GSA A;  2W18 A;  3SVW D;  3IKO A;  3DSM A;  5IGO A;  4K3I D;  3EI4 A;  1R5M A;  4XEI C;  1B9X A;  3MZK A;  3CFS B;  3JZN A;  4E54 B;  1YFQ A;  3EI2 A;  3CIK B;  4NSX A;  4E5Z B;  2I3T A;  4CZV A;  2HJB A;  3AL8 A;  2AGZ A;  3VH0 A;  3NVX A;  5TF2 A;  2YNP A;  5TEF A;  5AMS A;  3UKU C;  3NVN A;  4BL0 A;  1OLZ A;  3N0D A;  2I3S A;  3MKS B;  5EML B;  3EMH A;  4GQ1 A;  3J80 g;  3CFV A;  2I0R A;  1XIP A;  2B5L A;  4X3E A;  3AL9 A;  1K8K C;  1PGU A;  3I7H A;  5EAL A;  4D6V A;  2H9L A;  4ZOZ A;  2CO0 A;  3UVM A;  5HE2 B;  2H9P A;  2OVP B;  4CY3 A;  3PVU B;  4D0K A;  3IIY A;  1XKS A;  3DXM C;  2QC5 A;  4ZOY A;  2I0T A;  4OWR A;  2H6Q A;  3EI1 A;  4LGN A;  3OW8 A;  3RFG A;  4Z8L A;  3I8C A;  2I0S A;  4JSN C;  3KRX B;  4PBY A;  2CE9 A;  2GC7 A;  4JXM A;  2CE8 A;  4X61 B;  3P4F A;  5CXB B;  4A11 A;  3SXT D;  4YVD A;  2IWK A;  4QL1 A;  4O3U B;  3KRW B;  4H5J A;  3IJC A;  4KFM B;  2H6N A;  4UI9 R;  2Z2P A;  2YB8 B;  5AJA A;  3UKR C;  5GMK n;  3I7L A;  2J55 H;  4XYI A;  3OKY B;  3F3F A;  3EG6 A;  4QRJ A;  5K1C C;  1PBY B;  5FLX g;  3JRP A;  4J77 A;  2OK4 A;  4GGD A;  4J86 A;  3VGZ A;  2H47 A;  4I79 A;  5K19 A;  5TDH B;  4GGC A;  3ODT A;  4FWW A;  4TZ4 A;  4LG9 A;  5FXY A;  4JSX C;  5IGQ A;  4A11 B;  2G99 A;  3DWL C;  4CC9 A;  4ZOV A;  3F3G A;  4J78 A;  5CYK B;  4JT6 C;  3RSE C;  3C99 A;  1QNI A;  2PM9 B;  5EMK B;  4QT8 A;  3JAM g;  3BWS A;  4GMB A;  2Z2O A;  4PXW A;  4GZ8 A;  3RFH A;  3DXK C;  4FAN D;  4FAV D;  3ORV D;  3SWS D;  1ERJ A;  1JMZ B;  4CY5 A;  2HKR A;  3EI2 B;  3FGB A;  2H9M A;  2P9U C;  3UR4 A;  3I89 A;  3AFC A;  5H14 A;  2AGW A;  3RN1 D;  2IUV A;  4CZY A;  5TEE A;  2P9N C;  4ERZ A;  4Y5R D;  2CO0 C;  3C5M A;  3PXW D;  3W15 A;  3E0C A;  4FA4 D;  1JMX B;  1U4C A;  5EAR A;  5JWZ A;  4J87 A;  2HJ4 A;  1MDA H;  3C9C A;  4U7A A;  3K26 A;  3SHF A;  1PEV A;  3F3P A;  5H1M A;  5FKR A;  3EWE A;  3VA6 A;  3EI4 B;  5FKS A;  3I7O A;  2HXC A;  4A08 A;  3SN6 B;  3PVW B;  4PNK B;  5IJ8 E;  3I7K A;  4A09 B;  1TYQ C;  5IT9 g;  5EAM A;  3I7P A;  3OTT A;  4CY2 A;  1GG2 B;  3IJ1 A;  1L0Q A;  4GGA A;  2GNQ A;  3RRM C;  1RI6 A;  4XYH A;  4ZN4 A;  5C2V B;  5HE0 B;  3OKT A;  5I5M A;  5C9Z B;  1N6D A;  3L4M D;  1A0R B;  1OMW B;  3AL8 B;  2IUQ A;  3GRE A;  3OKW A;  1MG2 A;  2P9P C;  3BG0 A;  4FB1 D;  4AOW A;  1TBG A;  4PSW B;  2XL3 A;  2H13 A;  2UZX B;  4J82 A;  1JOF A;  4MK0 B;  1S4U X;  2H3X A;  2TRC B;  2B4E A;  1SHY B;  5IJ7 E;  2HYE A;  5HE3 B;  1Q47 A;  4FA1 D;  3OKY A;  1SQ9 A;  4L3G D;  2H68 A;  3EI1 B;  1GOT B;  3K27 A;  4IMM A;  3FM0 A;  3IJ0 A;  5SXM A;  4R7A B;  4HDJ A;  2HES X;  2XU7 A;  4A2L A;  3UVO A;  3PE7 A;  4J8B A;  5FA5 B;  4G56 B;  2YMU A;  4CI2 A;  4CZX A;  2AGX A;  2P9S C;  4CI3 A;  3HFQ A;  4ES0 A;  3I2N A;  2BCJ B;  3UVK A;  1P22 A;  4GQB B;  4EWR A;  2P9L C;  5CXB A;  5CXC B;  4J0X A;  4FA9 D;  3EU7 A;  4JT5 C;  3PSL A;  4FA5 D;  2HKM A;  2AH1 A;  4PBZ A;  2J56 H;  3I8E A;  4X63 B;  2H9N A;  2P9K C;  3MXX A;  5HE1 B;  3OL2 A;  4A09 A;  2B5M A;  2Z2N A;  4FHL A;  5FKQ A;  3MMY A;  4O3T B;  4ERY A;  4A0A A;  1GXR A;  3MZL A;  2XL2 A;  4A0B A;  1N6F A;  3PXT D;  2O9K A;  2EBS A;  4BUJ C;  1GP2 B;  4GM3 A;  2G9A A;  4K3J B;  3EI3 A;  4AEZ A;  2PM9 A;  3PXS D;  2OK6 A;  4J79 A;  3JRO A;  3BG1 A;  3RMZ D;  2UZY B;  3OL2 B;  4ERQ A;  3N0E A;  3UVN A;  2P9I C;  3ZWL B;  5C2W B;  3AH8 B;  2MTA H;  2Q7Q A;  1SQJ A;  4J0W A;  4JD2 C;  5I5J A;  5HQG A;  2IWF A;  5EM2 B;  4H5I A;  2BBK H;  4J84 A;  3IIW A;  5FKT A;  2PM6 B;  2H14 A;  4A0B B;  2PM7 B;  5H17 A;  2QXV A;  3J81 g;  2IUR A;  3SBQ A;  3RLM D;  4Y7R A;  3SMR A;  2CNX A;  1VYH C;  1NEX B;  2AH0 A;  5A2Q g;  4A08 B;  4BH6 A;  4GM8 A;  4J8G A;  4JSV C;  4IA9 A;  5EM2 A;  3UVL A;  2AQ5 A;  3ULE C;  3NVQ A;  2GC4 A;  3JPX A;  2YNO A;  5GXI A;  4GQ2 P;  4A0A B;  3GFC A;  4O45 A;  3SBR A;  2OIZ A;  2IUP A;  2CN2 A;  4PSX B;  1XHM A;  1NR0 A;  2XYI A;  2YNN A;  4J81 A;  5EMJ B;  4X60 B;  1U2V C;  3I7N A;  2AGY A;  3V7D B;  5IC7 A;  5GXH A;  2J57 G;  1B9Y A;  2CN3 A;  3EI3 B;  3FRX A;  3SLE D;  4ESG A;  5HYN B;  5EMM B;  4ZOX A;  4PC0 A;  3V9F A;  4A2M A;  3B7F A;  4L3H D;  2YBA A;  5EAP A;  4CI1 A;  4GM9 A;  4L9O A;  4QQE A;  5CYK A;  4CY1 A;  2AGL A;  2OVQ B;  5KDO B;  4E54 A;  3SFZ A;  3V5W B;  5B4W A;  4O1Q D;  3JZG A;  3JZH A;  3SBP A;  5THA A;  1PI6 A;  3DM0 A;  1JJU B;  2B5N A;  3SJL D;  3RN0 D;  5I5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...