2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
2IAAA 2AH0A 4XEIC 4BH6A 3E0CA 2CN3A 4H5JA 3BG0A 3MZKA 4LG8A 2OIZA 2PBIB 2OK6A 3ODTA 4U1EI 4XYHA 1MG2A 3I7OA 2W18A 3K27A 5C2WB 2CO0A 4ERYA 4FAVD 2P9PC 2IUVA 4PSWB 3DXKC 4J78A 2J55H 3NVQA 4FWWA 3UKRC 5CYKA 2CE9A 4O3UB 5CXBB 2XU7A 4CY5A 3SJLD 3J80g 4N14A 4AOWA 3UVNA 3KRXB 4GMBA 5EAMA 1GXRA 5HE1B 2AH1A 2YBAA 4H5IA 2OK4A 3NVNA 3DXMC 3SBRA 4XYIA 3OKTA 1B9YA 4JSXC 5I5MA 3EMHA 2IURA 3A0FA 4ZOVA 3SFZA 3UVLA 1R5MA 2H6KA 2YMUA 2IUQA 4ERQA 5CYKB 1K8KC 4ERZA 2H13A 2O9KA 1QNIA 3CFSB 4I79A 4GQBB 4D6VA 3OKWA 4L3HD 4GM8A 1VYHC 3OL2A 4E54B 3V5WB 1OLZA 3HFQA 4U7AA 5EM2A 3N0EA 3IJ1A 3UR4A 1A0RB 4ZOZA 3RN1D 1XIPA 4QT8A 2QC5A 3IIWA 3RRMC 4J79A 2HKRA 4A0AB 1U2VC 2H9LA 1N6FA 3OKYA 2GC4A 3EG6A 4O3TB 4L9OA 3OL2B 3SXTD 3RN0D 5CXCA 5EAPA 5B4WA 4L1QD 2OVRB 3ULEC 5EM2B 4PSXB 1PEVA 2I0TA 2CE8A 2UZYB 1U4CA 3PVUB 3I7NA 4J77A 4A2MA 4PBYA 2YNNA 3PXSD 4Y7RA 5JWZA 4CI1A 5FXYA 1N6DA 3UVKA 4JXMA 4CC9A 3EI4A 3C99A 4X3EA 5CXCB 5IT9g 4IMMA 4CI2A 2BCJB 5GSAA 4QRJA 1TBGA 5H14A 2HJBA 5A2Qg 5I5IA 5CXBA 3I89A 5IJ8E 2PM6B 2OVQB 3IJ0A 5FKQA 3MKQA 2P9SC 3PXWD 5AJAA 5TF2A 4JT5C 2HESX 4A11A 3EI4B 4J0WA 2UZXB 3SVWD 4A0BA 5K19A 4FAND 5TDHB 2H14A 2H9PA 2H6QA 3F3FA 2EBSA 2Z2OA 3EI3A 2H6NA 2XL2A 5TEFA 4E54A 5EMLB 2HKMA 3RLMD 1YFQA 2I0RA 4J8GA 2H68A 3PE7A 4LG9A 4A11B 4E5ZA 2CO0C 2CNXA 4FB1D 4ZOXA 2P9IC 5KDOB 3FRXA 4A0BB 3ORVD 4A7JA 1JMZB 4ZN4A 3PSCB 2H3XA 2IWKA 4O1QD 3UKUC 2GC7A 3OTTA 5GXIA 5IGQA 5HE0B 2YNOA 3U4YA 4A0AA 4FA5D 3SN6B 2HYEA 3J81g 4J73A 3V7DB 3EI3B 4PXWA 1JOFA 2IWFA 2OVPB 3FM0A 5EMJB 3PVWB 2Q7QA 3I7KA 5TEEA 4E5ZB 4J84A 3SBPA 2Z2PA 4ES0A 4JT6C 1XKSA 5IGOA 3W15A 5FKTA 3B7FA 2J56H 3C75H 3EI2A 4GM9A 4X60B 2H9MA 3L4MD 5FKSA 2HJ4A 5GXHA 1GP2B 4GQ2P 3I7HA 3F3GA 5H17A 3I8EA 1L0QA 3JRPA 5C2VB 3DWLC 3MXXA 4G56B 2B4EA 3BG1A 3IJCA 2XYIA 4CY3A 5FA5B 1K32A 3JZHA 3C9CA 5H1MA 2I0SA 4AEZA 4BUJC 3EI2B 3FGBA 4JSVC 4QL1A 5HQGA 3SHFA 1TYQC 2AGZA 3JB9L 4NSXA 3JZGA 4R7AB 3UVOA 3L4OD 2B5NA 4J87A 4GM3A 1SHYB 2AGLA 4EWRA 4MK0B 2Z2NA 5EMMB 3BWSA 2TRCB 4J81A 2B5MA 5EMKB 3CFVA 4PNKB 3IIYA 2CN2A 3OW8A 4J82A 5EALA 3SLED 1PGUA 5HE3B 2YNPA 4A08A 4CY2A 4J8BA 3RSEC 4JSPC 3AL8A 4KFMB 4PBZA 3MZLA 4A09A 4D0KA 4LGNA 3JAMg 1JMXB 4QQEA 1P22A 5FQDA 2OJYA 3I2NA 5SXMA 4Z8LA 2J57G 3SCYA 3EU7A 3I7PA 4CZYA 3AH8B 1RI6A 2XL3A 4IA9A 3RFHA 3JPXA 3I8CA 1PBYB 5EARA 2PM7B 4A08B 1JJUB 4GGAA 2IUPA 3MMYA 1GG2B 4JD2C 3AL8B 3JZNA 3RMZD 3EI1B 1PI6A 4A09B 4YVDA 3K26A 4HDJA 5FLXg 2BBKH 5HYNB 3RFGA 2GNQA 1SQJA 4J86A 3PSLA 4PC0A 3AL9A 1ERJA 4BL0A 4CZXA 4ZOYA 5C9ZB 4OZUA 3VH0A 1B9XA 2AQ5A 3CIKB 2B5LA 2AGXA 3AFCA 3EWEA 5IJ7E 4FHLA 3P4FA 4L3GD 2HXCA 1OMWB 1XHMA 3KRWB 4GGDA 2P9KC 4CI8A 1NEXB 4OWRA 1FWXA 4CY1A 2P9UC 5IC7A 2G99A 5GMKn 5THAA 2G9AA 4J0XA 5AMSA 2P9LC 2QXVA 3N0DA 5AFU3 4X61B 3VGZA 3DSMA 4JSNC 4CI3A 1GOTB 2I3TA 5HE2B 3SBQA 1SQ9A 4K3ID 4X63B 3F3PA 1NR0A 4Y5RD 3C5MA 4O45A 3V9FA 2PM9A 4A2LA 4GQ1A 4CZVA 5K1CC 3PXTD 3ZWLB 4K3JB 3NVXA 3SMRA 4GZ8A 3I7LA 2AGWA 3GREA 3VA6A 2I3SA 3JROA 3IKOA 2H47A 4TZ4A 1S4UX 1Q47A 2H9NA 4O9DA 4FA9D 3OKYB 3GFCA 3EI1A 1MDAH 2PM9B 5I5JA 4ESGA 4FA1D 3SWSD 2AGYA 2MTAH 4UI9R 4FA4D 4GGCA 5FKRA 1N6EA 2P9NC 2YB8B 1MG3A 3UVMA 3DM0A 3MKSB
chains in the Genus database with same CATH superfamily
2IAAA 2AH0A 4XEIC 4BH6A 4DNVA 3E0CA 2CN3A 4H5JA 1GOFA 3BG0A 3MZKA 2QZPA 2EIDA 3O4GA 4LG8A 2OIZA 2PBIB 4AMZA 2OK6A 3ODTA 4U1EI 2WQ8A 3NIGA 4XYHA 4RE6A 1MG2A 1UOPA 2W18A 3I7OA 3K27A 5C2WB 2CO0A 4ERYA 4FAVD 2P9PC 1T2XA 2IUVA 4PSWB 3DXKC 4J78A 1UOQA 2J55H 3K71A 3EQ7A 3NVQA 4FWWA 3UKRC 5CYKA 4G1EA 2CE9A 2VZ1A 4O3UB 5CXBB 2XU7A 4CY5A 3SJLD 3J80g 4N14A 4AOWA 3UVNA 3KRXB 4GMBA 5EAMA 1GXRA 5HE1B 4MMXA 4O2WA 2VDPA 2AH1A 2YBAA 4H5IA 2OK4A 3NVNA 3DXMC 3SBRA 2HU8A 4XYIA 4DNWA 3OKTA 4BP9A 1B9YA 4JSXC 5I5MA 4WK2A 3EMHA 5M5RA 2IURA 3A0FA 4ZOVA 3SFZA 3UVLA 1R5MA 2H6KA 2YMUA 2IUQA 4ERQA 5CYKB 1K8KC 4UM8A 1JTDB 1K3IA 2H13A 4ERZA 2O9KA 1QNIA 3CFSB 4I79A 3MUNA 4GQBB 4D6VA 3OKWA 4L3HD 5E6RA 4AN0A 4GM8A 3ZDZA 1VYHC 3OL2A 4E54B 3V5WB 1OLZA 1UOOA 3HFQA 4U7AA 5EM2A 2VZ3A 3N0EA 3IJ1A 3UR4A 1A0RB 5HDBA 4ZOZA 3RN1D 1XIPA 4QT8A 2QC5A 3IIWA 3RRMC 4J79A 2HKRA 4A0AB 4BCDA 1U2VC 2H9LA 1N6FA 3OKYA 2GC4A 3EG6A 4O3TB 4BCCA 4IRZA 4L9OA 3OL2B 3SXTD 3RN0D 5CXCA 5EAPA 5B4WA 4L1QD 2OVRB 1L5GA 3ULEC 5EM2B 3ZE0A 4PSXB 3FCSA 1PEVA 2I0TA 2CE8A 2UZYB 1U4CA 3PVUB 3OF7A 2VDQA 3I7NA 4J77A 2VDNA 4A2MA 4PBYA 3FCUA 2YNNA 4MMYA 3PXSD 4Y7RA 4AX4A 1H2WA 5JWZA 4CI1A 5FXYA 1N6DA 3UVKA 4JXMA 2EIEA 4CC9A 3EQ9A 3EI4A 3C99A 4X3EA 5CXCB 5IT9g 4IMMA 1JV2A 4CI2A 2BCJB 5GSAA 1QFSA 4QRJA 1TBGA 3O4IA 5H14A 4AN1A 1U8CA 2HJBA 3VI4A 5A2Qg 5I5IA 3MUOA 5CXBA 3I89A 5IJ8E 1YR2A 5C92A 2PM6B 2OVQB 3IJ0A 3IURA 5FKQA 3MKQA 2P9SC 5FFGA 3PXWD 5AJAA 5TF2A 5E6UA 4JT5C 2HESX 4A11A 3EI4B 2JKXA 4J0WA 2UZXB 3SVWD 4A0BA 5K19A 4FAND 5TDHB 2H14A 2H9PA 2H6QA 1H2YA 1GOHA 3F3FA 2EBSA 4WK0A 4D9SA 3EQ8A 2Z2OA 3EI3A 2H6NA 4Z7OA 2XL2A 5TEFA 4E54A 5EMLB 2HKMA 3RLMD 1YFQA 2I0RA 4J8GA 3MVDK 2H68A 3PE7A 4LG9A 4A11B 4E5ZA 2CNXA 1I2MB 2CO0C 3IUQA 4FB1D 4ZOXA 2P9IC 5KDOB 3FRXA 4A0BB 5M61A 3ORVD 4A7JA 1JMZB 4ZN4A 3PSCB 2H3XA 3IUMA 2IWKA 4O1QD 4BCBA 3UKUC 2GC7A 3OTTA 5GXIA 5IGQA 5HE0B 2YNOA 3U4YA 4A0AA 2HU7A 4QAMA 4FA5D 3SN6B 3ZDXA 2HYEA 3J81g 4J73A 3V7DB 3EI3B 4PXWA 4NAAA 1JOFA 2IWFA 4JHPC 2OVPB 3FM0A 5EMJB 3QI0A 3PVWB 2Q7QA 3I7KA 5TEEA 4E5ZB 1C9LA 4J84A 3SBPA 2Z2PA 4AMYA 4ES0A 4JT6C 1XKSA 5IGOA 3W15A 5FKTA 3B7FA 2J56H 3C75H 4G55A 4L1MA 3EI2A 4GM9A 4X60B 2H9MA 3K6SA 3L4MD 5FKSA 2VDKA 2HJ4A 5GXHA 1GP2B 2VDLA 4GQ2P 3I7HA 3F3GA 5H17A 3I8EA 1L0QA 3JRPA 5C2VB 3T3MA 2XDWA 4UM9A 5M5UA 3DWLC 3KCIA 3MXXA 4G56B 2B4EA 3BG1A 3IJCA 2XYIA 4JHNA 5FA5B 4CY3A 1K32A 3JZHA 3C9CA 3DDUA 5H1MA 2I0SA 2EIBA 4AEZA 4BUJC 3EI2B 3FGBA 4JSVC 4QL1A 5HQGA 3SHFA 3V4VA 1TYQC 2AGZA 3JB9L 1QFMA 4NSXA 3JZGA 4G1MA 4R7AB 3UVOA 5M5TA 3VI3A 3L4OD 4DNUA 3NIFA 2B5NA 4Z7NA 4J87A 4GM3A 1SHYB 5E6SA 2AGLA 4EWRA 4MK0B 2Z2NA 5EMMB 3BWSA 2TRCB 3T3PA 2BKLA 4J81A 2B5MA 2VDOA 5EMKB 3CFVA 4PNKB 3IIYA 2CN2A 3OW8A 4J82A 5EALA 4NENA 3SLED 1PGUA 5HE3B 2YNPA 3NIDA 4CY2A 4A08A 4J8BA 3RSEC 4JSPC 3AL8A 1VE6A 4KFMB 4PBZA 3MZLA 4A09A 4O02A 4D0KA 4LGNA 3JAMg 1JMXB 4QQEA 1P22A 4NC4A 2QR5A 5FQDA 4WK4A 2OJYA 3I2NA 5SXMA 4Z8LA 2J57G 4WJKA 3SCYA 3EU7A 3I7PA 4CZYA 3AH8B 1RI6A 2XL3A 3ZDYA 4IA9A 3RFHA 3JPXA 3ZE1A 3I8CA 1PBYB 5EARA 2PM7B 4A08B 1JJUB 4GGAA 2IUPA 3MMYA 1GG2B 1O6GA 4JD2C 1VZ3A 3AL8B 3JZNA 3RMZD 3EI1B 2HU5A 1PI6A 1VE7A 1UTCA 4A09B 3IUJA 4NBMA 5M5SA 2VC2A 3O4HA 3K26A 4YVDA 4HDJA 5FLXg 2BBKH 2VDRA 3V4PA 5HYNB 3RFGA 2GNQA 4RE5A 2XE4A 3K72A 1SQJA 1VZ2A 4J86A 3PSLA 4PC0A 3AL9A 1ERJA 4BL0A 4CZXA 4ZOYA 3ZE2A 5C9ZB 2VDMA 4OZUA 3VH0A 1C9IA 3IUNA 1B9XA 2AQ5A 5FFOA 3CIKB 2B5LA 2AGXA 3AFCA 3EWEA 5IJ7E 4FHLA 3P4FA 4L3GD 2HXCA 1OMWB 1XHMA 1A12A 3KRWB 4GGDA 2P9KC 1BPOA 4CI8A 1NEXB 4OWRA 1E8NA 1H2XA 1FWXA 4CY1A 2P9UC 3IVMA 5IC7A 2G99A 3IULA 5GMKn 5THAA 2G9AA 4J0XA 5AMSA 2P9LC 2QXVA 3N0DA 5C86A 5AFU3 3QHYB 4X61B 3VGZA 3DSMA 4JSNC 4CI3A 1GOTB 2I3TA 3IJEA 4MMZA 5HE2B 3SBQA 1SQ9A 4K3ID 4BP8A 4X63B 3F3PA 1NR0A 4Y5RD 3C5MA 5M5VA 4O45A 3V9FA 4Z7QA 2PM9A 4A2LA 4GQ1A 4CZVA 5K1CC 3PXTD 3ZWLB 4K3JB 3NVXA 3SMRA 4GZ8A 3I7LA 2AGWA 1M1XA 3GREA 3VA6A 1H2ZA 1GOGA 2I3SA 3JROA 3GC3B 1TYEA 3IKOA 2H47A 4TZ4A 1S4UX 1Q47A 3O4JA 2H9NA 2XZGA 4O9DA 4FA9D 3OKYB 1O6FA 3GFCA 3EI1A 1E8MA 1MDAH 2PM9B 2EICA 5I5JA 4ESGA 3SWSD 4FA1D 2AGYA 1E5TA 2MTAH 4UI9R 4FA4D 4GGCA 5FKRA 3GD1I 1N6EA 2P9NC 2YB8B 1MG3A 3UVMA 3DM0A 3MKSB
chains in the Genus database with same CATH topology
2IAAA 2AH0A 4XEIC 4BH6A 3E0CA 2CN3A 4H5JA 3BG0A 3MZKA 4LG8A 2OIZA 2PBIB 2OK6A 3ODTA 4U1EI 4XYHA 1MG2A 3I7OA 2W18A 3K27A 5C2WB 2CO0A 4ERYA 4FAVD 2P9PC 2IUVA 4PSWB 3DXKC 4J78A 2J55H 3NVQA 4FWWA 3UKRC 5CYKA 2CE9A 4O3UB 5CXBB 2XU7A 4CY5A 3SJLD 3J80g 4N14A 4AOWA 3UVNA 3KRXB 4GMBA 5EAMA 1GXRA 5HE1B 2AH1A 2YBAA 4H5IA 2OK4A 3NVNA 3DXMC 3SBRA 4XYIA 3OKTA 1B9YA 4JSXC 5I5MA 3EMHA 2IURA 3A0FA 4ZOVA 3SFZA 3UVLA 1R5MA 2H6KA 2YMUA 2IUQA 4ERQA 5CYKB 1K8KC 4ERZA 2H13A 2O9KA 1QNIA 3CFSB 4I79A 4GQBB 4D6VA 3OKWA 4L3HD 4GM8A 1VYHC 3OL2A 4E54B 3V5WB 1OLZA 3HFQA 4U7AA 5EM2A 3N0EA 3IJ1A 3UR4A 1A0RB 4ZOZA 3RN1D 1XIPA 4QT8A 2QC5A 3IIWA 3RRMC 4J79A 2HKRA 4A0AB 1U2VC 2H9LA 1N6FA 3OKYA 2GC4A 3EG6A 4O3TB 4L9OA 3OL2B 3SXTD 3RN0D 5CXCA 5EAPA 5B4WA 4L1QD 2OVRB 3ULEC 5EM2B 4PSXB 1PEVA 2I0TA 2CE8A 2UZYB 1U4CA 3PVUB 3I7NA 4J77A 4A2MA 4PBYA 2YNNA 3PXSD 4Y7RA 5JWZA 4CI1A 5FXYA 1N6DA 3UVKA 4JXMA 4CC9A 3EI4A 3C99A 4X3EA 5CXCB 5IT9g 4IMMA 4CI2A 2BCJB 5GSAA 4QRJA 1TBGA 5H14A 2HJBA 5A2Qg 5I5IA 5CXBA 3I89A 5IJ8E 2PM6B 2OVQB 3IJ0A 5FKQA 3MKQA 2P9SC 3PXWD 5AJAA 5TF2A 4JT5C 2HESX 4A11A 3EI4B 4J0WA 2UZXB 3SVWD 4A0BA 5K19A 4FAND 5TDHB 2H14A 2H9PA 2H6QA 3F3FA 2EBSA 2Z2OA 3EI3A 2H6NA 2XL2A 5TEFA 4E54A 5EMLB 2HKMA 3RLMD 1YFQA 2I0RA 4J8GA 2H68A 3PE7A 4LG9A 4A11B 4E5ZA 2CO0C 2CNXA 4FB1D 4ZOXA 2P9IC 5KDOB 3FRXA 4A0BB 3ORVD 4A7JA 1JMZB 4ZN4A 3PSCB 2H3XA 2IWKA 4O1QD 3UKUC 2GC7A 3OTTA 5GXIA 5IGQA 5HE0B 2YNOA 3U4YA 4A0AA 4FA5D 3SN6B 2HYEA 3J81g 4J73A 3V7DB 3EI3B 4PXWA 1JOFA 2IWFA 2OVPB 3FM0A 5EMJB 3PVWB 2Q7QA 3I7KA 5TEEA 4E5ZB 4J84A 3SBPA 2Z2PA 4ES0A 4JT6C 1XKSA 5IGOA 3W15A 5FKTA 3B7FA 2J56H 3C75H 3EI2A 4GM9A 4X60B 2H9MA 3L4MD 5FKSA 2HJ4A 5GXHA 1GP2B 4GQ2P 3I7HA 3F3GA 5H17A 3I8EA 1L0QA 3JRPA 5C2VB 3DWLC 3MXXA 4G56B 2B4EA 3BG1A 3IJCA 2XYIA 4CY3A 5FA5B 1K32A 3JZHA 3C9CA 5H1MA 2I0SA 4AEZA 4BUJC 3EI2B 3FGBA 4JSVC 4QL1A 5HQGA 3SHFA 1TYQC 2AGZA 3JB9L 4NSXA 3JZGA 4R7AB 3UVOA 3L4OD 2B5NA 4J87A 4GM3A 1SHYB 2AGLA 4EWRA 4MK0B 2Z2NA 5EMMB 3BWSA 2TRCB 4J81A 2B5MA 5EMKB 3CFVA 4PNKB 3IIYA 2CN2A 3OW8A 4J82A 5EALA 3SLED 1PGUA 5HE3B 2YNPA 4A08A 4CY2A 4J8BA 3RSEC 4JSPC 3AL8A 4KFMB 4PBZA 3MZLA 4A09A 4D0KA 4LGNA 3JAMg 1JMXB 4QQEA 1P22A 5FQDA 2OJYA 3I2NA 5SXMA 4Z8LA 2J57G 3SCYA 3EU7A 3I7PA 4CZYA 3AH8B 1RI6A 2XL3A 4IA9A 3RFHA 3JPXA 3I8CA 1PBYB 5EARA 2PM7B 4A08B 1JJUB 4GGAA 2IUPA 3MMYA 1GG2B 4JD2C 3AL8B 3JZNA 3RMZD 3EI1B 1PI6A 4A09B 4YVDA 3K26A 4HDJA 5FLXg 2BBKH 5HYNB 3RFGA 2GNQA 1SQJA 4J86A 3PSLA 4PC0A 3AL9A 1ERJA 4BL0A 4CZXA 4ZOYA 5C9ZB 4OZUA 3VH0A 1B9XA 2AQ5A 3CIKB 2B5LA 2AGXA 3AFCA 3EWEA 5IJ7E 4FHLA 3P4FA 4L3GD 2HXCA 1OMWB 1XHMA 3KRWB 4GGDA 2P9KC 4CI8A 1NEXB 4OWRA 1FWXA 4CY1A 2P9UC 5IC7A 2G99A 5GMKn 5THAA 2G9AA 4J0XA 5AMSA 2P9LC 2QXVA 3N0DA 5AFU3 4X61B 3VGZA 3DSMA 4JSNC 4CI3A 1GOTB 2I3TA 5HE2B 3SBQA 1SQ9A 4K3ID 4X63B 3F3PA 1NR0A 4Y5RD 3C5MA 4O45A 3V9FA 2PM9A 4A2LA 4GQ1A 4CZVA 5K1CC 3PXTD 3ZWLB 4K3JB 3NVXA 3SMRA 4GZ8A 3I7LA 2AGWA 3GREA 3VA6A 2I3SA 3JROA 3IKOA 2H47A 4TZ4A 1S4UX 1Q47A 2H9NA 4O9DA 4FA9D 3OKYB 3GFCA 3EI1A 1MDAH 2PM9B 5I5JA 4ESGA 4FA1D 3SWSD 2AGYA 2MTAH 4UI9R 4FA4D 4GGCA 5FKRA 1N6EA 2P9NC 2YB8B 1MG3A 3UVMA 3DM0A 3MKSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IAA A;  2AH0 A;  4XEI C;  4BH6 A;  3E0C A;  2CN3 A;  4H5J A;  3BG0 A;  3MZK A;  4LG8 A;  2OIZ A;  2PBI B;  2OK6 A;  3ODT A;  4U1E I;  4XYH A;  1MG2 A;  3I7O A;  2W18 A;  3K27 A;  5C2W B;  2CO0 A;  4ERY A;  4FAV D;  2P9P C;  2IUV A;  4PSW B;  3DXK C;  4J78 A;  2J55 H;  3NVQ A;  4FWW A;  3UKR C;  5CYK A;  2CE9 A;  4O3U B;  5CXB B;  2XU7 A;  4CY5 A;  3SJL D;  3J80 g;  4N14 A;  4AOW A;  3UVN A;  3KRX B;  4GMB A;  5EAM A;  1GXR A;  5HE1 B;  2AH1 A;  2YBA A;  4H5I A;  2OK4 A;  3NVN A;  3DXM C;  3SBR A;  4XYI A;  3OKT A;  1B9Y A;  4JSX C;  5I5M A;  3EMH A;  2IUR A;  3A0F A;  4ZOV A;  3SFZ A;  3UVL A;  1R5M A;  2H6K A;  2YMU A;  2IUQ A;  4ERQ A;  5CYK B;  1K8K C;  4ERZ A;  2H13 A;  2O9K A;  1QNI A;  3CFS B;  4I79 A;  4GQB B;  4D6V A;  3OKW A;  4L3H D;  4GM8 A;  1VYH C;  3OL2 A;  4E54 B;  3V5W B;  1OLZ A;  3HFQ A;  4U7A A;  5EM2 A;  3N0E A;  3IJ1 A;  3UR4 A;  1A0R B;  4ZOZ A;  3RN1 D;  1XIP A;  4QT8 A;  2QC5 A;  3IIW A;  3RRM C;  4J79 A;  2HKR A;  4A0A B;  1U2V C;  2H9L A;  1N6F A;  3OKY A;  2GC4 A;  3EG6 A;  4O3T B;  4L9O A;  3OL2 B;  3SXT D;  3RN0 D;  5CXC A;  5EAP A;  5B4W A;  4L1Q D;  2OVR B;  3ULE C;  5EM2 B;  4PSX B;  1PEV A;  2I0T A;  2CE8 A;  2UZY B;  1U4C A;  3PVU B;  3I7N A;  4J77 A;  4A2M A;  4PBY A;  2YNN A;  3PXS D;  4Y7R A;  5JWZ A;  4CI1 A;  5FXY A;  1N6D A;  3UVK A;  4JXM A;  4CC9 A;  3EI4 A;  3C99 A;  4X3E A;  5CXC B;  5IT9 g;  4IMM A;  4CI2 A;  2BCJ B;  5GSA A;  4QRJ A;  1TBG A;  5H14 A;  2HJB A;  5A2Q g;  5I5I A;  5CXB A;  3I89 A;  5IJ8 E;  2PM6 B;  2OVQ B;  3IJ0 A;  5FKQ A;  3MKQ A;  2P9S C;  3PXW D;  5AJA A;  5TF2 A;  4JT5 C;  2HES X;  4A11 A;  3EI4 B;  4J0W A;  2UZX B;  3SVW D;  4A0B A;  5K19 A;  4FAN D;  5TDH B;  2H14 A;  2H9P A;  2H6Q A;  3F3F A;  2EBS A;  2Z2O A;  3EI3 A;  2H6N A;  2XL2 A;  5TEF A;  4E54 A;  5EML B;  2HKM A;  3RLM D;  1YFQ A;  2I0R A;  4J8G A;  2H68 A;  3PE7 A;  4LG9 A;  4A11 B;  4E5Z A;  2CO0 C;  2CNX A;  4FB1 D;  4ZOX A;  2P9I C;  5KDO B;  3FRX A;  4A0B B;  3ORV D;  4A7J A;  1JMZ B;  4ZN4 A;  3PSC B;  2H3X A;  2IWK A;  4O1Q D;  3UKU C;  2GC7 A;  3OTT A;  5GXI A;  5IGQ A;  5HE0 B;  2YNO A;  3U4Y A;  4A0A A;  4FA5 D;  3SN6 B;  2HYE A;  3J81 g;  4J73 A;  3V7D B;  3EI3 B;  4PXW A;  1JOF A;  2IWF A;  2OVP B;  3FM0 A;  5EMJ B;  3PVW B;  2Q7Q A;  3I7K A;  5TEE A;  4E5Z B;  4J84 A;  3SBP A;  2Z2P A;  4ES0 A;  4JT6 C;  1XKS A;  5IGO A;  3W15 A;  5FKT A;  3B7F A;  2J56 H;  3C75 H;  3EI2 A;  4GM9 A;  4X60 B;  2H9M A;  3L4M D;  5FKS A;  2HJ4 A;  5GXH A;  1GP2 B;  4GQ2 P;  3I7H A;  3F3G A;  5H17 A;  3I8E A;  1L0Q A;  3JRP A;  5C2V B;  3DWL C;  3MXX A;  4G56 B;  2B4E A;  3BG1 A;  3IJC A;  2XYI A;  4CY3 A;  5FA5 B;  1K32 A;  3JZH A;  3C9C A;  5H1M A;  2I0S A;  4AEZ A;  4BUJ C;  3EI2 B;  3FGB A;  4JSV C;  4QL1 A;  5HQG A;  3SHF A;  1TYQ C;  2AGZ A;  3JB9 L;  4NSX A;  3JZG A;  4R7A B;  3UVO A;  3L4O D;  2B5N A;  4J87 A;  4GM3 A;  1SHY B;  2AGL A;  4EWR A;  4MK0 B;  2Z2N A;  5EMM B;  3BWS A;  2TRC B;  4J81 A;  2B5M A;  5EMK B;  3CFV A;  4PNK B;  3IIY A;  2CN2 A;  3OW8 A;  4J82 A;  5EAL A;  3SLE D;  1PGU A;  5HE3 B;  2YNP A;  4A08 A;  4CY2 A;  4J8B A;  3RSE C;  4JSP C;  3AL8 A;  4KFM B;  4PBZ A;  3MZL A;  4A09 A;  4D0K A;  4LGN A;  3JAM g;  1JMX B;  4QQE A;  1P22 A;  5FQD A;  2OJY A;  3I2N A;  5SXM A;  4Z8L A;  2J57 G;  3SCY A;  3EU7 A;  3I7P A;  4CZY A;  3AH8 B;  1RI6 A;  2XL3 A;  4IA9 A;  3RFH A;  3JPX A;  3I8C A;  1PBY B;  5EAR A;  2PM7 B;  4A08 B;  1JJU B;  4GGA A;  2IUP A;  3MMY A;  1GG2 B;  4JD2 C;  3AL8 B;  3JZN A;  3RMZ D;  3EI1 B;  1PI6 A;  4A09 B;  4YVD A;  3K26 A;  4HDJ A;  5FLX g;  2BBK H;  5HYN B;  3RFG A;  2GNQ A;  1SQJ A;  4J86 A;  3PSL A;  4PC0 A;  3AL9 A;  1ERJ A;  4BL0 A;  4CZX A;  4ZOY A;  5C9Z B;  4OZU A;  3VH0 A;  1B9X A;  2AQ5 A;  3CIK B;  2B5L A;  2AGX A;  3AFC A;  3EWE A;  5IJ7 E;  4FHL A;  3P4F A;  4L3G D;  2HXC A;  1OMW B;  1XHM A;  3KRW B;  4GGD A;  2P9K C;  4CI8 A;  1NEX B;  4OWR A;  1FWX A;  4CY1 A;  2P9U C;  5IC7 A;  2G99 A;  5GMK n;  5THA A;  2G9A A;  4J0X A;  5AMS A;  2P9L C;  2QXV A;  3N0D A;  5AFU 3;  4X61 B;  3VGZ A;  3DSM A;  4JSN C;  4CI3 A;  1GOT B;  2I3T A;  5HE2 B;  3SBQ A;  1SQ9 A;  4K3I D;  4X63 B;  3F3P A;  1NR0 A;  4Y5R D;  3C5M A;  4O45 A;  3V9F A;  2PM9 A;  4A2L A;  4GQ1 A;  4CZV A;  5K1C C;  3PXT D;  3ZWL B;  4K3J B;  3NVX A;  3SMR A;  4GZ8 A;  3I7L A;  2AGW A;  3GRE A;  3VA6 A;  2I3S A;  3JRO A;  3IKO A;  2H47 A;  4TZ4 A;  1S4U X;  1Q47 A;  2H9N A;  4O9D A;  4FA9 D;  3OKY B;  3GFC A;  3EI1 A;  1MDA H;  2PM9 B;  5I5J A;  4ESG A;  4FA1 D;  3SWS D;  2AGY A;  2MTA H;  4UI9 R;  4FA4 D;  4GGC A;  5FKR A;  1N6E A;  2P9N C;  2YB8 B;  1MG3 A;  3UVM A;  3DM0 A;  3MKS B; 
#chains in the Genus database with same CATH topology
 2IAA A;  2AH0 A;  4XEI C;  4BH6 A;  4DNV A;  3E0C A;  2CN3 A;  4H5J A;  1GOF A;  3BG0 A;  3MZK A;  2QZP A;  2EID A;  3O4G A;  4LG8 A;  2OIZ A;  2PBI B;  4AMZ A;  2OK6 A;  3ODT A;  4U1E I;  2WQ8 A;  3NIG A;  4XYH A;  4RE6 A;  1MG2 A;  1UOP A;  2W18 A;  3I7O A;  3K27 A;  5C2W B;  2CO0 A;  4ERY A;  4FAV D;  2P9P C;  1T2X A;  2IUV A;  4PSW B;  3DXK C;  4J78 A;  1UOQ A;  2J55 H;  3K71 A;  3EQ7 A;  3NVQ A;  4FWW A;  3UKR C;  5CYK A;  4G1E A;  2CE9 A;  2VZ1 A;  4O3U B;  5CXB B;  2XU7 A;  4CY5 A;  3SJL D;  3J80 g;  4N14 A;  4AOW A;  3UVN A;  3KRX B;  4GMB A;  5EAM A;  1GXR A;  5HE1 B;  4MMX A;  4O2W A;  2VDP A;  2AH1 A;  2YBA A;  4H5I A;  2OK4 A;  3NVN A;  3DXM C;  3SBR A;  2HU8 A;  4XYI A;  4DNW A;  3OKT A;  4BP9 A;  1B9Y A;  4JSX C;  5I5M A;  4WK2 A;  3EMH A;  5M5R A;  2IUR A;  3A0F A;  4ZOV A;  3SFZ A;  3UVL A;  1R5M A;  2H6K A;  2YMU A;  2IUQ A;  4ERQ A;  5CYK B;  1K8K C;  4UM8 A;  1JTD B;  1K3I A;  2H13 A;  4ERZ A;  2O9K A;  1QNI A;  3CFS B;  4I79 A;  3MUN A;  4GQB B;  4D6V A;  3OKW A;  4L3H D;  5E6R A;  4AN0 A;  4GM8 A;  3ZDZ A;  1VYH C;  3OL2 A;  4E54 B;  3V5W B;  1OLZ A;  1UOO A;  3HFQ A;  4U7A A;  5EM2 A;  2VZ3 A;  3N0E A;  3IJ1 A;  3UR4 A;  1A0R B;  5HDB A;  4ZOZ A;  3RN1 D;  1XIP A;  4QT8 A;  2QC5 A;  3IIW A;  3RRM C;  4J79 A;  2HKR A;  4A0A B;  4BCD A;  1U2V C;  2H9L A;  1N6F A;  3OKY A;  2GC4 A;  3EG6 A;  4O3T B;  4BCC A;  4IRZ A;  4L9O A;  3OL2 B;  3SXT D;  3RN0 D;  5CXC A;  5EAP A;  5B4W A;  4L1Q D;  2OVR B;  1L5G A;  3ULE C;  5EM2 B;  3ZE0 A;  4PSX B;  3FCS A;  1PEV A;  2I0T A;  2CE8 A;  2UZY B;  1U4C A;  3PVU B;  3OF7 A;  2VDQ A;  3I7N A;  4J77 A;  2VDN A;  4A2M A;  4PBY A;  3FCU A;  2YNN A;  4MMY A;  3PXS D;  4Y7R A;  4AX4 A;  1H2W A;  5JWZ A;  4CI1 A;  5FXY A;  1N6D A;  3UVK A;  4JXM A;  2EIE A;  4CC9 A;  3EQ9 A;  3EI4 A;  3C99 A;  4X3E A;  5CXC B;  5IT9 g;  4IMM A;  1JV2 A;  4CI2 A;  2BCJ B;  5GSA A;  1QFS A;  4QRJ A;  1TBG A;  3O4I A;  5H14 A;  4AN1 A;  1U8C A;  2HJB A;  3VI4 A;  5A2Q g;  5I5I A;  3MUO A;  5CXB A;  3I89 A;  5IJ8 E;  1YR2 A;  5C92 A;  2PM6 B;  2OVQ B;  3IJ0 A;  3IUR A;  5FKQ A;  3MKQ A;  2P9S C;  5FFG A;  3PXW D;  5AJA A;  5TF2 A;  5E6U A;  4JT5 C;  2HES X;  4A11 A;  3EI4 B;  2JKX A;  4J0W A;  2UZX B;  3SVW D;  4A0B A;  5K19 A;  4FAN D;  5TDH B;  2H14 A;  2H9P A;  2H6Q A;  1H2Y A;  1GOH A;  3F3F A;  2EBS A;  4WK0 A;  4D9S A;  3EQ8 A;  2Z2O A;  3EI3 A;  2H6N A;  4Z7O A;  2XL2 A;  5TEF A;  4E54 A;  5EML B;  2HKM A;  3RLM D;  1YFQ A;  2I0R A;  4J8G A;  3MVD K;  2H68 A;  3PE7 A;  4LG9 A;  4A11 B;  4E5Z A;  2CNX A;  1I2M B;  2CO0 C;  3IUQ A;  4FB1 D;  4ZOX A;  2P9I C;  5KDO B;  3FRX A;  4A0B B;  5M61 A;  3ORV D;  4A7J A;  1JMZ B;  4ZN4 A;  3PSC B;  2H3X A;  3IUM A;  2IWK A;  4O1Q D;  4BCB A;  3UKU C;  2GC7 A;  3OTT A;  5GXI A;  5IGQ A;  5HE0 B;  2YNO A;  3U4Y A;  4A0A A;  2HU7 A;  4QAM A;  4FA5 D;  3SN6 B;  3ZDX A;  2HYE A;  3J81 g;  4J73 A;  3V7D B;  3EI3 B;  4PXW A;  4NAA A;  1JOF A;  2IWF A;  4JHP C;  2OVP B;  3FM0 A;  5EMJ B;  3QI0 A;  3PVW B;  2Q7Q A;  3I7K A;  5TEE A;  4E5Z B;  1C9L A;  4J84 A;  3SBP A;  2Z2P A;  4AMY A;  4ES0 A;  4JT6 C;  1XKS A;  5IGO A;  3W15 A;  5FKT A;  3B7F A;  2J56 H;  3C75 H;  4G55 A;  4L1M A;  3EI2 A;  4GM9 A;  4X60 B;  2H9M A;  3K6S A;  3L4M D;  5FKS A;  2VDK A;  2HJ4 A;  5GXH A;  1GP2 B;  2VDL A;  4GQ2 P;  3I7H A;  3F3G A;  5H17 A;  3I8E A;  1L0Q A;  3JRP A;  5C2V B;  3T3M A;  2XDW A;  4UM9 A;  5M5U A;  3DWL C;  3KCI A;  3MXX A;  4G56 B;  2B4E A;  3BG1 A;  3IJC A;  2XYI A;  4JHN A;  5FA5 B;  4CY3 A;  1K32 A;  3JZH A;  3C9C A;  3DDU A;  5H1M A;  2I0S A;  2EIB A;  4AEZ A;  4BUJ C;  3EI2 B;  3FGB A;  4JSV C;  4QL1 A;  5HQG A;  3SHF A;  3V4V A;  1TYQ C;  2AGZ A;  3JB9 L;  1QFM A;  4NSX A;  3JZG A;  4G1M A;  4R7A B;  3UVO A;  5M5T A;  3VI3 A;  3L4O D;  4DNU A;  3NIF A;  2B5N A;  4Z7N A;  4J87 A;  4GM3 A;  1SHY B;  5E6S A;  2AGL A;  4EWR A;  4MK0 B;  2Z2N A;  5EMM B;  3BWS A;  2TRC B;  3T3P A;  2BKL A;  4J81 A;  2B5M A;  2VDO A;  5EMK B;  3CFV A;  4PNK B;  3IIY A;  2CN2 A;  3OW8 A;  4J82 A;  5EAL A;  4NEN A;  3SLE D;  1PGU A;  5HE3 B;  2YNP A;  3NID A;  4CY2 A;  4A08 A;  4J8B A;  3RSE C;  4JSP C;  3AL8 A;  1VE6 A;  4KFM B;  4PBZ A;  3MZL A;  4A09 A;  4O02 A;  4D0K A;  4LGN A;  3JAM g;  1JMX B;  4QQE A;  1P22 A;  4NC4 A;  2QR5 A;  5FQD A;  4WK4 A;  2OJY A;  3I2N A;  5SXM A;  4Z8L A;  2J57 G;  4WJK A;  3SCY A;  3EU7 A;  3I7P A;  4CZY A;  3AH8 B;  1RI6 A;  2XL3 A;  3ZDY A;  4IA9 A;  3RFH A;  3JPX A;  3ZE1 A;  3I8C A;  1PBY B;  5EAR A;  2PM7 B;  4A08 B;  1JJU B;  4GGA A;  2IUP A;  3MMY A;  1GG2 B;  1O6G A;  4JD2 C;  1VZ3 A;  3AL8 B;  3JZN A;  3RMZ D;  3EI1 B;  2HU5 A;  1PI6 A;  1VE7 A;  1UTC A;  4A09 B;  3IUJ A;  4NBM A;  5M5S A;  2VC2 A;  3O4H A;  3K26 A;  4YVD A;  4HDJ A;  5FLX g;  2BBK H;  2VDR A;  3V4P A;  5HYN B;  3RFG A;  2GNQ A;  4RE5 A;  2XE4 A;  3K72 A;  1SQJ A;  1VZ2 A;  4J86 A;  3PSL A;  4PC0 A;  3AL9 A;  1ERJ A;  4BL0 A;  4CZX A;  4ZOY A;  3ZE2 A;  5C9Z B;  2VDM A;  4OZU A;  3VH0 A;  1C9I A;  3IUN A;  1B9X A;  2AQ5 A;  5FFO A;  3CIK B;  2B5L A;  2AGX A;  3AFC A;  3EWE A;  5IJ7 E;  4FHL A;  3P4F A;  4L3G D;  2HXC A;  1OMW B;  1XHM A;  1A12 A;  3KRW B;  4GGD A;  2P9K C;  1BPO A;  4CI8 A;  1NEX B;  4OWR A;  1E8N A;  1H2X A;  1FWX A;  4CY1 A;  2P9U C;  3IVM A;  5IC7 A;  2G99 A;  3IUL A;  5GMK n;  5THA A;  2G9A A;  4J0X A;  5AMS A;  2P9L C;  2QXV A;  3N0D A;  5C86 A;  5AFU 3;  3QHY B;  4X61 B;  3VGZ A;  3DSM A;  4JSN C;  4CI3 A;  1GOT B;  2I3T A;  3IJE A;  4MMZ A;  5HE2 B;  3SBQ A;  1SQ9 A;  4K3I D;  4BP8 A;  4X63 B;  3F3P A;  1NR0 A;  4Y5R D;  3C5M A;  5M5V A;  4O45 A;  3V9F A;  4Z7Q A;  2PM9 A;  4A2L A;  4GQ1 A;  4CZV A;  5K1C C;  3PXT D;  3ZWL B;  4K3J B;  3NVX A;  3SMR A;  4GZ8 A;  3I7L A;  2AGW A;  1M1X A;  3GRE A;  3VA6 A;  1H2Z A;  1GOG A;  2I3S A;  3JRO A;  3GC3 B;  1TYE A;  3IKO A;  2H47 A;  4TZ4 A;  1S4U X;  1Q47 A;  3O4J A;  2H9N A;  2XZG A;  4O9D A;  4FA9 D;  3OKY B;  1O6F A;  3GFC A;  3EI1 A;  1E8M A;  1MDA H;  2PM9 B;  2EIC A;  5I5J A;  4ESG A;  3SWS D;  4FA1 D;  2AGY A;  1E5T A;  2MTA H;  4UI9 R;  4FA4 D;  4GGC A;  5FKR A;  3GD1 I;  1N6E A;  2P9N C;  2YB8 B;  1MG3 A;  3UVM A;  3DM0 A;  3MKS B; 
#chains in the Genus database with same CATH homology
 2IAA A;  2AH0 A;  4XEI C;  4BH6 A;  3E0C A;  2CN3 A;  4H5J A;  3BG0 A;  3MZK A;  4LG8 A;  2OIZ A;  2PBI B;  2OK6 A;  3ODT A;  4U1E I;  4XYH A;  1MG2 A;  3I7O A;  2W18 A;  3K27 A;  5C2W B;  2CO0 A;  4ERY A;  4FAV D;  2P9P C;  2IUV A;  4PSW B;  3DXK C;  4J78 A;  2J55 H;  3NVQ A;  4FWW A;  3UKR C;  5CYK A;  2CE9 A;  4O3U B;  5CXB B;  2XU7 A;  4CY5 A;  3SJL D;  3J80 g;  4N14 A;  4AOW A;  3UVN A;  3KRX B;  4GMB A;  5EAM A;  1GXR A;  5HE1 B;  2AH1 A;  2YBA A;  4H5I A;  2OK4 A;  3NVN A;  3DXM C;  3SBR A;  4XYI A;  3OKT A;  1B9Y A;  4JSX C;  5I5M A;  3EMH A;  2IUR A;  3A0F A;  4ZOV A;  3SFZ A;  3UVL A;  1R5M A;  2H6K A;  2YMU A;  2IUQ A;  4ERQ A;  5CYK B;  1K8K C;  4ERZ A;  2H13 A;  2O9K A;  1QNI A;  3CFS B;  4I79 A;  4GQB B;  4D6V A;  3OKW A;  4L3H D;  4GM8 A;  1VYH C;  3OL2 A;  4E54 B;  3V5W B;  1OLZ A;  3HFQ A;  4U7A A;  5EM2 A;  3N0E A;  3IJ1 A;  3UR4 A;  1A0R B;  4ZOZ A;  3RN1 D;  1XIP A;  4QT8 A;  2QC5 A;  3IIW A;  3RRM C;  4J79 A;  2HKR A;  4A0A B;  1U2V C;  2H9L A;  1N6F A;  3OKY A;  2GC4 A;  3EG6 A;  4O3T B;  4L9O A;  3OL2 B;  3SXT D;  3RN0 D;  5CXC A;  5EAP A;  5B4W A;  4L1Q D;  2OVR B;  3ULE C;  5EM2 B;  4PSX B;  1PEV A;  2I0T A;  2CE8 A;  2UZY B;  1U4C A;  3PVU B;  3I7N A;  4J77 A;  4A2M A;  4PBY A;  2YNN A;  3PXS D;  4Y7R A;  5JWZ A;  4CI1 A;  5FXY A;  1N6D A;  3UVK A;  4JXM A;  4CC9 A;  3EI4 A;  3C99 A;  4X3E A;  5CXC B;  5IT9 g;  4IMM A;  4CI2 A;  2BCJ B;  5GSA A;  4QRJ A;  1TBG A;  5H14 A;  2HJB A;  5A2Q g;  5I5I A;  5CXB A;  3I89 A;  5IJ8 E;  2PM6 B;  2OVQ B;  3IJ0 A;  5FKQ A;  3MKQ A;  2P9S C;  3PXW D;  5AJA A;  5TF2 A;  4JT5 C;  2HES X;  4A11 A;  3EI4 B;  4J0W A;  2UZX B;  3SVW D;  4A0B A;  5K19 A;  4FAN D;  5TDH B;  2H14 A;  2H9P A;  2H6Q A;  3F3F A;  2EBS A;  2Z2O A;  3EI3 A;  2H6N A;  2XL2 A;  5TEF A;  4E54 A;  5EML B;  2HKM A;  3RLM D;  1YFQ A;  2I0R A;  4J8G A;  2H68 A;  3PE7 A;  4LG9 A;  4A11 B;  4E5Z A;  2CO0 C;  2CNX A;  4FB1 D;  4ZOX A;  2P9I C;  5KDO B;  3FRX A;  4A0B B;  3ORV D;  4A7J A;  1JMZ B;  4ZN4 A;  3PSC B;  2H3X A;  2IWK A;  4O1Q D;  3UKU C;  2GC7 A;  3OTT A;  5GXI A;  5IGQ A;  5HE0 B;  2YNO A;  3U4Y A;  4A0A A;  4FA5 D;  3SN6 B;  2HYE A;  3J81 g;  4J73 A;  3V7D B;  3EI3 B;  4PXW A;  1JOF A;  2IWF A;  2OVP B;  3FM0 A;  5EMJ B;  3PVW B;  2Q7Q A;  3I7K A;  5TEE A;  4E5Z B;  4J84 A;  3SBP A;  2Z2P A;  4ES0 A;  4JT6 C;  1XKS A;  5IGO A;  3W15 A;  5FKT A;  3B7F A;  2J56 H;  3C75 H;  3EI2 A;  4GM9 A;  4X60 B;  2H9M A;  3L4M D;  5FKS A;  2HJ4 A;  5GXH A;  1GP2 B;  4GQ2 P;  3I7H A;  3F3G A;  5H17 A;  3I8E A;  1L0Q A;  3JRP A;  5C2V B;  3DWL C;  3MXX A;  4G56 B;  2B4E A;  3BG1 A;  3IJC A;  2XYI A;  4CY3 A;  5FA5 B;  1K32 A;  3JZH A;  3C9C A;  5H1M A;  2I0S A;  4AEZ A;  4BUJ C;  3EI2 B;  3FGB A;  4JSV C;  4QL1 A;  5HQG A;  3SHF A;  1TYQ C;  2AGZ A;  3JB9 L;  4NSX A;  3JZG A;  4R7A B;  3UVO A;  3L4O D;  2B5N A;  4J87 A;  4GM3 A;  1SHY B;  2AGL A;  4EWR A;  4MK0 B;  2Z2N A;  5EMM B;  3BWS A;  2TRC B;  4J81 A;  2B5M A;  5EMK B;  3CFV A;  4PNK B;  3IIY A;  2CN2 A;  3OW8 A;  4J82 A;  5EAL A;  3SLE D;  1PGU A;  5HE3 B;  2YNP A;  4A08 A;  4CY2 A;  4J8B A;  3RSE C;  4JSP C;  3AL8 A;  4KFM B;  4PBZ A;  3MZL A;  4A09 A;  4D0K A;  4LGN A;  3JAM g;  1JMX B;  4QQE A;  1P22 A;  5FQD A;  2OJY A;  3I2N A;  5SXM A;  4Z8L A;  2J57 G;  3SCY A;  3EU7 A;  3I7P A;  4CZY A;  3AH8 B;  1RI6 A;  2XL3 A;  4IA9 A;  3RFH A;  3JPX A;  3I8C A;  1PBY B;  5EAR A;  2PM7 B;  4A08 B;  1JJU B;  4GGA A;  2IUP A;  3MMY A;  1GG2 B;  4JD2 C;  3AL8 B;  3JZN A;  3RMZ D;  3EI1 B;  1PI6 A;  4A09 B;  4YVD A;  3K26 A;  4HDJ A;  5FLX g;  2BBK H;  5HYN B;  3RFG A;  2GNQ A;  1SQJ A;  4J86 A;  3PSL A;  4PC0 A;  3AL9 A;  1ERJ A;  4BL0 A;  4CZX A;  4ZOY A;  5C9Z B;  4OZU A;  3VH0 A;  1B9X A;  2AQ5 A;  3CIK B;  2B5L A;  2AGX A;  3AFC A;  3EWE A;  5IJ7 E;  4FHL A;  3P4F A;  4L3G D;  2HXC A;  1OMW B;  1XHM A;  3KRW B;  4GGD A;  2P9K C;  4CI8 A;  1NEX B;  4OWR A;  1FWX A;  4CY1 A;  2P9U C;  5IC7 A;  2G99 A;  5GMK n;  5THA A;  2G9A A;  4J0X A;  5AMS A;  2P9L C;  2QXV A;  3N0D A;  5AFU 3;  4X61 B;  3VGZ A;  3DSM A;  4JSN C;  4CI3 A;  1GOT B;  2I3T A;  5HE2 B;  3SBQ A;  1SQ9 A;  4K3I D;  4X63 B;  3F3P A;  1NR0 A;  4Y5R D;  3C5M A;  4O45 A;  3V9F A;  2PM9 A;  4A2L A;  4GQ1 A;  4CZV A;  5K1C C;  3PXT D;  3ZWL B;  4K3J B;  3NVX A;  3SMR A;  4GZ8 A;  3I7L A;  2AGW A;  3GRE A;  3VA6 A;  2I3S A;  3JRO A;  3IKO A;  2H47 A;  4TZ4 A;  1S4U X;  1Q47 A;  2H9N A;  4O9D A;  4FA9 D;  3OKY B;  3GFC A;  3EI1 A;  1MDA H;  2PM9 B;  5I5J A;  4ESG A;  4FA1 D;  3SWS D;  2AGY A;  2MTA H;  4UI9 R;  4FA4 D;  4GGC A;  5FKR A;  1N6E A;  2P9N C;  2YB8 B;  1MG3 A;  3UVM A;  3DM0 A;  3MKS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...