2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
b'QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
3RFHA 3RN1D 4R7AB 2H13A 2G9AA 4ZOVA 4BUJC 4JSXC 4A0AA 1K32A 1GG2B 4JT6C 3L4MD 4FAVD 4JSVC 3JROA 4ES0A 4J0WA 3JZNA 3RSEC 3K26A 1MG3A 5EMLB 4FA4D 4J81A 3UKUC 3IJCA 3ZWLB 5EMJB 2CNXA 2HJBA 4L9OA 3NVXA 1B9YA 4X3EA 4BL0A 5A2Qg 2I3SA 4GM9A 2AH1A 4ZOZA 2P9UC 3GFCA 1R5MA 2J56H 3PSCB 5EARA 1L0QA 2UZXB 2QC5A 2XYIA 4J78A 3JB9L 2CE9A 4X63B 4J0XA 4CZVA 2P9KC 2HKRA 4TZ4A 5GXIA 4CY5A 2I0RA 5K1CC 2BBKH 5TDHB 4H5JA 3BWSA 3SLED 3I7PA 3PVWB 3ODTA 4OWRA 4J8BA 3SBQA 4FAND 4X60B 4GM8A 4FWWA 2J57G 4J86A 4UI9R 3DWLC 1NEXB 1YFQA 1N6DA 4FA9D 2H6KA 2QXVA 2MTAH 3C99A 3F3PA 2OIZA 3CIKB 4D0KA 2CN2A 2UZYB 3UVOA 4Y7RA 3JPXA 3EI1B 3MMYA 4MK0B 2PM7B 4JD2C 2XU7A 3UVLA 4CZYA 5IC7A 4CZXA 4QRJA 4FA1D 2IUQA 1PGUA 5HE3B 2H9LA 3UVMA 4XYHA 1MG2A 2Q7QA 3EI2B 1PI6A 4GGCA 4J73A 5AMSA 2BCJB 1QNIA 2OJYA 3I7HA 3SXTD 3EI2A 5TEFA 4FHLA 4A0BB 4PBZA 4GM3A 2H6QA 2XL3A 5FKQA 1Q47A 3SHFA 4ZOYA 4I79A 4GQ1A 4A2LA 1OLZA 4LG8A 1PEVA 2XL2A 4JT5C 4O3UB 4PSXB 3A0FA 3AH8B 3W15A 2P9NC 3EWEA 5FKRA 2HJ4A 5TF2A 4XEIC 5EMMB 4A0AB 3RLMD 2G99A 4ESGA 3KRXB 1XIPA 3GREA 2B4EA 5H17A 4GZ8A 2IUPA 4HDJA 2YBAA 2P9PC 2H6NA 2P9IC 4JSNC 2I0TA 3OL2B 4H5IA 4FA5D 4J82A 3UKRC 3JAMg 4L1QD 3IJ0A 1JJUB 4PBYA 3MZKA 3OL2A 5FKSA 5KDOB 4BH6A 4CI2A 3BG0A 4GQBB 2H9MA 5FKTA 2HYEA 5I5JA 2AGWA 1P22A 3I8EA 3U4YA 4PSWB 5GXHA 3SCYA 5IT9g 5K19A 4Z8LA 4ERQA 2AGLA 2Z2NA 4L3HD 5H14A 2YNPA 5FLXg 4D6VA 2PM6B 4EWRA 3CFVA 2YB8B 5IGOA 3SFZA 3MXXA 3JZHA 2EBSA 5GMKn 3NVQA 4CC9A 4QL1A 4J84A 4GGDA 2B5NA 2CO0C 3UVKA 2O9KA 1FWXA 1TYQC 1RI6A 1XHMA 3AL9A 3I7KA 2YNNA 3NVNA 4PC0A 5EAPA 3RRMC 3C75H 4IMMA 2GNQA 2IAAA 2CE8A 3ULEC 3VH0A 3RMZD 3FGBA 5C2WB 3VA6A 4O45A 4IA9A 3I7NA 3DSMA 1NR0A 2H68A 2OK6A 4Y5RD 5EM2A 3PE7A 2OVPB 3EMHA 1SHYB 3I8CA 3OTTA 4L3GD 3MKSB 5H1MA 4ZOXA 5IGQA 5HE1B 4J8GA 3OKTA 2H3XA 5CXBB 5HQGA 3SBPA 2B5MA 4J87A 3RFGA 4A09B 1K8KC 4N14A 3N0DA 3N0EA 4GGAA 5CXBA 2YNOA 2H47A 5C9ZB 1OMWB 4A09A 3IIWA 2J55H 2HXCA 3JZGA 3DXKC 3SVWD 1GP2B 1SQJA 3C5MA 3V9FA 4ERYA 2Z2PA 3V7DB 2CO0A 3UVNA 3DM0A 2YMUA 3FRXA 5FQDA 4J77A 3PSLA 1A0RB 3E0CA 1SQ9A 4GMBA 4CY1A 2H9PA 3RN0D 5C2VB 4U7AA 5EMKB 3PXTD 2AGZA 4A7JA 3EI4B 4CI8A 4NSXA 2I3TA 2TRCB 3ORVD 3I7LA 3KRWB 5AJAA 1GOTB 2IWFA 4CY3A 4O1QD 3EI4A 2I0SA 4YVDA 2IWKA 3P4FA 2PM9B 5IJ8E 3K27A 5B4WA 1XKSA 4JXMA 3FM0A 4LG9A 2OK4A 4A08B 1N6FA 2PM9A 3EI3B 3SJLD 4E54B 3AL8B 3SBRA 3OW8A 1GXRA 4K3JB 4A11B 4A08A 4LGNA 5JWZA 5I5IA 3IKOA 4ERZA 3EI3A 4E54A 2W18A 3AL8A 5AFU3 3EU7A 3J80g 3L4OD 2OVQB 4A11A 2Z2OA 4CY2A 4A2MA 1JMZB 2AGYA 3DXMC 4QQEA 3SN6B 3AFCA 5FXYA 1MDAH 4PXWA 2B5LA 5THAA 4AOWA 4XYIA 1TBGA 5IJ7E 5FA5B 3V5WB 2AH0A 5I5MA 1B9XA 1N6EA 4QT8A 1S4UX 2H9NA 1JOFA 2HESX 1JMXB 3PVUB 2AQ5A 2P9SC 5EM2B 3B7FA 3HFQA 4PNKB 4O3TB 4U1EI 4AEZA 3BG1A 3F3FA 3J81g 3F3GA 4ZN4A 3EG6A 2GC4A 5SXMA 2IURA 3C9CA 4GQ2P 5HE2B 3MKQA 3SWSD 3IIYA 3VGZA 1U4CA 5EALA 5EAMA 3PXSD 3SMRA 3IJ1A 1PBYB 3EI1A 1U2VC 4O9DA 5HE0B 3OKYB 4KFMB 1ERJA 4FB1D 3PXWD 5GSAA 3UR4A 2IUVA 3OKYA 3I7OA 2H14A 4G56B 5TEEA 2OVRB 4E5ZB 3OKWA 3I89A 3I2NA 5CXCB 4OZUA 4JSPC 2CN3A 4E5ZA 2P9LC 2HKMA 5CYKB 3MZLA 4J79A 5CXCA 5HYNB 4A0BA 4CI1A 2PBIB 4K3ID 4CI3A 2AGXA 4X61B 1VYHC 3CFSB 5CYKA 3JRPA 2GC7A
chains in the Genus database with same CATH superfamily
3RFHA 3RN1D 4R7AB 1C9IA 2H13A 1UTCA 5M5VA 5C86A 2G9AA 4ZOVA 4BUJC 4JSXC 4A0AA 3KCIA 1K32A 1GG2B 4JT6C 3L4MD 4FAVD 4JSVC 3JROA 4ES0A 4J0WA 3JZNA 3RSEC 3K26A 1MG3A 5EMLB 5C92A 5FFOA 4FA4D 4J81A 4WJKA 3UKUC 3IJCA 2VDQA 1GOHA 3ZWLB 1JTDB 2HU8A 5EMJB 2CNXA 2HJBA 4L9OA 3NVXA 1B9YA 4X3EA 4BL0A 5A2Qg 2I3SA 2QZPA 4GM9A 5HDBA 2AH1A 3O4HA 4ZOZA 2P9UC 3GFCA 1R5MA 2J56H 3PSCB 1JV2A 5EARA 4BP9A 1L0QA 2UZXB 2QC5A 2XYIA 4J78A 3JB9L 2CE9A 4X63B 4J0XA 4CZVA 2P9KC 2HKRA 4TZ4A 5GXIA 4CY5A 2I0RA 5K1CC 3K6SA 5E6UA 2BBKH 3NIFA 5TDHB 4H5JA 3BWSA 3SLED 3I7PA 2VDLA 3PVWB 3MVDK 1I2MB 3ODTA 4OWRA 4J8BA 1H2ZA 3SBQA 4BCBA 4FAND 4X60B 4GM8A 4FWWA 2J57G 4J86A 5FFGA 4UI9R 4O2WA 3DWLC 1NEXB 3T3MA 1N6DA 1YFQA 4FA9D 2H6KA 2QXVA 2MTAH 3C99A 3F3PA 2OIZA 3CIKB 4D0KA 2CN2A 3O4JA 2UZYB 3UVOA 4Y7RA 3JPXA 3EI1B 4IRZA 3MMYA 4MK0B 2PM7B 4JD2C 2XU7A 3UVLA 4CZYA 5IC7A 4CZXA 3OF7A 4QRJA 4FA1D 2IUQA 1PGUA 5HE3B 2H9LA 3UVMA 4XYHA 1MG2A 2EIBA 4BP8A 2Q7QA 3EI2B 1PI6A 4GGCA 1UOOA 4J73A 3FCUA 3ZDXA 5AMSA 2BCJB 1QNIA 2OJYA 2BKLA 3I7HA 3SXTD 3EI2A 5TEFA 4FHLA 4A0BB 4PBZA 4GM3A 2H6QA 2XL3A 4G55A 5FKQA 1Q47A 3SHFA 4ZOYA 4I79A 4AN0A 4GQ1A 4A2LA 5M5TA 1OLZA 4LG8A 1PEVA 2XL2A 4JT5C 4O3UB 4PSXB 3A0FA 3AH8B 3O4IA 3W15A 4DNUA 2P9NC 3EWEA 5FKRA 2HJ4A 5TF2A 1VE6A 4XEIC 3GD1I 5EMMB 4A0AB 3RLMD 2G99A 4ESGA 3KRXB 1XIPA 2VDMA 2B4EA 3GREA 4AMZA 5H17A 1E8NA 4GZ8A 2IUPA 3ZE0A 4HDJA 2YBAA 2EICA 4NAAA 3EQ7A 3NIDA 2P9PC 2H6NA 3VI3A 2P9IC 4JSNC 1GOFA 4JHNA 4O02A 2I0TA 3OL2B 4H5IA 4FA5D 4J82A 3UKRC 3JAMg 4L1QD 3IJ0A 1JJUB 4PBYA 3MZKA 3OL2A 5FKSA 2VDKA 1O6GA 5KDOB 3IUNA 4BH6A 2VDRA 4CI2A 2VDNA 3V4VA 3BG0A 4GQBB 2H9MA 5FKTA 2HYEA 5I5JA 2AGWA 1P22A 3I8EA 3U4YA 4PSWB 5GXHA 3IUJA 3SCYA 1QFMA 5IT9g 1QFSA 3T3PA 5K19A 4Z8LA 4ERQA 4BCDA 2AGLA 2Z2NA 4WK4A 4G1EA 4L3HD 5H14A 2YNPA 5FLXg 4D6VA 2PM6B 5E6RA 4EWRA 3CFVA 1UOQA 2YB8B 5IGOA 1E5TA 3SFZA 3GC3B 1UOPA 3MXXA 3JZHA 2EBSA 4DNVA 4BCCA 5GMKn 1GOGA 3NVQA 4CC9A 4QL1A 4J84A 4GGDA 2XDWA 2B5NA 2CO0C 3UVKA 1U8CA 2O9KA 3IUMA 1FWXA 1TYQC 4AN1A 1RI6A 1XHMA 3ZE1A 3AL9A 3I7KA 2YNNA 3NVNA 4PC0A 5EAPA 3RRMC 3C75H 4IMMA 2GNQA 2IAAA 4WK2A 4NBMA 2CE8A 3ULEC 3VH0A 3RMZD 3FGBA 5C2WB 3VA6A 4O45A 4IA9A 3VI4A 3I7NA 2VZ1A 4RE5A 3FCSA 3DSMA 1NR0A 2H68A 3ZDZA 2OK6A 4Y5RD 5EM2A 3PE7A 2OVPB 2QR5A 3EMHA 1SHYB 4UM9A 3I8CA 3OTTA 4L3GD 3MKSB 4RE6A 5M5UA 5H1MA 1H2XA 4ZOXA 5IGQA 5HE1B 4J8GA 3OKTA 2H3XA 5E6SA 5CXBB 4Z7QA 5HQGA 3SBPA 2B5MA 4J87A 3RFGA 4A09B 1K8KC 4N14A 3N0DA 3N0EA 4MMYA 4GGAA 5CXBA 2YNOA 2H47A 5C9ZB 1OMWB 4A09A 3IIWA 2J55H 1H2WA 1BPOA 3IURA 1L5GA 3JZGA 2HXCA 3DXKC 4UM8A 3SVWD 5M5SA 1GP2B 1SQJA 3IVMA 3C5MA 3V9FA 4ERYA 1O6FA 2Z2PA 3EQ8A 2CO0A 3V7DB 1TYEA 3UVNA 3DM0A 4NENA 5M5RA 1VZ2A 2YMUA 1VE7A 2XE4A 3FRXA 5FQDA 1T2XA 2HU5A 4J77A 3PSLA 3ZE2A 1A0RB 3E0CA 1SQ9A 4GMBA 2EIDA 4CY1A 3MUOA 2H9PA 3RN0D 5C2VB 1M1XA 4U7AA 5EMKB 3PXTD 2AGZA 4A7JA 3EI4B 4CI8A 4NSXA 2I3TA 2TRCB 3ORVD 3K72A 3I7LA 3KRWB 3K71A 5AJAA 3V4PA 1GOTB 2IWFA 3MUNA 4CY3A 3IUQA 3QI0A 3EI4A 4O1QD 4JHPC 2I0SA 4YVDA 1C9LA 2IWKA 3P4FA 2PM9B 5IJ8E 3K27A 5B4WA 1A12A 1XKSA 3FM0A 4JXMA 4G1MA 4LG9A 2OK4A 3DDUA 4A08B 3IULA 1E8MA 1N6FA 2PM9A 3EI3B 3SJLD 4E54B 1H2YA 3AL8B 3SBRA 4AX4A 3OW8A 1GXRA 4K3JB 4A11B 4A08A 4LGNA 2XZGA 5I5IA 5JWZA 3IKOA 4ERZA 4MMZA 3EI3A 4E54A 2W18A 3AL8A 5AFU3 3EU7A 4AMYA 3J80g 3L4OD 2OVQB 4A11A 2Z2OA 4CY2A 4A2MA 1JMZB 2AGYA 3DXMC 3EQ9A 4QQEA 3O4GA 3SN6B 3AFCA 5M61A 5FXYA 1K3IA 1MDAH 4PXWA 2B5LA 5THAA 4AOWA 4XYIA 1TBGA 5IJ7E 3ZDYA 5FA5B 3V5WB 2AH0A 5I5MA 1B9XA 1N6EA 1YR2A 4QT8A 1S4UX 2H9NA 1JOFA 2HESX 1JMXB 3PVUB 2AQ5A 2P9SC 3IJEA 5EM2B 3B7FA 3HFQA 4PNKB 4O3TB 4Z7NA 4U1EI 4AEZA 3BG1A 3F3FA 3J81g 3F3GA 4ZN4A 3EG6A 2GC4A 5SXMA 2IURA 3C9CA 4GQ2P 5HE2B 3MKQA 4DNWA 3SWSD 3IIYA 3VGZA 1U4CA 5EALA 2HU7A 5EAMA 3PXSD 3SMRA 3IJ1A 2WQ8A 1PBYB 3EI1A 1U2VC 4O9DA 5HE0B 3OKYB 4KFMB 1ERJA 2VDPA 4FB1D 1VZ3A 4D9SA 3PXWD 5GSAA 3QHYB 3UR4A 4L1MA 2IUVA 3OKYA 3I7OA 2H14A 4G56B 5TEEA 2OVRB 4MMXA 4E5ZB 3OKWA 4WK0A 3I89A 3NIGA 3I2NA 5CXCB 4OZUA 4Z7OA 2VC2A 2EIEA 4JSPC 2CN3A 4NC4A 4E5ZA 2P9LC 2HKMA 5CYKB 3MZLA 2VZ3A 4J79A 5CXCA 5HYNB 4QAMA 4A0BA 2JKXA 2PBIB 4K3ID 4CI1A 4CI3A 2AGXA 4X61B 1VYHC 3CFSB 5CYKA 3JRPA 2VDOA 2GC7A
chains in the Genus database with same CATH topology
3RFHA 3RN1D 4R7AB 2H13A 2G9AA 4ZOVA 4BUJC 4JSXC 4A0AA 1K32A 1GG2B 4JT6C 3L4MD 4FAVD 4JSVC 3JROA 4ES0A 4J0WA 3JZNA 3RSEC 3K26A 1MG3A 5EMLB 4FA4D 4J81A 3UKUC 3IJCA 3ZWLB 5EMJB 2CNXA 2HJBA 4L9OA 3NVXA 1B9YA 4X3EA 4BL0A 5A2Qg 2I3SA 4GM9A 2AH1A 4ZOZA 2P9UC 3GFCA 1R5MA 2J56H 3PSCB 5EARA 1L0QA 2UZXB 2QC5A 2XYIA 4J78A 3JB9L 2CE9A 4X63B 4J0XA 4CZVA 2P9KC 2HKRA 4TZ4A 5GXIA 4CY5A 2I0RA 5K1CC 2BBKH 5TDHB 4H5JA 3BWSA 3SLED 3I7PA 3PVWB 3ODTA 4OWRA 4J8BA 3SBQA 4FAND 4X60B 4GM8A 4FWWA 2J57G 4J86A 4UI9R 3DWLC 1NEXB 1YFQA 1N6DA 4FA9D 2H6KA 2QXVA 2MTAH 3C99A 3F3PA 2OIZA 3CIKB 4D0KA 2CN2A 2UZYB 3UVOA 4Y7RA 3JPXA 3EI1B 3MMYA 4MK0B 2PM7B 4JD2C 2XU7A 3UVLA 4CZYA 5IC7A 4CZXA 4QRJA 4FA1D 2IUQA 1PGUA 5HE3B 2H9LA 3UVMA 4XYHA 1MG2A 2Q7QA 3EI2B 1PI6A 4GGCA 4J73A 5AMSA 2BCJB 1QNIA 2OJYA 3I7HA 3SXTD 3EI2A 5TEFA 4FHLA 4A0BB 4PBZA 4GM3A 2H6QA 2XL3A 5FKQA 1Q47A 3SHFA 4ZOYA 4I79A 4GQ1A 4A2LA 1OLZA 4LG8A 1PEVA 2XL2A 4JT5C 4O3UB 4PSXB 3A0FA 3AH8B 3W15A 2P9NC 3EWEA 5FKRA 2HJ4A 5TF2A 4XEIC 5EMMB 4A0AB 3RLMD 2G99A 4ESGA 3KRXB 1XIPA 3GREA 2B4EA 5H17A 4GZ8A 2IUPA 4HDJA 2YBAA 2P9PC 2H6NA 2P9IC 4JSNC 2I0TA 3OL2B 4H5IA 4FA5D 4J82A 3UKRC 3JAMg 4L1QD 3IJ0A 1JJUB 4PBYA 3MZKA 3OL2A 5FKSA 5KDOB 4BH6A 4CI2A 3BG0A 4GQBB 2H9MA 5FKTA 2HYEA 5I5JA 2AGWA 1P22A 3I8EA 3U4YA 4PSWB 5GXHA 3SCYA 5IT9g 5K19A 4Z8LA 4ERQA 2AGLA 2Z2NA 4L3HD 5H14A 2YNPA 5FLXg 4D6VA 2PM6B 4EWRA 3CFVA 2YB8B 5IGOA 3SFZA 3MXXA 3JZHA 2EBSA 5GMKn 3NVQA 4CC9A 4QL1A 4J84A 4GGDA 2B5NA 2CO0C 3UVKA 2O9KA 1FWXA 1TYQC 1RI6A 1XHMA 3AL9A 3I7KA 2YNNA 3NVNA 4PC0A 5EAPA 3RRMC 3C75H 4IMMA 2GNQA 2IAAA 2CE8A 3ULEC 3VH0A 3RMZD 3FGBA 5C2WB 3VA6A 4O45A 4IA9A 3I7NA 3DSMA 1NR0A 2H68A 2OK6A 4Y5RD 5EM2A 3PE7A 2OVPB 3EMHA 1SHYB 3I8CA 3OTTA 4L3GD 3MKSB 5H1MA 4ZOXA 5IGQA 5HE1B 4J8GA 3OKTA 2H3XA 5CXBB 5HQGA 3SBPA 2B5MA 4J87A 3RFGA 4A09B 1K8KC 4N14A 3N0DA 3N0EA 4GGAA 5CXBA 2YNOA 2H47A 5C9ZB 1OMWB 4A09A 3IIWA 2J55H 2HXCA 3JZGA 3DXKC 3SVWD 1GP2B 1SQJA 3C5MA 3V9FA 4ERYA 2Z2PA 3V7DB 2CO0A 3UVNA 3DM0A 2YMUA 3FRXA 5FQDA 4J77A 3PSLA 1A0RB 3E0CA 1SQ9A 4GMBA 4CY1A 2H9PA 3RN0D 5C2VB 4U7AA 5EMKB 3PXTD 2AGZA 4A7JA 3EI4B 4CI8A 4NSXA 2I3TA 2TRCB 3ORVD 3I7LA 3KRWB 5AJAA 1GOTB 2IWFA 4CY3A 4O1QD 3EI4A 2I0SA 4YVDA 2IWKA 3P4FA 2PM9B 5IJ8E 3K27A 5B4WA 1XKSA 4JXMA 3FM0A 4LG9A 2OK4A 4A08B 1N6FA 2PM9A 3EI3B 3SJLD 4E54B 3AL8B 3SBRA 3OW8A 1GXRA 4K3JB 4A11B 4A08A 4LGNA 5JWZA 5I5IA 3IKOA 4ERZA 3EI3A 4E54A 2W18A 3AL8A 5AFU3 3EU7A 3J80g 3L4OD 2OVQB 4A11A 2Z2OA 4CY2A 4A2MA 1JMZB 2AGYA 3DXMC 4QQEA 3SN6B 3AFCA 5FXYA 1MDAH 4PXWA 2B5LA 5THAA 4AOWA 4XYIA 1TBGA 5IJ7E 5FA5B 3V5WB 2AH0A 5I5MA 1B9XA 1N6EA 4QT8A 1S4UX 2H9NA 1JOFA 2HESX 1JMXB 3PVUB 2AQ5A 2P9SC 5EM2B 3B7FA 3HFQA 4PNKB 4O3TB 4U1EI 4AEZA 3BG1A 3F3FA 3J81g 3F3GA 4ZN4A 3EG6A 2GC4A 5SXMA 2IURA 3C9CA 4GQ2P 5HE2B 3MKQA 3SWSD 3IIYA 3VGZA 1U4CA 5EALA 5EAMA 3PXSD 3SMRA 3IJ1A 1PBYB 3EI1A 1U2VC 4O9DA 5HE0B 3OKYB 4KFMB 1ERJA 4FB1D 3PXWD 5GSAA 3UR4A 2IUVA 3OKYA 3I7OA 2H14A 4G56B 5TEEA 2OVRB 4E5ZB 3OKWA 3I89A 3I2NA 5CXCB 4OZUA 4JSPC 2CN3A 4E5ZA 2P9LC 2HKMA 5CYKB 3MZLA 4J79A 5CXCA 5HYNB 4A0BA 4CI1A 2PBIB 4K3ID 4CI3A 2AGXA 4X61B 1VYHC 3CFSB 5CYKA 3JRPA 2GC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFH A;  3RN1 D;  4R7A B;  2H13 A;  2G9A A;  4ZOV A;  4BUJ C;  4JSX C;  4A0A A;  1K32 A;  1GG2 B;  4JT6 C;  3L4M D;  4FAV D;  4JSV C;  3JRO A;  4ES0 A;  4J0W A;  3JZN A;  3RSE C;  3K26 A;  1MG3 A;  5EML B;  4FA4 D;  4J81 A;  3UKU C;  3IJC A;  3ZWL B;  5EMJ B;  2CNX A;  2HJB A;  4L9O A;  3NVX A;  1B9Y A;  4X3E A;  4BL0 A;  5A2Q g;  2I3S A;  4GM9 A;  2AH1 A;  4ZOZ A;  2P9U C;  3GFC A;  1R5M A;  2J56 H;  3PSC B;  5EAR A;  1L0Q A;  2UZX B;  2QC5 A;  2XYI A;  4J78 A;  3JB9 L;  2CE9 A;  4X63 B;  4J0X A;  4CZV A;  2P9K C;  2HKR A;  4TZ4 A;  5GXI A;  4CY5 A;  2I0R A;  5K1C C;  2BBK H;  5TDH B;  4H5J A;  3BWS A;  3SLE D;  3I7P A;  3PVW B;  3ODT A;  4OWR A;  4J8B A;  3SBQ A;  4FAN D;  4X60 B;  4GM8 A;  4FWW A;  2J57 G;  4J86 A;  4UI9 R;  3DWL C;  1NEX B;  1YFQ A;  1N6D A;  4FA9 D;  2H6K A;  2QXV A;  2MTA H;  3C99 A;  3F3P A;  2OIZ A;  3CIK B;  4D0K A;  2CN2 A;  2UZY B;  3UVO A;  4Y7R A;  3JPX A;  3EI1 B;  3MMY A;  4MK0 B;  2PM7 B;  4JD2 C;  2XU7 A;  3UVL A;  4CZY A;  5IC7 A;  4CZX A;  4QRJ A;  4FA1 D;  2IUQ A;  1PGU A;  5HE3 B;  2H9L A;  3UVM A;  4XYH A;  1MG2 A;  2Q7Q A;  3EI2 B;  1PI6 A;  4GGC A;  4J73 A;  5AMS A;  2BCJ B;  1QNI A;  2OJY A;  3I7H A;  3SXT D;  3EI2 A;  5TEF A;  4FHL A;  4A0B B;  4PBZ A;  4GM3 A;  2H6Q A;  2XL3 A;  5FKQ A;  1Q47 A;  3SHF A;  4ZOY A;  4I79 A;  4GQ1 A;  4A2L A;  1OLZ A;  4LG8 A;  1PEV A;  2XL2 A;  4JT5 C;  4O3U B;  4PSX B;  3A0F A;  3AH8 B;  3W15 A;  2P9N C;  3EWE A;  5FKR A;  2HJ4 A;  5TF2 A;  4XEI C;  5EMM B;  4A0A B;  3RLM D;  2G99 A;  4ESG A;  3KRX B;  1XIP A;  3GRE A;  2B4E A;  5H17 A;  4GZ8 A;  2IUP A;  4HDJ A;  2YBA A;  2P9P C;  2H6N A;  2P9I C;  4JSN C;  2I0T A;  3OL2 B;  4H5I A;  4FA5 D;  4J82 A;  3UKR C;  3JAM g;  4L1Q D;  3IJ0 A;  1JJU B;  4PBY A;  3MZK A;  3OL2 A;  5FKS A;  5KDO B;  4BH6 A;  4CI2 A;  3BG0 A;  4GQB B;  2H9M A;  5FKT A;  2HYE A;  5I5J A;  2AGW A;  1P22 A;  3I8E A;  3U4Y A;  4PSW B;  5GXH A;  3SCY A;  5IT9 g;  5K19 A;  4Z8L A;  4ERQ A;  2AGL A;  2Z2N A;  4L3H D;  5H14 A;  2YNP A;  5FLX g;  4D6V A;  2PM6 B;  4EWR A;  3CFV A;  2YB8 B;  5IGO A;  3SFZ A;  3MXX A;  3JZH A;  2EBS A;  5GMK n;  3NVQ A;  4CC9 A;  4QL1 A;  4J84 A;  4GGD A;  2B5N A;  2CO0 C;  3UVK A;  2O9K A;  1FWX A;  1TYQ C;  1RI6 A;  1XHM A;  3AL9 A;  3I7K A;  2YNN A;  3NVN A;  4PC0 A;  5EAP A;  3RRM C;  3C75 H;  4IMM A;  2GNQ A;  2IAA A;  2CE8 A;  3ULE C;  3VH0 A;  3RMZ D;  3FGB A;  5C2W B;  3VA6 A;  4O45 A;  4IA9 A;  3I7N A;  3DSM A;  1NR0 A;  2H68 A;  2OK6 A;  4Y5R D;  5EM2 A;  3PE7 A;  2OVP B;  3EMH A;  1SHY B;  3I8C A;  3OTT A;  4L3G D;  3MKS B;  5H1M A;  4ZOX A;  5IGQ A;  5HE1 B;  4J8G A;  3OKT A;  2H3X A;  5CXB B;  5HQG A;  3SBP A;  2B5M A;  4J87 A;  3RFG A;  4A09 B;  1K8K C;  4N14 A;  3N0D A;  3N0E A;  4GGA A;  5CXB A;  2YNO A;  2H47 A;  5C9Z B;  1OMW B;  4A09 A;  3IIW A;  2J55 H;  2HXC A;  3JZG A;  3DXK C;  3SVW D;  1GP2 B;  1SQJ A;  3C5M A;  3V9F A;  4ERY A;  2Z2P A;  3V7D B;  2CO0 A;  3UVN A;  3DM0 A;  2YMU A;  3FRX A;  5FQD A;  4J77 A;  3PSL A;  1A0R B;  3E0C A;  1SQ9 A;  4GMB A;  4CY1 A;  2H9P A;  3RN0 D;  5C2V B;  4U7A A;  5EMK B;  3PXT D;  2AGZ A;  4A7J A;  3EI4 B;  4CI8 A;  4NSX A;  2I3T A;  2TRC B;  3ORV D;  3I7L A;  3KRW B;  5AJA A;  1GOT B;  2IWF A;  4CY3 A;  4O1Q D;  3EI4 A;  2I0S A;  4YVD A;  2IWK A;  3P4F A;  2PM9 B;  5IJ8 E;  3K27 A;  5B4W A;  1XKS A;  4JXM A;  3FM0 A;  4LG9 A;  2OK4 A;  4A08 B;  1N6F A;  2PM9 A;  3EI3 B;  3SJL D;  4E54 B;  3AL8 B;  3SBR A;  3OW8 A;  1GXR A;  4K3J B;  4A11 B;  4A08 A;  4LGN A;  5JWZ A;  5I5I A;  3IKO A;  4ERZ A;  3EI3 A;  4E54 A;  2W18 A;  3AL8 A;  5AFU 3;  3EU7 A;  3J80 g;  3L4O D;  2OVQ B;  4A11 A;  2Z2O A;  4CY2 A;  4A2M A;  1JMZ B;  2AGY A;  3DXM C;  4QQE A;  3SN6 B;  3AFC A;  5FXY A;  1MDA H;  4PXW A;  2B5L A;  5THA A;  4AOW A;  4XYI A;  1TBG A;  5IJ7 E;  5FA5 B;  3V5W B;  2AH0 A;  5I5M A;  1B9X A;  1N6E A;  4QT8 A;  1S4U X;  2H9N A;  1JOF A;  2HES X;  1JMX B;  3PVU B;  2AQ5 A;  2P9S C;  5EM2 B;  3B7F A;  3HFQ A;  4PNK B;  4O3T B;  4U1E I;  4AEZ A;  3BG1 A;  3F3F A;  3J81 g;  3F3G A;  4ZN4 A;  3EG6 A;  2GC4 A;  5SXM A;  2IUR A;  3C9C A;  4GQ2 P;  5HE2 B;  3MKQ A;  3SWS D;  3IIY A;  3VGZ A;  1U4C A;  5EAL A;  5EAM A;  3PXS D;  3SMR A;  3IJ1 A;  1PBY B;  3EI1 A;  1U2V C;  4O9D A;  5HE0 B;  3OKY B;  4KFM B;  1ERJ A;  4FB1 D;  3PXW D;  5GSA A;  3UR4 A;  2IUV A;  3OKY A;  3I7O A;  2H14 A;  4G56 B;  5TEE A;  2OVR B;  4E5Z B;  3OKW A;  3I89 A;  3I2N A;  5CXC B;  4OZU A;  4JSP C;  2CN3 A;  4E5Z A;  2P9L C;  2HKM A;  5CYK B;  3MZL A;  4J79 A;  5CXC A;  5HYN B;  4A0B A;  4CI1 A;  2PBI B;  4K3I D;  4CI3 A;  2AGX A;  4X61 B;  1VYH C;  3CFS B;  5CYK A;  3JRP A;  2GC7 A; 
#chains in the Genus database with same CATH topology
 3RFH A;  3RN1 D;  4R7A B;  1C9I A;  2H13 A;  1UTC A;  5M5V A;  5C86 A;  2G9A A;  4ZOV A;  4BUJ C;  4JSX C;  4A0A A;  3KCI A;  1K32 A;  1GG2 B;  4JT6 C;  3L4M D;  4FAV D;  4JSV C;  3JRO A;  4ES0 A;  4J0W A;  3JZN A;  3RSE C;  3K26 A;  1MG3 A;  5EML B;  5C92 A;  5FFO A;  4FA4 D;  4J81 A;  4WJK A;  3UKU C;  3IJC A;  2VDQ A;  1GOH A;  3ZWL B;  1JTD B;  2HU8 A;  5EMJ B;  2CNX A;  2HJB A;  4L9O A;  3NVX A;  1B9Y A;  4X3E A;  4BL0 A;  5A2Q g;  2I3S A;  2QZP A;  4GM9 A;  5HDB A;  2AH1 A;  3O4H A;  4ZOZ A;  2P9U C;  3GFC A;  1R5M A;  2J56 H;  3PSC B;  1JV2 A;  5EAR A;  4BP9 A;  1L0Q A;  2UZX B;  2QC5 A;  2XYI A;  4J78 A;  3JB9 L;  2CE9 A;  4X63 B;  4J0X A;  4CZV A;  2P9K C;  2HKR A;  4TZ4 A;  5GXI A;  4CY5 A;  2I0R A;  5K1C C;  3K6S A;  5E6U A;  2BBK H;  3NIF A;  5TDH B;  4H5J A;  3BWS A;  3SLE D;  3I7P A;  2VDL A;  3PVW B;  3MVD K;  1I2M B;  3ODT A;  4OWR A;  4J8B A;  1H2Z A;  3SBQ A;  4BCB A;  4FAN D;  4X60 B;  4GM8 A;  4FWW A;  2J57 G;  4J86 A;  5FFG A;  4UI9 R;  4O2W A;  3DWL C;  1NEX B;  3T3M A;  1N6D A;  1YFQ A;  4FA9 D;  2H6K A;  2QXV A;  2MTA H;  3C99 A;  3F3P A;  2OIZ A;  3CIK B;  4D0K A;  2CN2 A;  3O4J A;  2UZY B;  3UVO A;  4Y7R A;  3JPX A;  3EI1 B;  4IRZ A;  3MMY A;  4MK0 B;  2PM7 B;  4JD2 C;  2XU7 A;  3UVL A;  4CZY A;  5IC7 A;  4CZX A;  3OF7 A;  4QRJ A;  4FA1 D;  2IUQ A;  1PGU A;  5HE3 B;  2H9L A;  3UVM A;  4XYH A;  1MG2 A;  2EIB A;  4BP8 A;  2Q7Q A;  3EI2 B;  1PI6 A;  4GGC A;  1UOO A;  4J73 A;  3FCU A;  3ZDX A;  5AMS A;  2BCJ B;  1QNI A;  2OJY A;  2BKL A;  3I7H A;  3SXT D;  3EI2 A;  5TEF A;  4FHL A;  4A0B B;  4PBZ A;  4GM3 A;  2H6Q A;  2XL3 A;  4G55 A;  5FKQ A;  1Q47 A;  3SHF A;  4ZOY A;  4I79 A;  4AN0 A;  4GQ1 A;  4A2L A;  5M5T A;  1OLZ A;  4LG8 A;  1PEV A;  2XL2 A;  4JT5 C;  4O3U B;  4PSX B;  3A0F A;  3AH8 B;  3O4I A;  3W15 A;  4DNU A;  2P9N C;  3EWE A;  5FKR A;  2HJ4 A;  5TF2 A;  1VE6 A;  4XEI C;  3GD1 I;  5EMM B;  4A0A B;  3RLM D;  2G99 A;  4ESG A;  3KRX B;  1XIP A;  2VDM A;  2B4E A;  3GRE A;  4AMZ A;  5H17 A;  1E8N A;  4GZ8 A;  2IUP A;  3ZE0 A;  4HDJ A;  2YBA A;  2EIC A;  4NAA A;  3EQ7 A;  3NID A;  2P9P C;  2H6N A;  3VI3 A;  2P9I C;  4JSN C;  1GOF A;  4JHN A;  4O02 A;  2I0T A;  3OL2 B;  4H5I A;  4FA5 D;  4J82 A;  3UKR C;  3JAM g;  4L1Q D;  3IJ0 A;  1JJU B;  4PBY A;  3MZK A;  3OL2 A;  5FKS A;  2VDK A;  1O6G A;  5KDO B;  3IUN A;  4BH6 A;  2VDR A;  4CI2 A;  2VDN A;  3V4V A;  3BG0 A;  4GQB B;  2H9M A;  5FKT A;  2HYE A;  5I5J A;  2AGW A;  1P22 A;  3I8E A;  3U4Y A;  4PSW B;  5GXH A;  3IUJ A;  3SCY A;  1QFM A;  5IT9 g;  1QFS A;  3T3P A;  5K19 A;  4Z8L A;  4ERQ A;  4BCD A;  2AGL A;  2Z2N A;  4WK4 A;  4G1E A;  4L3H D;  5H14 A;  2YNP A;  5FLX g;  4D6V A;  2PM6 B;  5E6R A;  4EWR A;  3CFV A;  1UOQ A;  2YB8 B;  5IGO A;  1E5T A;  3SFZ A;  3GC3 B;  1UOP A;  3MXX A;  3JZH A;  2EBS A;  4DNV A;  4BCC A;  5GMK n;  1GOG A;  3NVQ A;  4CC9 A;  4QL1 A;  4J84 A;  4GGD A;  2XDW A;  2B5N A;  2CO0 C;  3UVK A;  1U8C A;  2O9K A;  3IUM A;  1FWX A;  1TYQ C;  4AN1 A;  1RI6 A;  1XHM A;  3ZE1 A;  3AL9 A;  3I7K A;  2YNN A;  3NVN A;  4PC0 A;  5EAP A;  3RRM C;  3C75 H;  4IMM A;  2GNQ A;  2IAA A;  4WK2 A;  4NBM A;  2CE8 A;  3ULE C;  3VH0 A;  3RMZ D;  3FGB A;  5C2W B;  3VA6 A;  4O45 A;  4IA9 A;  3VI4 A;  3I7N A;  2VZ1 A;  4RE5 A;  3FCS A;  3DSM A;  1NR0 A;  2H68 A;  3ZDZ A;  2OK6 A;  4Y5R D;  5EM2 A;  3PE7 A;  2OVP B;  2QR5 A;  3EMH A;  1SHY B;  4UM9 A;  3I8C A;  3OTT A;  4L3G D;  3MKS B;  4RE6 A;  5M5U A;  5H1M A;  1H2X A;  4ZOX A;  5IGQ A;  5HE1 B;  4J8G A;  3OKT A;  2H3X A;  5E6S A;  5CXB B;  4Z7Q A;  5HQG A;  3SBP A;  2B5M A;  4J87 A;  3RFG A;  4A09 B;  1K8K C;  4N14 A;  3N0D A;  3N0E A;  4MMY A;  4GGA A;  5CXB A;  2YNO A;  2H47 A;  5C9Z B;  1OMW B;  4A09 A;  3IIW A;  2J55 H;  1H2W A;  1BPO A;  3IUR A;  1L5G A;  3JZG A;  2HXC A;  3DXK C;  4UM8 A;  3SVW D;  5M5S A;  1GP2 B;  1SQJ A;  3IVM A;  3C5M A;  3V9F A;  4ERY A;  1O6F A;  2Z2P A;  3EQ8 A;  2CO0 A;  3V7D B;  1TYE A;  3UVN A;  3DM0 A;  4NEN A;  5M5R A;  1VZ2 A;  2YMU A;  1VE7 A;  2XE4 A;  3FRX A;  5FQD A;  1T2X A;  2HU5 A;  4J77 A;  3PSL A;  3ZE2 A;  1A0R B;  3E0C A;  1SQ9 A;  4GMB A;  2EID A;  4CY1 A;  3MUO A;  2H9P A;  3RN0 D;  5C2V B;  1M1X A;  4U7A A;  5EMK B;  3PXT D;  2AGZ A;  4A7J A;  3EI4 B;  4CI8 A;  4NSX A;  2I3T A;  2TRC B;  3ORV D;  3K72 A;  3I7L A;  3KRW B;  3K71 A;  5AJA A;  3V4P A;  1GOT B;  2IWF A;  3MUN A;  4CY3 A;  3IUQ A;  3QI0 A;  3EI4 A;  4O1Q D;  4JHP C;  2I0S A;  4YVD A;  1C9L A;  2IWK A;  3P4F A;  2PM9 B;  5IJ8 E;  3K27 A;  5B4W A;  1A12 A;  1XKS A;  3FM0 A;  4JXM A;  4G1M A;  4LG9 A;  2OK4 A;  3DDU A;  4A08 B;  3IUL A;  1E8M A;  1N6F A;  2PM9 A;  3EI3 B;  3SJL D;  4E54 B;  1H2Y A;  3AL8 B;  3SBR A;  4AX4 A;  3OW8 A;  1GXR A;  4K3J B;  4A11 B;  4A08 A;  4LGN A;  2XZG A;  5I5I A;  5JWZ A;  3IKO A;  4ERZ A;  4MMZ A;  3EI3 A;  4E54 A;  2W18 A;  3AL8 A;  5AFU 3;  3EU7 A;  4AMY A;  3J80 g;  3L4O D;  2OVQ B;  4A11 A;  2Z2O A;  4CY2 A;  4A2M A;  1JMZ B;  2AGY A;  3DXM C;  3EQ9 A;  4QQE A;  3O4G A;  3SN6 B;  3AFC A;  5M61 A;  5FXY A;  1K3I A;  1MDA H;  4PXW A;  2B5L A;  5THA A;  4AOW A;  4XYI A;  1TBG A;  5IJ7 E;  3ZDY A;  5FA5 B;  3V5W B;  2AH0 A;  5I5M A;  1B9X A;  1N6E A;  1YR2 A;  4QT8 A;  1S4U X;  2H9N A;  1JOF A;  2HES X;  1JMX B;  3PVU B;  2AQ5 A;  2P9S C;  3IJE A;  5EM2 B;  3B7F A;  3HFQ A;  4PNK B;  4O3T B;  4Z7N A;  4U1E I;  4AEZ A;  3BG1 A;  3F3F A;  3J81 g;  3F3G A;  4ZN4 A;  3EG6 A;  2GC4 A;  5SXM A;  2IUR A;  3C9C A;  4GQ2 P;  5HE2 B;  3MKQ A;  4DNW A;  3SWS D;  3IIY A;  3VGZ A;  1U4C A;  5EAL A;  2HU7 A;  5EAM A;  3PXS D;  3SMR A;  3IJ1 A;  2WQ8 A;  1PBY B;  3EI1 A;  1U2V C;  4O9D A;  5HE0 B;  3OKY B;  4KFM B;  1ERJ A;  2VDP A;  4FB1 D;  1VZ3 A;  4D9S A;  3PXW D;  5GSA A;  3QHY B;  3UR4 A;  4L1M A;  2IUV A;  3OKY A;  3I7O A;  2H14 A;  4G56 B;  5TEE A;  2OVR B;  4MMX A;  4E5Z B;  3OKW A;  4WK0 A;  3I89 A;  3NIG A;  3I2N A;  5CXC B;  4OZU A;  4Z7O A;  2VC2 A;  2EIE A;  4JSP C;  2CN3 A;  4NC4 A;  4E5Z A;  2P9L C;  2HKM A;  5CYK B;  3MZL A;  2VZ3 A;  4J79 A;  5CXC A;  5HYN B;  4QAM A;  4A0B A;  2JKX A;  2PBI B;  4K3I D;  4CI1 A;  4CI3 A;  2AGX A;  4X61 B;  1VYH C;  3CFS B;  5CYK A;  3JRP A;  2VDO A;  2GC7 A; 
#chains in the Genus database with same CATH homology
 3RFH A;  3RN1 D;  4R7A B;  2H13 A;  2G9A A;  4ZOV A;  4BUJ C;  4JSX C;  4A0A A;  1K32 A;  1GG2 B;  4JT6 C;  3L4M D;  4FAV D;  4JSV C;  3JRO A;  4ES0 A;  4J0W A;  3JZN A;  3RSE C;  3K26 A;  1MG3 A;  5EML B;  4FA4 D;  4J81 A;  3UKU C;  3IJC A;  3ZWL B;  5EMJ B;  2CNX A;  2HJB A;  4L9O A;  3NVX A;  1B9Y A;  4X3E A;  4BL0 A;  5A2Q g;  2I3S A;  4GM9 A;  2AH1 A;  4ZOZ A;  2P9U C;  3GFC A;  1R5M A;  2J56 H;  3PSC B;  5EAR A;  1L0Q A;  2UZX B;  2QC5 A;  2XYI A;  4J78 A;  3JB9 L;  2CE9 A;  4X63 B;  4J0X A;  4CZV A;  2P9K C;  2HKR A;  4TZ4 A;  5GXI A;  4CY5 A;  2I0R A;  5K1C C;  2BBK H;  5TDH B;  4H5J A;  3BWS A;  3SLE D;  3I7P A;  3PVW B;  3ODT A;  4OWR A;  4J8B A;  3SBQ A;  4FAN D;  4X60 B;  4GM8 A;  4FWW A;  2J57 G;  4J86 A;  4UI9 R;  3DWL C;  1NEX B;  1YFQ A;  1N6D A;  4FA9 D;  2H6K A;  2QXV A;  2MTA H;  3C99 A;  3F3P A;  2OIZ A;  3CIK B;  4D0K A;  2CN2 A;  2UZY B;  3UVO A;  4Y7R A;  3JPX A;  3EI1 B;  3MMY A;  4MK0 B;  2PM7 B;  4JD2 C;  2XU7 A;  3UVL A;  4CZY A;  5IC7 A;  4CZX A;  4QRJ A;  4FA1 D;  2IUQ A;  1PGU A;  5HE3 B;  2H9L A;  3UVM A;  4XYH A;  1MG2 A;  2Q7Q A;  3EI2 B;  1PI6 A;  4GGC A;  4J73 A;  5AMS A;  2BCJ B;  1QNI A;  2OJY A;  3I7H A;  3SXT D;  3EI2 A;  5TEF A;  4FHL A;  4A0B B;  4PBZ A;  4GM3 A;  2H6Q A;  2XL3 A;  5FKQ A;  1Q47 A;  3SHF A;  4ZOY A;  4I79 A;  4GQ1 A;  4A2L A;  1OLZ A;  4LG8 A;  1PEV A;  2XL2 A;  4JT5 C;  4O3U B;  4PSX B;  3A0F A;  3AH8 B;  3W15 A;  2P9N C;  3EWE A;  5FKR A;  2HJ4 A;  5TF2 A;  4XEI C;  5EMM B;  4A0A B;  3RLM D;  2G99 A;  4ESG A;  3KRX B;  1XIP A;  3GRE A;  2B4E A;  5H17 A;  4GZ8 A;  2IUP A;  4HDJ A;  2YBA A;  2P9P C;  2H6N A;  2P9I C;  4JSN C;  2I0T A;  3OL2 B;  4H5I A;  4FA5 D;  4J82 A;  3UKR C;  3JAM g;  4L1Q D;  3IJ0 A;  1JJU B;  4PBY A;  3MZK A;  3OL2 A;  5FKS A;  5KDO B;  4BH6 A;  4CI2 A;  3BG0 A;  4GQB B;  2H9M A;  5FKT A;  2HYE A;  5I5J A;  2AGW A;  1P22 A;  3I8E A;  3U4Y A;  4PSW B;  5GXH A;  3SCY A;  5IT9 g;  5K19 A;  4Z8L A;  4ERQ A;  2AGL A;  2Z2N A;  4L3H D;  5H14 A;  2YNP A;  5FLX g;  4D6V A;  2PM6 B;  4EWR A;  3CFV A;  2YB8 B;  5IGO A;  3SFZ A;  3MXX A;  3JZH A;  2EBS A;  5GMK n;  3NVQ A;  4CC9 A;  4QL1 A;  4J84 A;  4GGD A;  2B5N A;  2CO0 C;  3UVK A;  2O9K A;  1FWX A;  1TYQ C;  1RI6 A;  1XHM A;  3AL9 A;  3I7K A;  2YNN A;  3NVN A;  4PC0 A;  5EAP A;  3RRM C;  3C75 H;  4IMM A;  2GNQ A;  2IAA A;  2CE8 A;  3ULE C;  3VH0 A;  3RMZ D;  3FGB A;  5C2W B;  3VA6 A;  4O45 A;  4IA9 A;  3I7N A;  3DSM A;  1NR0 A;  2H68 A;  2OK6 A;  4Y5R D;  5EM2 A;  3PE7 A;  2OVP B;  3EMH A;  1SHY B;  3I8C A;  3OTT A;  4L3G D;  3MKS B;  5H1M A;  4ZOX A;  5IGQ A;  5HE1 B;  4J8G A;  3OKT A;  2H3X A;  5CXB B;  5HQG A;  3SBP A;  2B5M A;  4J87 A;  3RFG A;  4A09 B;  1K8K C;  4N14 A;  3N0D A;  3N0E A;  4GGA A;  5CXB A;  2YNO A;  2H47 A;  5C9Z B;  1OMW B;  4A09 A;  3IIW A;  2J55 H;  2HXC A;  3JZG A;  3DXK C;  3SVW D;  1GP2 B;  1SQJ A;  3C5M A;  3V9F A;  4ERY A;  2Z2P A;  3V7D B;  2CO0 A;  3UVN A;  3DM0 A;  2YMU A;  3FRX A;  5FQD A;  4J77 A;  3PSL A;  1A0R B;  3E0C A;  1SQ9 A;  4GMB A;  4CY1 A;  2H9P A;  3RN0 D;  5C2V B;  4U7A A;  5EMK B;  3PXT D;  2AGZ A;  4A7J A;  3EI4 B;  4CI8 A;  4NSX A;  2I3T A;  2TRC B;  3ORV D;  3I7L A;  3KRW B;  5AJA A;  1GOT B;  2IWF A;  4CY3 A;  4O1Q D;  3EI4 A;  2I0S A;  4YVD A;  2IWK A;  3P4F A;  2PM9 B;  5IJ8 E;  3K27 A;  5B4W A;  1XKS A;  4JXM A;  3FM0 A;  4LG9 A;  2OK4 A;  4A08 B;  1N6F A;  2PM9 A;  3EI3 B;  3SJL D;  4E54 B;  3AL8 B;  3SBR A;  3OW8 A;  1GXR A;  4K3J B;  4A11 B;  4A08 A;  4LGN A;  5JWZ A;  5I5I A;  3IKO A;  4ERZ A;  3EI3 A;  4E54 A;  2W18 A;  3AL8 A;  5AFU 3;  3EU7 A;  3J80 g;  3L4O D;  2OVQ B;  4A11 A;  2Z2O A;  4CY2 A;  4A2M A;  1JMZ B;  2AGY A;  3DXM C;  4QQE A;  3SN6 B;  3AFC A;  5FXY A;  1MDA H;  4PXW A;  2B5L A;  5THA A;  4AOW A;  4XYI A;  1TBG A;  5IJ7 E;  5FA5 B;  3V5W B;  2AH0 A;  5I5M A;  1B9X A;  1N6E A;  4QT8 A;  1S4U X;  2H9N A;  1JOF A;  2HES X;  1JMX B;  3PVU B;  2AQ5 A;  2P9S C;  5EM2 B;  3B7F A;  3HFQ A;  4PNK B;  4O3T B;  4U1E I;  4AEZ A;  3BG1 A;  3F3F A;  3J81 g;  3F3G A;  4ZN4 A;  3EG6 A;  2GC4 A;  5SXM A;  2IUR A;  3C9C A;  4GQ2 P;  5HE2 B;  3MKQ A;  3SWS D;  3IIY A;  3VGZ A;  1U4C A;  5EAL A;  5EAM A;  3PXS D;  3SMR A;  3IJ1 A;  1PBY B;  3EI1 A;  1U2V C;  4O9D A;  5HE0 B;  3OKY B;  4KFM B;  1ERJ A;  4FB1 D;  3PXW D;  5GSA A;  3UR4 A;  2IUV A;  3OKY A;  3I7O A;  2H14 A;  4G56 B;  5TEE A;  2OVR B;  4E5Z B;  3OKW A;  3I89 A;  3I2N A;  5CXC B;  4OZU A;  4JSP C;  2CN3 A;  4E5Z A;  2P9L C;  2HKM A;  5CYK B;  3MZL A;  4J79 A;  5CXC A;  5HYN B;  4A0B A;  4CI1 A;  2PBI B;  4K3I D;  4CI3 A;  2AGX A;  4X61 B;  1VYH C;  3CFS B;  5CYK A;  3JRP A;  2GC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...