2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
3I89A 2MTAH 1MG3A 4CI2A 3SBQA 2IWFA 5HE3B 1PI6A 3SXTD 4GZ8A 4FA9D 2J56H 3AFCA 3PVUB 3VGZA 3DM0A 4PC0A 4ERQA 2AGZA 3EI3B 3MZLA 3MZKA 2IUQA 4A2LA 3OTTA 4K3JB 2CO0A 3AL9A 3RLMD 5IC7A 4J79A 4PXWA 4CY3A 4D0KA 1OMWB 2OVRB 5CYKB 4ZOVA 4FA4D 1GP2B 3JROA 3I7HA 5FKRA 4J0XA 2G9AA 3OKYA 1GXRA 4O3UB 4R7AB 2GNQA 3JZGA 5FQDA 2PM7B 3OKTA 2PM6B 5FKQA 3ZWLB 4CI8A 4Y5RD 3IIWA 4A0BA 2W18A 3DXMC 5HE2B 5EMLB 4PNKB 3UVKA 3F3GA 4GGDA 3C5MA 5JWZA 3N0DA 2I3SA 2CN3A 5EAPA 1NEXB 4Y7RA 1A0RB 3IJ1A 2OVPB 3L4MD 4JSVC 5FA5B 4FB1D 1K32A 1MDAH 3J81g 4O1QD 2OK4A 5TEFA 3UR4A 1JMXB 5I5MA 3GFCA 4E54A 1VYHC 4H5JA 4PSWB 4GQ1A 2P9UC 3VA6A 4GM9A 4FA1D 4XEIC 4L3HD 4YVDA 3KRWB 3PXTD 5SXMA 2Z2NA 2H6NA 5A2Qg 2IWKA 2OIZA 4QL1A 4JSNC 4KFMB 4K3ID 3KRXB 4GM3A 3FM0A 2IUVA 5IGOA 5EMMB 2PBIB 4BL0A 1U4CA 5C2WB 4ERYA 1RI6A 4J73A 1XHMA 5H17A 4Z8LA 2B5MA 4U1EI 2P9SC 5C9ZB 1GOTB 5IT9g 1PEVA 2H13A 3OKYB 3C75H 5AJAA 4J81A 5TF2A 4L1QD 4UI9R 5GMKn 3OL2A 5GXHA 2CN2A 4CY5A 4A08A 4A0BB 4E5ZA 3UVNA 4AEZA 3IJCA 2CE8A 5K19A 1B9XA 2I0RA 2J55H 4A2MA 1OLZA 4MK0B 3DSMA 3JPXA 4J84A 4CY1A 4LG8A 3V7DB 2YB8B 2XL3A 5IGQA 3NVNA 3IKOA 4E54B 3I7KA 3MKSB 4XYIA 3SHFA 2Z2PA 4JXMA 4L9OA 4J8BA 1XKSA 3J80g 3EI1A 5HE0B 3FRXA 2IURA 4CC9A 3BWSA 1R5MA 3PVWB 2B5LA 1MG2A 5K1CC 2UZYB 5FLXg 1Q47A 3RRMC 3SFZA 2H9MA 3NVQA 1XIPA 4JSXC 3UKRC 3JRPA 2J57G 3RFGA 4GMBA 2Q7QA 4J8GA 4JT6C 3RMZD 3RSEC 3PE7A 5FXYA 3ULEC 2P9KC 3EI2A 5HYNB 5TEEA 4X60B 2XL2A 3FGBA 3PXSD 3V9FA 5I5JA 5THAA 4AOWA 3OW8A 3IJ0A 4BH6A 4ES0A 2H9NA 3K26A 3OL2B 3I2NA 2EBSA 4CZYA 4PBYA 3ORVD 3AL8A 4O9DA 3EMHA 5EAMA 4A08B 2BCJB 4FWWA 1JMZB 3EWEA 4X61B 4E5ZB 4J77A 2XU7A 2YMUA 4O45A 3OKWA 3SWSD 5EMJB 1SQ9A 4CY2A 2HXCA 5TDHB 5AMSA 4ZOZA 5EM2A 4H5IA 2B4EA 5EMKB 5I5IA 2H6KA 2UZXB 4J82A 3EU7A 2IAAA 4G56B 3SCYA 1ERJA 3RN0D 3IIYA 2HYEA 3W15A 4J78A 3AH8B 3EI1B 2OK6A 3I7LA 2H9LA 4X3EA 5CXCA 2Z2OA 4QRJA 5GSAA 4GQ2P 4CI3A 2CE9A 3SBRA 2XYIA 4IA9A 3RN1D 2G99A 3JB9L 4CI1A 3BG1A 2H6QA 3F3PA 2AH0A 1QNIA 2OVQB 2AQ5A 4OZUA 3EI2B 4JSPC 3PSLA 3U4YA 4TZ4A 3L4OD 4PBZA 4A0AB 4XYHA 1GG2B 4GGAA 1SHYB 4JT5C 2YNNA 3CFVA 3AL8B 2AGXA 3V5WB 4HDJA 3UVLA 5HE1B 2CO0C 2AGYA 2I3TA 4ESGA 3ODTA 4LG9A 4GM8A 3EG6A 1FWXA 3UVOA 3I8CA 5CXBA 5EM2B 3SJLD 3I7PA 3E0CA 2AGWA 2AH1A 1N6FA 4I79A 4N14A 1JOFA 2P9PC 3VH0A 4FAND 2O9KA 4LGNA 4A11B 1S4UX 4OWRA 2QXVA 3C99A 3SMRA 4NSXA 2H68A 3NVXA 1PBYB 5H14A 5CXCB 2PM9B 2AGLA 3I8EA 4FAVD 1SQJA 4A09A 3MXXA 2HKMA 4ERZA 5EARA 3JAMg 4CZVA 2HJ4A 5AFU3 2IUPA 4U7AA 3SVWD 4A0AA 5B4WA 4J87A 3I7OA 4CZXA 4L3GD 4J86A 4D6VA 3EI4B 1N6EA 5HQGA 2OJYA 2I0TA 5FKTA 3PSCB 3UVMA 1YFQA 3CFSB 1TYQC 4FHLA 1U2VC 2YBAA 4ZOXA 3MKQA 1JJUB 3PXWD 1L0QA 2GC4A 2YNPA 5KDOB 3I7NA 3DXKC 1PGUA 2HKRA 2CNXA 3A0FA 1K8KC 5C2VB 4IMMA 5IJ7E 4A11A 3EI3A 3CIKB 5CXBB 3K27A 2PM9A 4QT8A 2H3XA 2P9NC 2B5NA 3B7FA 4QQEA 5CYKA 2I0SA 3RFHA 3F3FA 3C9CA 2H9PA 4PSXB 5IJ8E 2H14A 4JD2C 5FKSA 3N0EA 5H1MA 4EWRA 4GQBB 3BG0A 4GGCA 3MMYA 3EI4A 4A7JA 3JZHA 3JZNA 2QC5A 3SN6B 4A09B 3GREA 2H47A 4FA5D 4X63B 4ZN4A 5GXIA 1P22A 2YNOA 3UKUC 2GC7A 2TRCB 3SLED 2HESX 1B9YA 5EALA 2HJBA 3DWLC 4O3TB 3P4FA 1TBGA 3HFQA 2BBKH 1N6DA 4BUJC 2P9IC 1NR0A 2P9LC 4J0WA 4ZOYA 3SBPA
chains in the Genus database with same CATH superfamily
3NIGA 4BCDA 1I2MB 3I89A 2MTAH 1MG3A 4CI2A 3SBQA 2IWFA 5HE3B 1PI6A 3IUQA 3SXTD 4GZ8A 4FA9D 2J56H 1QFSA 3AFCA 3PVUB 3VGZA 4BCCA 3DM0A 4PC0A 4DNUA 4ERQA 2AGZA 3IUJA 2BKLA 4AMZA 3EI3B 3MZLA 3MZKA 2IUQA 4A2LA 3OTTA 4K3JB 4JHPC 5HDBA 2CO0A 3AL9A 2EIDA 3RLMD 5IC7A 4J79A 4PXWA 4CY3A 4RE6A 4D0KA 1OMWB 2OVRB 5CYKB 3ZDZA 4ZOVA 4FA4D 1GP2B 5FFGA 4D9SA 3JROA 1O6FA 3I7HA 5FKRA 4J0XA 2G9AA 3OKYA 1GXRA 4O3UB 4R7AB 2GNQA 3JZGA 5FQDA 4AN0A 2PM7B 3GC3B 3OKTA 2VDMA 2PM6B 5FKQA 3ZWLB 3ZDYA 4CI8A 4Y5RD 3IIWA 4A0BA 1JTDB 2W18A 3DXMC 5HE2B 1VZ3A 5EMLB 4PNKB 2VDPA 3UVKA 3F3GA 4GGDA 3C5MA 3FCUA 3N0DA 5JWZA 2I3SA 2CN3A 5EAPA 1NEXB 1VE6A 4Y7RA 1A0RB 3IJ1A 2HU8A 2OVPB 5M61A 3MUOA 2QZPA 3L4MD 4JSVC 5FA5B 4FB1D 1K32A 1MDAH 5E6RA 3J81g 4O1QD 3T3PA 2OK4A 5TEFA 3UR4A 3VI3A 1JMXB 1QFMA 5C86A 5I5MA 3GFCA 4E54A 2VDOA 4Z7NA 1C9IA 1VYHC 4H5JA 4PSWB 4GQ1A 2P9UC 3VA6A 4GM9A 4FA1D 4XEIC 4L3HD 4YVDA 5M5SA 3KRWB 3PXTD 5SXMA 2Z2NA 2H6NA 5A2Qg 2IWKA 2OIZA 4QL1A 4JSNC 4KFMB 4K3ID 3KRXB 4GM3A 3FM0A 2IUVA 4WK2A 3ZE2A 5IGOA 5EMMB 5C92A 2PBIB 4BL0A 3IJEA 1U4CA 5C2WB 4ERYA 1RI6A 4G1EA 4J73A 1XHMA 5H17A 1K3IA 4Z8LA 4Z7QA 2XZGA 2B5MA 4U1EI 4NBMA 2EIEA 2P9SC 5C9ZB 1GOTB 5IT9g 3V4PA 5E6UA 4MMZA 1PEVA 2H13A 3OKYB 3C75H 5AJAA 4J81A 5TF2A 4L1QD 4UI9R 5GMKn 3OL2A 5GXHA 2CN2A 4CY5A 4A08A 4MMYA 4A0BB 1E8MA 4E5ZA 3IURA 1GOGA 3UVNA 4AEZA 3IJCA 3ZE1A 3K6SA 2CE8A 5K19A 1B9XA 2I0RA 2J55H 4AN1A 4A2MA 1OLZA 4MK0B 5FFOA 3DSMA 3JPXA 2HU7A 4J84A 4CY1A 3DDUA 4LG8A 3V7DB 2YB8B 2XL3A 5IGQA 3NVNA 3IKOA 4E54B 3I7KA 3MKSB 1H2YA 4XYIA 3SHFA 2Z2PA 4JXMA 4L9OA 4J8BA 1XKSA 3J80g 3EI1A 5HE0B 3IUNA 3FRXA 2IURA 4CC9A 3BWSA 1R5MA 3PVWB 2B5LA 1MG2A 5K1CC 2UZYB 5FLXg 3ZDXA 1Q47A 3RRMC 3SFZA 2H9MA 3NVQA 1XIPA 4JSXC 3UKRC 3JRPA 2J57G 2VDRA 3RFGA 4GMBA 2Q7QA 4J8GA 4JT6C 3RMZD 3RSEC 3PE7A 5FXYA 3O4HA 3ULEC 2P9KC 3K72A 3EI2A 5HYNB 5TEEA 3QI0A 4X60B 2XL2A 3FGBA 3PXSD 3V9FA 5I5JA 5THAA 2XDWA 3GD1I 4AOWA 3OW8A 3IJ0A 4BH6A 4ES0A 2H9NA 3K26A 3NIDA 3OL2B 3I2NA 2EBSA 4CZYA 4PBYA 1H2ZA 3AL8A 3ORVD 3EMHA 4O9DA 5EAMA 1E8NA 4A08B 2BCJB 4FWWA 1JMZB 3EWEA 4X61B 4DNWA 4E5ZB 3O4IA 4J77A 2XE4A 3VI4A 2XU7A 2YMUA 4O45A 3OKWA 3EQ9A 3SWSD 5EMJB 1SQ9A 4CY2A 2HXCA 5TDHB 3OF7A 5AMSA 4ZOZA 5EM2A 4H5IA 2B4EA 3O4GA 5EMKB 5I5IA 2H6KA 2UZXB 4J82A 3EU7A 2IAAA 2VC2A 4G56B 3SCYA 1ERJA 1U8CA 1UTCA 4NAAA 3RN0D 3ZE0A 3IIYA 2HYEA 3KCIA 3W15A 4J78A 3AH8B 2VDKA 4QAMA 3EI1B 2OK6A 3I7LA 2H9LA 4X3EA 5CXCA 2Z2OA 4QRJA 1H2XA 5GSAA 2VDLA 4GQ2P 4CI3A 5M5VA 2CE9A 3SBRA 2JKXA 5M5RA 2XYIA 4IA9A 2VZ1A 3RN1D 1GOHA 2G99A 3JB9L 4CI1A 1BPOA 3BG1A 2H6QA 3F3PA 2AH0A 1QNIA 2OVQB 2QR5A 2AQ5A 4OZUA 3EI2B 4JSPC 4AMYA 3PSLA 3U4YA 4TZ4A 3L4OD 4BP9A 4PBZA 4A0AB 4XYHA 1GG2B 1YR2A 4MMXA 4GGAA 1SHYB 4JT5C 2YNNA 4O2WA 4Z7OA 4G55A 3CFVA 3AL8B 2AGXA 4DNVA 3V5WB 4HDJA 3UVLA 3IULA 5HE1B 2CO0C 4NENA 2AGYA 3K71A 2I3TA 4ESGA 3ODTA 4LG9A 4GM8A 1O6GA 1VZ2A 3EG6A 1FWXA 4UM8A 3UVOA 4BCBA 4WK0A 3I8CA 5CXBA 5EM2B 3SJLD 3I7PA 3EQ8A 3E0CA 2AGWA 2AH1A 1N6FA 4I79A 1JOFA 2P9PC 4N14A 3VH0A 4FAND 2O9KA 4LGNA 5M5UA 4A11B 1S4UX 2QXVA 3C99A 4OWRA 3SMRA 4NSXA 3O4JA 2H68A 3NVXA 1PBYB 5H14A 5CXCB 1TYEA 1UOOA 2PM9B 2AGLA 3EQ7A 2EIBA 1T2XA 3I8EA 4FAVD 1SQJA 1H2WA 4A09A 3MXXA 2HKMA 4ERZA 3MVDK 5EARA 3JAMg 3IVMA 4CZVA 2HJ4A 5AFU3 2IUPA 4U7AA 3SVWD 4A0AA 1L5GA 5B4WA 4WJKA 4J87A 3I7OA 4CZXA 4L3GD 5M5TA 4J86A 2VDNA 4AX4A 2EICA 4D6VA 3EI4B 1N6EA 5HQGA 2OJYA 2I0TA 4IRZA 5FKTA 3PSCB 3UVMA 1YFQA 3CFSB 1TYQC 4WK4A 4FHLA 1U2VC 2YBAA 4ZOXA 3MKQA 1VE7A 2VZ3A 1JJUB 4O02A 3PXWD 1JV2A 1L0QA 3NIFA 4JHNA 1E5TA 2GC4A 2YNPA 4L1MA 5KDOB 3I7NA 3DXKC 1PGUA 2HKRA 4NC4A 2CNXA 3A0FA 3FCSA 1M1XA 1K8KC 5C2VB 4IMMA 5IJ7E 4A11A 2VDQA 3EI3A 3CIKB 5CXBB 3K27A 2PM9A 4QT8A 2H3XA 2P9NC 1GOFA 2B5NA 4RE5A 3B7FA 3IUMA 4QQEA 5CYKA 2I0SA 4UM9A 3RFHA 3F3FA 3C9CA 2H9PA 4PSXB 5IJ8E 2H14A 4JD2C 2WQ8A 5FKSA 1UOPA 3N0EA 5H1MA 4EWRA 4GQBB 3BG0A 4GGCA 3MMYA 3EI4A 4A7JA 2HU5A 3JZHA 3JZNA 2QC5A 3SN6B 1UOQA 4A09B 3GREA 2H47A 3T3MA 4FA5D 4X63B 4ZN4A 5GXIA 1P22A 1A12A 2YNOA 3UKUC 3V4VA 2GC7A 2TRCB 3SLED 2HESX 1B9YA 3QHYB 1C9LA 5EALA 2HJBA 3DWLC 4O3TB 3P4FA 1TBGA 3HFQA 2BBKH 1N6DA 4BUJC 2P9IC 1NR0A 2P9LC 4J0WA 4ZOYA 3SBPA 4G1MA 3MUNA 4BP8A 5E6SA
chains in the Genus database with same CATH topology
3I89A 2MTAH 1MG3A 4CI2A 3SBQA 2IWFA 5HE3B 1PI6A 3SXTD 4GZ8A 4FA9D 2J56H 3AFCA 3PVUB 3VGZA 3DM0A 4PC0A 4ERQA 2AGZA 3EI3B 3MZLA 3MZKA 2IUQA 4A2LA 3OTTA 4K3JB 2CO0A 3AL9A 3RLMD 5IC7A 4J79A 4PXWA 4CY3A 4D0KA 1OMWB 2OVRB 5CYKB 4ZOVA 4FA4D 1GP2B 3JROA 3I7HA 5FKRA 4J0XA 2G9AA 3OKYA 1GXRA 4O3UB 4R7AB 2GNQA 3JZGA 5FQDA 2PM7B 3OKTA 2PM6B 5FKQA 3ZWLB 4CI8A 4Y5RD 3IIWA 4A0BA 2W18A 3DXMC 5HE2B 5EMLB 4PNKB 3UVKA 3F3GA 4GGDA 3C5MA 5JWZA 3N0DA 2I3SA 2CN3A 5EAPA 1NEXB 4Y7RA 1A0RB 3IJ1A 2OVPB 3L4MD 4JSVC 5FA5B 4FB1D 1K32A 1MDAH 3J81g 4O1QD 2OK4A 5TEFA 3UR4A 1JMXB 5I5MA 3GFCA 4E54A 1VYHC 4H5JA 4PSWB 4GQ1A 2P9UC 3VA6A 4GM9A 4FA1D 4XEIC 4L3HD 4YVDA 3KRWB 3PXTD 5SXMA 2Z2NA 2H6NA 5A2Qg 2IWKA 2OIZA 4QL1A 4JSNC 4KFMB 4K3ID 3KRXB 4GM3A 3FM0A 2IUVA 5IGOA 5EMMB 2PBIB 4BL0A 1U4CA 5C2WB 4ERYA 1RI6A 4J73A 1XHMA 5H17A 4Z8LA 2B5MA 4U1EI 2P9SC 5C9ZB 1GOTB 5IT9g 1PEVA 2H13A 3OKYB 3C75H 5AJAA 4J81A 5TF2A 4L1QD 4UI9R 5GMKn 3OL2A 5GXHA 2CN2A 4CY5A 4A08A 4A0BB 4E5ZA 3UVNA 4AEZA 3IJCA 2CE8A 5K19A 1B9XA 2I0RA 2J55H 4A2MA 1OLZA 4MK0B 3DSMA 3JPXA 4J84A 4CY1A 4LG8A 3V7DB 2YB8B 2XL3A 5IGQA 3NVNA 3IKOA 4E54B 3I7KA 3MKSB 4XYIA 3SHFA 2Z2PA 4JXMA 4L9OA 4J8BA 1XKSA 3J80g 3EI1A 5HE0B 3FRXA 2IURA 4CC9A 3BWSA 1R5MA 3PVWB 2B5LA 1MG2A 5K1CC 2UZYB 5FLXg 1Q47A 3RRMC 3SFZA 2H9MA 3NVQA 1XIPA 4JSXC 3UKRC 3JRPA 2J57G 3RFGA 4GMBA 2Q7QA 4J8GA 4JT6C 3RMZD 3RSEC 3PE7A 5FXYA 3ULEC 2P9KC 3EI2A 5HYNB 5TEEA 4X60B 2XL2A 3FGBA 3PXSD 3V9FA 5I5JA 5THAA 4AOWA 3OW8A 3IJ0A 4BH6A 4ES0A 2H9NA 3K26A 3OL2B 3I2NA 2EBSA 4CZYA 4PBYA 3ORVD 3AL8A 4O9DA 3EMHA 5EAMA 4A08B 2BCJB 4FWWA 1JMZB 3EWEA 4X61B 4E5ZB 4J77A 2XU7A 2YMUA 4O45A 3OKWA 3SWSD 5EMJB 1SQ9A 4CY2A 2HXCA 5TDHB 5AMSA 4ZOZA 5EM2A 4H5IA 2B4EA 5EMKB 5I5IA 2H6KA 2UZXB 4J82A 3EU7A 2IAAA 4G56B 3SCYA 1ERJA 3RN0D 3IIYA 2HYEA 3W15A 4J78A 3AH8B 3EI1B 2OK6A 3I7LA 2H9LA 4X3EA 5CXCA 2Z2OA 4QRJA 5GSAA 4GQ2P 4CI3A 2CE9A 3SBRA 2XYIA 4IA9A 3RN1D 2G99A 3JB9L 4CI1A 3BG1A 2H6QA 3F3PA 2AH0A 1QNIA 2OVQB 2AQ5A 4OZUA 3EI2B 4JSPC 3PSLA 3U4YA 4TZ4A 3L4OD 4PBZA 4A0AB 4XYHA 1GG2B 4GGAA 1SHYB 4JT5C 2YNNA 3CFVA 3AL8B 2AGXA 3V5WB 4HDJA 3UVLA 5HE1B 2CO0C 2AGYA 2I3TA 4ESGA 3ODTA 4LG9A 4GM8A 3EG6A 1FWXA 3UVOA 3I8CA 5CXBA 5EM2B 3SJLD 3I7PA 3E0CA 2AGWA 2AH1A 1N6FA 4I79A 4N14A 1JOFA 2P9PC 3VH0A 4FAND 2O9KA 4LGNA 4A11B 1S4UX 4OWRA 2QXVA 3C99A 3SMRA 4NSXA 2H68A 3NVXA 1PBYB 5H14A 5CXCB 2PM9B 2AGLA 3I8EA 4FAVD 1SQJA 4A09A 3MXXA 2HKMA 4ERZA 5EARA 3JAMg 4CZVA 2HJ4A 5AFU3 2IUPA 4U7AA 3SVWD 4A0AA 5B4WA 4J87A 3I7OA 4CZXA 4L3GD 4J86A 4D6VA 3EI4B 1N6EA 5HQGA 2OJYA 2I0TA 5FKTA 3PSCB 3UVMA 1YFQA 3CFSB 1TYQC 4FHLA 1U2VC 2YBAA 4ZOXA 3MKQA 1JJUB 3PXWD 1L0QA 2GC4A 2YNPA 5KDOB 3I7NA 3DXKC 1PGUA 2HKRA 2CNXA 3A0FA 1K8KC 5C2VB 4IMMA 5IJ7E 4A11A 3EI3A 3CIKB 5CXBB 3K27A 2PM9A 4QT8A 2H3XA 2P9NC 2B5NA 3B7FA 4QQEA 5CYKA 2I0SA 3RFHA 3F3FA 3C9CA 2H9PA 4PSXB 5IJ8E 2H14A 4JD2C 5FKSA 3N0EA 5H1MA 4EWRA 4GQBB 3BG0A 4GGCA 3MMYA 3EI4A 4A7JA 3JZHA 3JZNA 2QC5A 3SN6B 4A09B 3GREA 2H47A 4FA5D 4X63B 4ZN4A 5GXIA 1P22A 2YNOA 3UKUC 2GC7A 2TRCB 3SLED 2HESX 1B9YA 5EALA 2HJBA 3DWLC 4O3TB 3P4FA 1TBGA 3HFQA 2BBKH 1N6DA 4BUJC 2P9IC 1NR0A 2P9LC 4J0WA 4ZOYA 3SBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I89 A;  2MTA H;  1MG3 A;  4CI2 A;  3SBQ A;  2IWF A;  5HE3 B;  1PI6 A;  3SXT D;  4GZ8 A;  4FA9 D;  2J56 H;  3AFC A;  3PVU B;  3VGZ A;  3DM0 A;  4PC0 A;  4ERQ A;  2AGZ A;  3EI3 B;  3MZL A;  3MZK A;  2IUQ A;  4A2L A;  3OTT A;  4K3J B;  2CO0 A;  3AL9 A;  3RLM D;  5IC7 A;  4J79 A;  4PXW A;  4CY3 A;  4D0K A;  1OMW B;  2OVR B;  5CYK B;  4ZOV A;  4FA4 D;  1GP2 B;  3JRO A;  3I7H A;  5FKR A;  4J0X A;  2G9A A;  3OKY A;  1GXR A;  4O3U B;  4R7A B;  2GNQ A;  3JZG A;  5FQD A;  2PM7 B;  3OKT A;  2PM6 B;  5FKQ A;  3ZWL B;  4CI8 A;  4Y5R D;  3IIW A;  4A0B A;  2W18 A;  3DXM C;  5HE2 B;  5EML B;  4PNK B;  3UVK A;  3F3G A;  4GGD A;  3C5M A;  5JWZ A;  3N0D A;  2I3S A;  2CN3 A;  5EAP A;  1NEX B;  4Y7R A;  1A0R B;  3IJ1 A;  2OVP B;  3L4M D;  4JSV C;  5FA5 B;  4FB1 D;  1K32 A;  1MDA H;  3J81 g;  4O1Q D;  2OK4 A;  5TEF A;  3UR4 A;  1JMX B;  5I5M A;  3GFC A;  4E54 A;  1VYH C;  4H5J A;  4PSW B;  4GQ1 A;  2P9U C;  3VA6 A;  4GM9 A;  4FA1 D;  4XEI C;  4L3H D;  4YVD A;  3KRW B;  3PXT D;  5SXM A;  2Z2N A;  2H6N A;  5A2Q g;  2IWK A;  2OIZ A;  4QL1 A;  4JSN C;  4KFM B;  4K3I D;  3KRX B;  4GM3 A;  3FM0 A;  2IUV A;  5IGO A;  5EMM B;  2PBI B;  4BL0 A;  1U4C A;  5C2W B;  4ERY A;  1RI6 A;  4J73 A;  1XHM A;  5H17 A;  4Z8L A;  2B5M A;  4U1E I;  2P9S C;  5C9Z B;  1GOT B;  5IT9 g;  1PEV A;  2H13 A;  3OKY B;  3C75 H;  5AJA A;  4J81 A;  5TF2 A;  4L1Q D;  4UI9 R;  5GMK n;  3OL2 A;  5GXH A;  2CN2 A;  4CY5 A;  4A08 A;  4A0B B;  4E5Z A;  3UVN A;  4AEZ A;  3IJC A;  2CE8 A;  5K19 A;  1B9X A;  2I0R A;  2J55 H;  4A2M A;  1OLZ A;  4MK0 B;  3DSM A;  3JPX A;  4J84 A;  4CY1 A;  4LG8 A;  3V7D B;  2YB8 B;  2XL3 A;  5IGQ A;  3NVN A;  3IKO A;  4E54 B;  3I7K A;  3MKS B;  4XYI A;  3SHF A;  2Z2P A;  4JXM A;  4L9O A;  4J8B A;  1XKS A;  3J80 g;  3EI1 A;  5HE0 B;  3FRX A;  2IUR A;  4CC9 A;  3BWS A;  1R5M A;  3PVW B;  2B5L A;  1MG2 A;  5K1C C;  2UZY B;  5FLX g;  1Q47 A;  3RRM C;  3SFZ A;  2H9M A;  3NVQ A;  1XIP A;  4JSX C;  3UKR C;  3JRP A;  2J57 G;  3RFG A;  4GMB A;  2Q7Q A;  4J8G A;  4JT6 C;  3RMZ D;  3RSE C;  3PE7 A;  5FXY A;  3ULE C;  2P9K C;  3EI2 A;  5HYN B;  5TEE A;  4X60 B;  2XL2 A;  3FGB A;  3PXS D;  3V9F A;  5I5J A;  5THA A;  4AOW A;  3OW8 A;  3IJ0 A;  4BH6 A;  4ES0 A;  2H9N A;  3K26 A;  3OL2 B;  3I2N A;  2EBS A;  4CZY A;  4PBY A;  3ORV D;  3AL8 A;  4O9D A;  3EMH A;  5EAM A;  4A08 B;  2BCJ B;  4FWW A;  1JMZ B;  3EWE A;  4X61 B;  4E5Z B;  4J77 A;  2XU7 A;  2YMU A;  4O45 A;  3OKW A;  3SWS D;  5EMJ B;  1SQ9 A;  4CY2 A;  2HXC A;  5TDH B;  5AMS A;  4ZOZ A;  5EM2 A;  4H5I A;  2B4E A;  5EMK B;  5I5I A;  2H6K A;  2UZX B;  4J82 A;  3EU7 A;  2IAA A;  4G56 B;  3SCY A;  1ERJ A;  3RN0 D;  3IIY A;  2HYE A;  3W15 A;  4J78 A;  3AH8 B;  3EI1 B;  2OK6 A;  3I7L A;  2H9L A;  4X3E A;  5CXC A;  2Z2O A;  4QRJ A;  5GSA A;  4GQ2 P;  4CI3 A;  2CE9 A;  3SBR A;  2XYI A;  4IA9 A;  3RN1 D;  2G99 A;  3JB9 L;  4CI1 A;  3BG1 A;  2H6Q A;  3F3P A;  2AH0 A;  1QNI A;  2OVQ B;  2AQ5 A;  4OZU A;  3EI2 B;  4JSP C;  3PSL A;  3U4Y A;  4TZ4 A;  3L4O D;  4PBZ A;  4A0A B;  4XYH A;  1GG2 B;  4GGA A;  1SHY B;  4JT5 C;  2YNN A;  3CFV A;  3AL8 B;  2AGX A;  3V5W B;  4HDJ A;  3UVL A;  5HE1 B;  2CO0 C;  2AGY A;  2I3T A;  4ESG A;  3ODT A;  4LG9 A;  4GM8 A;  3EG6 A;  1FWX A;  3UVO A;  3I8C A;  5CXB A;  5EM2 B;  3SJL D;  3I7P A;  3E0C A;  2AGW A;  2AH1 A;  1N6F A;  4I79 A;  4N14 A;  1JOF A;  2P9P C;  3VH0 A;  4FAN D;  2O9K A;  4LGN A;  4A11 B;  1S4U X;  4OWR A;  2QXV A;  3C99 A;  3SMR A;  4NSX A;  2H68 A;  3NVX A;  1PBY B;  5H14 A;  5CXC B;  2PM9 B;  2AGL A;  3I8E A;  4FAV D;  1SQJ A;  4A09 A;  3MXX A;  2HKM A;  4ERZ A;  5EAR A;  3JAM g;  4CZV A;  2HJ4 A;  5AFU 3;  2IUP A;  4U7A A;  3SVW D;  4A0A A;  5B4W A;  4J87 A;  3I7O A;  4CZX A;  4L3G D;  4J86 A;  4D6V A;  3EI4 B;  1N6E A;  5HQG A;  2OJY A;  2I0T A;  5FKT A;  3PSC B;  3UVM A;  1YFQ A;  3CFS B;  1TYQ C;  4FHL A;  1U2V C;  2YBA A;  4ZOX A;  3MKQ A;  1JJU B;  3PXW D;  1L0Q A;  2GC4 A;  2YNP A;  5KDO B;  3I7N A;  3DXK C;  1PGU A;  2HKR A;  2CNX A;  3A0F A;  1K8K C;  5C2V B;  4IMM A;  5IJ7 E;  4A11 A;  3EI3 A;  3CIK B;  5CXB B;  3K27 A;  2PM9 A;  4QT8 A;  2H3X A;  2P9N C;  2B5N A;  3B7F A;  4QQE A;  5CYK A;  2I0S A;  3RFH A;  3F3F A;  3C9C A;  2H9P A;  4PSX B;  5IJ8 E;  2H14 A;  4JD2 C;  5FKS A;  3N0E A;  5H1M A;  4EWR A;  4GQB B;  3BG0 A;  4GGC A;  3MMY A;  3EI4 A;  4A7J A;  3JZH A;  3JZN A;  2QC5 A;  3SN6 B;  4A09 B;  3GRE A;  2H47 A;  4FA5 D;  4X63 B;  4ZN4 A;  5GXI A;  1P22 A;  2YNO A;  3UKU C;  2GC7 A;  2TRC B;  3SLE D;  2HES X;  1B9Y A;  5EAL A;  2HJB A;  3DWL C;  4O3T B;  3P4F A;  1TBG A;  3HFQ A;  2BBK H;  1N6D A;  4BUJ C;  2P9I C;  1NR0 A;  2P9L C;  4J0W A;  4ZOY A;  3SBP A; 
#chains in the Genus database with same CATH topology
 3NIG A;  4BCD A;  1I2M B;  3I89 A;  2MTA H;  1MG3 A;  4CI2 A;  3SBQ A;  2IWF A;  5HE3 B;  1PI6 A;  3IUQ A;  3SXT D;  4GZ8 A;  4FA9 D;  2J56 H;  1QFS A;  3AFC A;  3PVU B;  3VGZ A;  4BCC A;  3DM0 A;  4PC0 A;  4DNU A;  4ERQ A;  2AGZ A;  3IUJ A;  2BKL A;  4AMZ A;  3EI3 B;  3MZL A;  3MZK A;  2IUQ A;  4A2L A;  3OTT A;  4K3J B;  4JHP C;  5HDB A;  2CO0 A;  3AL9 A;  2EID A;  3RLM D;  5IC7 A;  4J79 A;  4PXW A;  4CY3 A;  4RE6 A;  4D0K A;  1OMW B;  2OVR B;  5CYK B;  3ZDZ A;  4ZOV A;  4FA4 D;  1GP2 B;  5FFG A;  4D9S A;  3JRO A;  1O6F A;  3I7H A;  5FKR A;  4J0X A;  2G9A A;  3OKY A;  1GXR A;  4O3U B;  4R7A B;  2GNQ A;  3JZG A;  5FQD A;  4AN0 A;  2PM7 B;  3GC3 B;  3OKT A;  2VDM A;  2PM6 B;  5FKQ A;  3ZWL B;  3ZDY A;  4CI8 A;  4Y5R D;  3IIW A;  4A0B A;  1JTD B;  2W18 A;  3DXM C;  5HE2 B;  1VZ3 A;  5EML B;  4PNK B;  2VDP A;  3UVK A;  3F3G A;  4GGD A;  3C5M A;  3FCU A;  3N0D A;  5JWZ A;  2I3S A;  2CN3 A;  5EAP A;  1NEX B;  1VE6 A;  4Y7R A;  1A0R B;  3IJ1 A;  2HU8 A;  2OVP B;  5M61 A;  3MUO A;  2QZP A;  3L4M D;  4JSV C;  5FA5 B;  4FB1 D;  1K32 A;  1MDA H;  5E6R A;  3J81 g;  4O1Q D;  3T3P A;  2OK4 A;  5TEF A;  3UR4 A;  3VI3 A;  1JMX B;  1QFM A;  5C86 A;  5I5M A;  3GFC A;  4E54 A;  2VDO A;  4Z7N A;  1C9I A;  1VYH C;  4H5J A;  4PSW B;  4GQ1 A;  2P9U C;  3VA6 A;  4GM9 A;  4FA1 D;  4XEI C;  4L3H D;  4YVD A;  5M5S A;  3KRW B;  3PXT D;  5SXM A;  2Z2N A;  2H6N A;  5A2Q g;  2IWK A;  2OIZ A;  4QL1 A;  4JSN C;  4KFM B;  4K3I D;  3KRX B;  4GM3 A;  3FM0 A;  2IUV A;  4WK2 A;  3ZE2 A;  5IGO A;  5EMM B;  5C92 A;  2PBI B;  4BL0 A;  3IJE A;  1U4C A;  5C2W B;  4ERY A;  1RI6 A;  4G1E A;  4J73 A;  1XHM A;  5H17 A;  1K3I A;  4Z8L A;  4Z7Q A;  2XZG A;  2B5M A;  4U1E I;  4NBM A;  2EIE A;  2P9S C;  5C9Z B;  1GOT B;  5IT9 g;  3V4P A;  5E6U A;  4MMZ A;  1PEV A;  2H13 A;  3OKY B;  3C75 H;  5AJA A;  4J81 A;  5TF2 A;  4L1Q D;  4UI9 R;  5GMK n;  3OL2 A;  5GXH A;  2CN2 A;  4CY5 A;  4A08 A;  4MMY A;  4A0B B;  1E8M A;  4E5Z A;  3IUR A;  1GOG A;  3UVN A;  4AEZ A;  3IJC A;  3ZE1 A;  3K6S A;  2CE8 A;  5K19 A;  1B9X A;  2I0R A;  2J55 H;  4AN1 A;  4A2M A;  1OLZ A;  4MK0 B;  5FFO A;  3DSM A;  3JPX A;  2HU7 A;  4J84 A;  4CY1 A;  3DDU A;  4LG8 A;  3V7D B;  2YB8 B;  2XL3 A;  5IGQ A;  3NVN A;  3IKO A;  4E54 B;  3I7K A;  3MKS B;  1H2Y A;  4XYI A;  3SHF A;  2Z2P A;  4JXM A;  4L9O A;  4J8B A;  1XKS A;  3J80 g;  3EI1 A;  5HE0 B;  3IUN A;  3FRX A;  2IUR A;  4CC9 A;  3BWS A;  1R5M A;  3PVW B;  2B5L A;  1MG2 A;  5K1C C;  2UZY B;  5FLX g;  3ZDX A;  1Q47 A;  3RRM C;  3SFZ A;  2H9M A;  3NVQ A;  1XIP A;  4JSX C;  3UKR C;  3JRP A;  2J57 G;  2VDR A;  3RFG A;  4GMB A;  2Q7Q A;  4J8G A;  4JT6 C;  3RMZ D;  3RSE C;  3PE7 A;  5FXY A;  3O4H A;  3ULE C;  2P9K C;  3K72 A;  3EI2 A;  5HYN B;  5TEE A;  3QI0 A;  4X60 B;  2XL2 A;  3FGB A;  3PXS D;  3V9F A;  5I5J A;  5THA A;  2XDW A;  3GD1 I;  4AOW A;  3OW8 A;  3IJ0 A;  4BH6 A;  4ES0 A;  2H9N A;  3K26 A;  3NID A;  3OL2 B;  3I2N A;  2EBS A;  4CZY A;  4PBY A;  1H2Z A;  3AL8 A;  3ORV D;  3EMH A;  4O9D A;  5EAM A;  1E8N A;  4A08 B;  2BCJ B;  4FWW A;  1JMZ B;  3EWE A;  4X61 B;  4DNW A;  4E5Z B;  3O4I A;  4J77 A;  2XE4 A;  3VI4 A;  2XU7 A;  2YMU A;  4O45 A;  3OKW A;  3EQ9 A;  3SWS D;  5EMJ B;  1SQ9 A;  4CY2 A;  2HXC A;  5TDH B;  3OF7 A;  5AMS A;  4ZOZ A;  5EM2 A;  4H5I A;  2B4E A;  3O4G A;  5EMK B;  5I5I A;  2H6K A;  2UZX B;  4J82 A;  3EU7 A;  2IAA A;  2VC2 A;  4G56 B;  3SCY A;  1ERJ A;  1U8C A;  1UTC A;  4NAA A;  3RN0 D;  3ZE0 A;  3IIY A;  2HYE A;  3KCI A;  3W15 A;  4J78 A;  3AH8 B;  2VDK A;  4QAM A;  3EI1 B;  2OK6 A;  3I7L A;  2H9L A;  4X3E A;  5CXC A;  2Z2O A;  4QRJ A;  1H2X A;  5GSA A;  2VDL A;  4GQ2 P;  4CI3 A;  5M5V A;  2CE9 A;  3SBR A;  2JKX A;  5M5R A;  2XYI A;  4IA9 A;  2VZ1 A;  3RN1 D;  1GOH A;  2G99 A;  3JB9 L;  4CI1 A;  1BPO A;  3BG1 A;  2H6Q A;  3F3P A;  2AH0 A;  1QNI A;  2OVQ B;  2QR5 A;  2AQ5 A;  4OZU A;  3EI2 B;  4JSP C;  4AMY A;  3PSL A;  3U4Y A;  4TZ4 A;  3L4O D;  4BP9 A;  4PBZ A;  4A0A B;  4XYH A;  1GG2 B;  1YR2 A;  4MMX A;  4GGA A;  1SHY B;  4JT5 C;  2YNN A;  4O2W A;  4Z7O A;  4G55 A;  3CFV A;  3AL8 B;  2AGX A;  4DNV A;  3V5W B;  4HDJ A;  3UVL A;  3IUL A;  5HE1 B;  2CO0 C;  4NEN A;  2AGY A;  3K71 A;  2I3T A;  4ESG A;  3ODT A;  4LG9 A;  4GM8 A;  1O6G A;  1VZ2 A;  3EG6 A;  1FWX A;  4UM8 A;  3UVO A;  4BCB A;  4WK0 A;  3I8C A;  5CXB A;  5EM2 B;  3SJL D;  3I7P A;  3EQ8 A;  3E0C A;  2AGW A;  2AH1 A;  1N6F A;  4I79 A;  1JOF A;  2P9P C;  4N14 A;  3VH0 A;  4FAN D;  2O9K A;  4LGN A;  5M5U A;  4A11 B;  1S4U X;  2QXV A;  3C99 A;  4OWR A;  3SMR A;  4NSX A;  3O4J A;  2H68 A;  3NVX A;  1PBY B;  5H14 A;  5CXC B;  1TYE A;  1UOO A;  2PM9 B;  2AGL A;  3EQ7 A;  2EIB A;  1T2X A;  3I8E A;  4FAV D;  1SQJ A;  1H2W A;  4A09 A;  3MXX A;  2HKM A;  4ERZ A;  3MVD K;  5EAR A;  3JAM g;  3IVM A;  4CZV A;  2HJ4 A;  5AFU 3;  2IUP A;  4U7A A;  3SVW D;  4A0A A;  1L5G A;  5B4W A;  4WJK A;  4J87 A;  3I7O A;  4CZX A;  4L3G D;  5M5T A;  4J86 A;  2VDN A;  4AX4 A;  2EIC A;  4D6V A;  3EI4 B;  1N6E A;  5HQG A;  2OJY A;  2I0T A;  4IRZ A;  5FKT A;  3PSC B;  3UVM A;  1YFQ A;  3CFS B;  1TYQ C;  4WK4 A;  4FHL A;  1U2V C;  2YBA A;  4ZOX A;  3MKQ A;  1VE7 A;  2VZ3 A;  1JJU B;  4O02 A;  3PXW D;  1JV2 A;  1L0Q A;  3NIF A;  4JHN A;  1E5T A;  2GC4 A;  2YNP A;  4L1M A;  5KDO B;  3I7N A;  3DXK C;  1PGU A;  2HKR A;  4NC4 A;  2CNX A;  3A0F A;  3FCS A;  1M1X A;  1K8K C;  5C2V B;  4IMM A;  5IJ7 E;  4A11 A;  2VDQ A;  3EI3 A;  3CIK B;  5CXB B;  3K27 A;  2PM9 A;  4QT8 A;  2H3X A;  2P9N C;  1GOF A;  2B5N A;  4RE5 A;  3B7F A;  3IUM A;  4QQE A;  5CYK A;  2I0S A;  4UM9 A;  3RFH A;  3F3F A;  3C9C A;  2H9P A;  4PSX B;  5IJ8 E;  2H14 A;  4JD2 C;  2WQ8 A;  5FKS A;  1UOP A;  3N0E A;  5H1M A;  4EWR A;  4GQB B;  3BG0 A;  4GGC A;  3MMY A;  3EI4 A;  4A7J A;  2HU5 A;  3JZH A;  3JZN A;  2QC5 A;  3SN6 B;  1UOQ A;  4A09 B;  3GRE A;  2H47 A;  3T3M A;  4FA5 D;  4X63 B;  4ZN4 A;  5GXI A;  1P22 A;  1A12 A;  2YNO A;  3UKU C;  3V4V A;  2GC7 A;  2TRC B;  3SLE D;  2HES X;  1B9Y A;  3QHY B;  1C9L A;  5EAL A;  2HJB A;  3DWL C;  4O3T B;  3P4F A;  1TBG A;  3HFQ A;  2BBK H;  1N6D A;  4BUJ C;  2P9I C;  1NR0 A;  2P9L C;  4J0W A;  4ZOY A;  3SBP A;  4G1M A;  3MUN A;  4BP8 A;  5E6S A; 
#chains in the Genus database with same CATH homology
 3I89 A;  2MTA H;  1MG3 A;  4CI2 A;  3SBQ A;  2IWF A;  5HE3 B;  1PI6 A;  3SXT D;  4GZ8 A;  4FA9 D;  2J56 H;  3AFC A;  3PVU B;  3VGZ A;  3DM0 A;  4PC0 A;  4ERQ A;  2AGZ A;  3EI3 B;  3MZL A;  3MZK A;  2IUQ A;  4A2L A;  3OTT A;  4K3J B;  2CO0 A;  3AL9 A;  3RLM D;  5IC7 A;  4J79 A;  4PXW A;  4CY3 A;  4D0K A;  1OMW B;  2OVR B;  5CYK B;  4ZOV A;  4FA4 D;  1GP2 B;  3JRO A;  3I7H A;  5FKR A;  4J0X A;  2G9A A;  3OKY A;  1GXR A;  4O3U B;  4R7A B;  2GNQ A;  3JZG A;  5FQD A;  2PM7 B;  3OKT A;  2PM6 B;  5FKQ A;  3ZWL B;  4CI8 A;  4Y5R D;  3IIW A;  4A0B A;  2W18 A;  3DXM C;  5HE2 B;  5EML B;  4PNK B;  3UVK A;  3F3G A;  4GGD A;  3C5M A;  5JWZ A;  3N0D A;  2I3S A;  2CN3 A;  5EAP A;  1NEX B;  4Y7R A;  1A0R B;  3IJ1 A;  2OVP B;  3L4M D;  4JSV C;  5FA5 B;  4FB1 D;  1K32 A;  1MDA H;  3J81 g;  4O1Q D;  2OK4 A;  5TEF A;  3UR4 A;  1JMX B;  5I5M A;  3GFC A;  4E54 A;  1VYH C;  4H5J A;  4PSW B;  4GQ1 A;  2P9U C;  3VA6 A;  4GM9 A;  4FA1 D;  4XEI C;  4L3H D;  4YVD A;  3KRW B;  3PXT D;  5SXM A;  2Z2N A;  2H6N A;  5A2Q g;  2IWK A;  2OIZ A;  4QL1 A;  4JSN C;  4KFM B;  4K3I D;  3KRX B;  4GM3 A;  3FM0 A;  2IUV A;  5IGO A;  5EMM B;  2PBI B;  4BL0 A;  1U4C A;  5C2W B;  4ERY A;  1RI6 A;  4J73 A;  1XHM A;  5H17 A;  4Z8L A;  2B5M A;  4U1E I;  2P9S C;  5C9Z B;  1GOT B;  5IT9 g;  1PEV A;  2H13 A;  3OKY B;  3C75 H;  5AJA A;  4J81 A;  5TF2 A;  4L1Q D;  4UI9 R;  5GMK n;  3OL2 A;  5GXH A;  2CN2 A;  4CY5 A;  4A08 A;  4A0B B;  4E5Z A;  3UVN A;  4AEZ A;  3IJC A;  2CE8 A;  5K19 A;  1B9X A;  2I0R A;  2J55 H;  4A2M A;  1OLZ A;  4MK0 B;  3DSM A;  3JPX A;  4J84 A;  4CY1 A;  4LG8 A;  3V7D B;  2YB8 B;  2XL3 A;  5IGQ A;  3NVN A;  3IKO A;  4E54 B;  3I7K A;  3MKS B;  4XYI A;  3SHF A;  2Z2P A;  4JXM A;  4L9O A;  4J8B A;  1XKS A;  3J80 g;  3EI1 A;  5HE0 B;  3FRX A;  2IUR A;  4CC9 A;  3BWS A;  1R5M A;  3PVW B;  2B5L A;  1MG2 A;  5K1C C;  2UZY B;  5FLX g;  1Q47 A;  3RRM C;  3SFZ A;  2H9M A;  3NVQ A;  1XIP A;  4JSX C;  3UKR C;  3JRP A;  2J57 G;  3RFG A;  4GMB A;  2Q7Q A;  4J8G A;  4JT6 C;  3RMZ D;  3RSE C;  3PE7 A;  5FXY A;  3ULE C;  2P9K C;  3EI2 A;  5HYN B;  5TEE A;  4X60 B;  2XL2 A;  3FGB A;  3PXS D;  3V9F A;  5I5J A;  5THA A;  4AOW A;  3OW8 A;  3IJ0 A;  4BH6 A;  4ES0 A;  2H9N A;  3K26 A;  3OL2 B;  3I2N A;  2EBS A;  4CZY A;  4PBY A;  3ORV D;  3AL8 A;  4O9D A;  3EMH A;  5EAM A;  4A08 B;  2BCJ B;  4FWW A;  1JMZ B;  3EWE A;  4X61 B;  4E5Z B;  4J77 A;  2XU7 A;  2YMU A;  4O45 A;  3OKW A;  3SWS D;  5EMJ B;  1SQ9 A;  4CY2 A;  2HXC A;  5TDH B;  5AMS A;  4ZOZ A;  5EM2 A;  4H5I A;  2B4E A;  5EMK B;  5I5I A;  2H6K A;  2UZX B;  4J82 A;  3EU7 A;  2IAA A;  4G56 B;  3SCY A;  1ERJ A;  3RN0 D;  3IIY A;  2HYE A;  3W15 A;  4J78 A;  3AH8 B;  3EI1 B;  2OK6 A;  3I7L A;  2H9L A;  4X3E A;  5CXC A;  2Z2O A;  4QRJ A;  5GSA A;  4GQ2 P;  4CI3 A;  2CE9 A;  3SBR A;  2XYI A;  4IA9 A;  3RN1 D;  2G99 A;  3JB9 L;  4CI1 A;  3BG1 A;  2H6Q A;  3F3P A;  2AH0 A;  1QNI A;  2OVQ B;  2AQ5 A;  4OZU A;  3EI2 B;  4JSP C;  3PSL A;  3U4Y A;  4TZ4 A;  3L4O D;  4PBZ A;  4A0A B;  4XYH A;  1GG2 B;  4GGA A;  1SHY B;  4JT5 C;  2YNN A;  3CFV A;  3AL8 B;  2AGX A;  3V5W B;  4HDJ A;  3UVL A;  5HE1 B;  2CO0 C;  2AGY A;  2I3T A;  4ESG A;  3ODT A;  4LG9 A;  4GM8 A;  3EG6 A;  1FWX A;  3UVO A;  3I8C A;  5CXB A;  5EM2 B;  3SJL D;  3I7P A;  3E0C A;  2AGW A;  2AH1 A;  1N6F A;  4I79 A;  4N14 A;  1JOF A;  2P9P C;  3VH0 A;  4FAN D;  2O9K A;  4LGN A;  4A11 B;  1S4U X;  4OWR A;  2QXV A;  3C99 A;  3SMR A;  4NSX A;  2H68 A;  3NVX A;  1PBY B;  5H14 A;  5CXC B;  2PM9 B;  2AGL A;  3I8E A;  4FAV D;  1SQJ A;  4A09 A;  3MXX A;  2HKM A;  4ERZ A;  5EAR A;  3JAM g;  4CZV A;  2HJ4 A;  5AFU 3;  2IUP A;  4U7A A;  3SVW D;  4A0A A;  5B4W A;  4J87 A;  3I7O A;  4CZX A;  4L3G D;  4J86 A;  4D6V A;  3EI4 B;  1N6E A;  5HQG A;  2OJY A;  2I0T A;  5FKT A;  3PSC B;  3UVM A;  1YFQ A;  3CFS B;  1TYQ C;  4FHL A;  1U2V C;  2YBA A;  4ZOX A;  3MKQ A;  1JJU B;  3PXW D;  1L0Q A;  2GC4 A;  2YNP A;  5KDO B;  3I7N A;  3DXK C;  1PGU A;  2HKR A;  2CNX A;  3A0F A;  1K8K C;  5C2V B;  4IMM A;  5IJ7 E;  4A11 A;  3EI3 A;  3CIK B;  5CXB B;  3K27 A;  2PM9 A;  4QT8 A;  2H3X A;  2P9N C;  2B5N A;  3B7F A;  4QQE A;  5CYK A;  2I0S A;  3RFH A;  3F3F A;  3C9C A;  2H9P A;  4PSX B;  5IJ8 E;  2H14 A;  4JD2 C;  5FKS A;  3N0E A;  5H1M A;  4EWR A;  4GQB B;  3BG0 A;  4GGC A;  3MMY A;  3EI4 A;  4A7J A;  3JZH A;  3JZN A;  2QC5 A;  3SN6 B;  4A09 B;  3GRE A;  2H47 A;  4FA5 D;  4X63 B;  4ZN4 A;  5GXI A;  1P22 A;  2YNO A;  3UKU C;  2GC7 A;  2TRC B;  3SLE D;  2HES X;  1B9Y A;  5EAL A;  2HJB A;  3DWL C;  4O3T B;  3P4F A;  1TBG A;  3HFQ A;  2BBK H;  1N6D A;  4BUJ C;  2P9I C;  1NR0 A;  2P9L C;  4J0W A;  4ZOY A;  3SBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...