2MTAH

Crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
373
structure length
373
Chain Sequence
b'QGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFLVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
molecule tags Electron transport
source organism Paracoccus denitrificans
publication title Structure of an electron transfer complex: methylamine dehydrogenase, amicyanin, and cytochrome c551i.
pubmed rcsb
total genus 85
structure length 373
sequence length 373
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2mtaH00
3VGZA 4CZXA 4A0AA 2B5MA 1FWXA 1PEVA 5HQGA 2AQ5A 5C2VB 2CNXA 3IKOA 4QL1A 4X3EA 3MKQA 3C5MA 1XKSA 3OKYB 1OLZA 3I8EA 1JMZB 3BG0A 1K8KC 2P9KC 5TEEA 2H68A 4H5JA 4EWRA 4KFMB 2AGXA 4O45A 3C9CA 2AGWA 2B5LA 5I5MA 4GM3A 3N0EA 3P4FA 3EI1B 3PE7A 2H3XA 4IMMA 4ZN4A 4L3HD 4GGDA 3PXSD 4J77A 2MTAH 4K3ID 5AMSA 1VYHC 1R5MA 2OK4A 3EG6A 5EM2B 4U7AA 2QC5A 2HESX 2P9UC 4GM8A 2P9LC 4YVDA 4A11B 5GMKn 4AOWA 1JMXB 1N6EA 4PC0A 4A0BA 3JB9L 3OKYA 2TRCB 4ES0A 4AEZA 3SCYA 3V5WB 1MDAH 3JROA 3DXKC 2J55H 5AFU3 4L3GD 5C2WB 4IA9A 2I3SA 4FWWA 3W15A 4GGAA 4J78A 5THAA 3VH0A 2AH1A 3I89A 4MK0B 4QRJA 1S4UX 4BUJC 1XIPA 3EI4B 3EI1A 3DXMC 2BBKH 1B9YA 2UZXB 5EALA 3EI3B 2H9PA 4PBYA 3I7NA 3J80g 4JT5C 5CYKB 4CC9A 1GP2B 3E0CA 1TYQC 3SXTD 2YMUA 1XHMA 4GGCA 3JZGA 2YNNA 2Q7QA 4XYIA 3CFVA 3F3GA 3AL8A 3IIYA 3OL2A 1PI6A 5C9ZB 3EI2A 2OVPB 4FHLA 1GOTB 5CYKA 4GQBB 2YBAA 2IUPA 2HKMA 4JT6C 3UR4A 5H14A 3VA6A 1QNIA 5KDOB 3KRWB 5K19A 1SHYB 5EAMA 3J81g 2UZYB 2B5NA 3AL9A 3EI4A 3MMYA 2J56H 5TDHB 3OTTA 2IUQA 3FRXA 3SJLD 4A09B 3RLMD 4JSPC 2IUVA 4X63B 4XYHA 2IWFA 3RN0D 4U1EI 4ERZA 4PSWB 2PBIB 5FLXg 1A0RB 4A2MA 2AGLA 4ZOZA 4D6VA 3CIKB 4CY1A 2GC7A 3ODTA 2P9NC 3RFHA 3OL2B 4ZOYA 4CI1A 3HFQA 3EI2B 3DSMA 5A2Qg 4XEIC 5FKQA 1U2VC 3A0FA 3SWSD 5EAPA 2IURA 3N0DA 5CXBA 5EMKB 4FAND 3C99A 4PSXB 3EMHA 5EARA 4CY3A 2G99A 3B7FA 2YNOA 2H13A 3MKSB 4L9OA 5IJ8E 4TZ4A 5EMMB 4FA9D 4GZ8A 2OVRB 4J87A 2CN2A 5AJAA 4JD2C 1MG2A 2CO0A 5CXBB 5FKTA 4PXWA 2XL2A 2G9AA 3C75H 1SQ9A 3IJ1A 2CE9A 4GMBA 4X60B 1ERJA 5HE0B 3I7HA 4E54B 3OKWA 4O9DA 3JPXA 4J73A 4BL0A 3SBRA 2HYEA 3AFCA 1TBGA 2XU7A 3IJ0A 4PNKB 4J86A 1N6DA 4J8GA 3F3PA 2Z2PA 2H6KA 5FKRA 2OIZA 4UI9R 3CFSB 4JSVC 2PM6B 4CY5A 2H6QA 2J57G 5FA5B 5EMJB 4LG9A 5FQDA 2OK6A 1MG3A 3JAMg 1OMWB 2H6NA 3ZWLB 5CXCA 3K27A 3UVKA 5B4WA 2HKRA 4JSXC 2H9LA 3UVOA 4ZOVA 4CY2A 2GNQA 3I7OA 1PBYB 4J0WA 3RSEC 4CZVA 4H5IA 4O1QD 3OKTA 5IT9g 2O9KA 1P22A 2YB8B 2Z2OA 3MXXA 5H17A 5I5IA 4E54A 2OVQB 3NVXA 3RN1D 4N14A 3I2NA 4JXMA 1K32A 2CN3A 4FA4D 3U4YA 2Z2NA 3L4MD 3NVNA 1L0QA 2AGYA 4JSNC 3RFGA 3UVNA 5IGOA 5FXYA 2PM9A 3SN6B 5IJ7E 2H9NA 2QXVA 2I0TA 3EI3A 3UKUC 4GQ1A 1JJUB 2XL3A 4OWRA 5TEFA 2PM9B 5JWZA 3RMZD 4GQ2P 3I7KA 4QQEA 4Y7RA 1JOFA 1YFQA 5EM2A 4LG8A 4A0AB 2HXCA 5HYNB 3V9FA 2I0SA 3V7DB 5IGQA 4A08A 4NSXA 3I8CA 3UVMA 4D0KA 2P9IC 3JZNA 3JZHA 4A0BB 4I79A 4J81A 3PVUB 2AH0A 4A7JA 3ULEC 3ORVD 3JRPA 4A11A 4X61B 3SBPA 3IJCA 4J0XA 1U4CA 4J84A 1GXRA 2EBSA 2AGZA 2HJBA 2BCJB 5TF2A 4BH6A 3K26A 2H14A 1N6FA 5GXHA 2GC4A 4O3UB 3PXTD 3IIWA 5H1MA 3RRMC 3PSCB 3PSLA 4CI2A 4LGNA 3MZLA 2W18A 2H9MA 3FGBA 4CZYA 2CO0C 4E5ZA 4G56B 1SQJA 3BWSA 4FB1D 2P9PC 3PVWB 2CE8A 3UKRC 2P9SC 1B9XA 1Q47A 4Z8LA 3NVQA 4J8BA 3GREA 4A09A 1PGUA 3SHFA 3DWLC 4FA1D 4K3JB 4FA5D 4ZOXA 5HE2B 5SXMA 3UVLA 2I0RA 2B4EA 3SVWD 2XYIA 2I3TA 3AH8B 5HE1B 2HJ4A 4ERYA 4E5ZB 4CI3A 4QT8A 3SLED 4FAVD 3OW8A 2IAAA 1RI6A 2PM7B 5EMLB 3PXWD 3I7PA 3DM0A 1GG2B 1NEXB 3MZKA 5IC7A 4L1QD 4R7AB 5HE3B 2OJYA 3SBQA 5CXCB 4CI8A 4OZUA 3EU7A 4PBZA 4A08B 4O3TB 3BG1A 5FKSA 3AL8B 3SFZA 3FM0A 4HDJA 1NR0A 3F3FA 2IWKA 2H47A 3GFCA 5K1CC 4ERQA 3EWEA 3L4OD 3KRXB 5GXIA 5I5JA 5GSAA 4J82A 4GM9A 2YNPA 4A2LA 4Y5RD 4J79A 3I7LA 4ESGA 3SMRA
chains in the Genus database with same CATH superfamily
3V4PA 3VGZA 4CZXA 4A0AA 1VE6A 5E6RA 2B5MA 1FWXA 1PEVA 2WQ8A 3T3PA 5HQGA 3ZDZA 4BCDA 2AQ5A 1K3IA 5C2VB 2CNXA 3IKOA 4QL1A 4X3EA 3MKQA 1VE7A 3C5MA 1XKSA 3OKYB 1OLZA 3I8EA 1JMZB 5HDBA 3BG0A 1K8KC 2P9KC 4BP9A 5TEEA 2H68A 4H5JA 4EWRA 4KFMB 2AGXA 4O45A 3C9CA 1H2ZA 2AGWA 2B5LA 5I5MA 4GM3A 3N0EA 3P4FA 3EI1B 3PE7A 2H3XA 4IMMA 5FFOA 4ZN4A 4Z7OA 4L3HD 4GGDA 3PXSD 4J77A 2MTAH 4K3ID 5AMSA 2HU5A 1VYHC 1R5MA 2VDKA 2OK4A 3O4GA 3EG6A 1C9IA 5EM2B 4U7AA 2QC5A 2HESX 2P9UC 4GM8A 2P9LC 4YVDA 4A11B 4UM9A 2VZ1A 4D9SA 5GMKn 4AOWA 1JMXB 1N6EA 4PC0A 1QFSA 4A0BA 3JB9L 2QZPA 1O6FA 3OKYA 2TRCB 4ES0A 4AEZA 3SCYA 3V5WB 1MDAH 1BPOA 3JROA 3DXKC 2VDRA 2J55H 5AFU3 4L3GD 5C2WB 4IA9A 2I3SA 2JKXA 4AX4A 4FWWA 3W15A 4GGAA 4J78A 5THAA 3VH0A 2VC2A 2AH1A 3I89A 4MK0B 4QRJA 1S4UX 4BUJC 1XIPA 3EI4B 3EI1A 3DXMC 2BBKH 1B9YA 2VDLA 2UZXB 2XE4A 5EALA 3EI3B 2H9PA 4PBYA 3I7NA 3J80g 4JT5C 5CYKB 4CC9A 1GOGA 1GP2B 2VDOA 3E0CA 1TYQC 3SXTD 2YMUA 1XHMA 4GGCA 3JZGA 2YNNA 2Q7QA 4XYIA 3EQ9A 3CFVA 3F3GA 2QR5A 1YR2A 3DDUA 3AL8A 3IIYA 3OL2A 3NIDA 1PI6A 5C9ZB 3EI2A 2OVPB 5M5RA 4FHLA 1GOTB 5CYKA 4GQBB 5C92A 4DNUA 2YBAA 2XDWA 2IUPA 4G55A 2HKMA 4JT6C 3UR4A 5H14A 4NAAA 1QNIA 3VA6A 5KDOB 3KRWB 5K19A 1SHYB 4NC4A 5EAMA 3J81g 2UZYB 2B5NA 3AL9A 3EI4A 3MMYA 4Z7QA 2J56H 5TDHB 3OTTA 2IUQA 3FRXA 3ZE0A 3SJLD 4A09B 1H2WA 4JSPC 3RLMD 2IUVA 4G1EA 4X63B 4XYHA 2IWFA 4JHNA 4RE5A 4BP8A 4L1MA 3RN0D 4MMYA 1GOHA 4U1EI 4ERZA 4PSWB 2PBIB 4AN0A 5FLXg 1A0RB 4A2MA 2AGLA 4ZOZA 4D6VA 3CIKB 5M61A 3MVDK 4CY1A 2GC7A 3ODTA 2P9NC 3RFHA 3OL2B 4ZOYA 2VDNA 4CI1A 3HFQA 3EI2B 3DSMA 5A2Qg 4XEIC 5FKQA 1U2VC 3A0FA 3SWSD 3IUJA 4MMXA 4AN1A 1UOOA 5EAPA 3O4HA 2IURA 3N0DA 4O2WA 3IULA 5CXBA 5EMKB 4FAND 3C99A 4G1MA 4PSXB 4O02A 3EMHA 5EARA 4CY3A 2G99A 3B7FA 2YNOA 2H13A 4IRZA 3MKSB 4L9OA 5IJ8E 4TZ4A 5EMMB 4FA9D 1H2XA 4GZ8A 3ZE1A 2OVRB 4J87A 5M5UA 2CN2A 5AJAA 4JD2C 3NIFA 1MG2A 2CO0A 5CXBB 5E6UA 2HU8A 1C9LA 5FKTA 4PXWA 2XL2A 2G9AA 3C75H 1SQ9A 3IJ1A 3ZE2A 1H2YA 2CE9A 2VDQA 3MUNA 4GMBA 4X60B 1ERJA 5HE0B 3I7HA 3O4IA 4E54B 3OKWA 4O9DA 3JPXA 3OF7A 1GOFA 4J73A 4BL0A 3SBRA 2HYEA 2EIBA 3GD1I 1T2XA 3AFCA 4WK4A 1TBGA 2XU7A 3IJ0A 3IVMA 1TYEA 4PNKB 4J86A 1N6DA 4NENA 4J8GA 3F3PA 4BCBA 2Z2PA 2H6KA 5FKRA 2OIZA 4DNWA 4UI9R 3CFSB 4JSVC 4AMYA 2PM6B 4CY5A 5C86A 2H6QA 2EIEA 2J57G 5FA5B 5EMJB 4LG9A 5FQDA 2OK6A 1MG3A 3EQ8A 3JAMg 1OMWB 2H6NA 3ZWLB 5CXCA 3K27A 3UVKA 5B4WA 2HKRA 4JSXC 2H9LA 3UVOA 4ZOVA 4CY2A 2GNQA 4NBMA 4RE6A 3I7OA 1PBYB 4J0WA 3RSEC 4CZVA 1UOQA 4H5IA 4O1QD 5FFGA 3OKTA 5IT9g 4DNVA 2O9KA 1P22A 2YB8B 2Z2OA 3MXXA 5H17A 5I5IA 4E54A 3IURA 4WK0A 2OVQB 3T3MA 3NVXA 3RN1D 3ZDXA 4N14A 2EICA 3I2NA 4JXMA 1K32A 2CN3A 4FA4D 3U4YA 2Z2NA 3L4MD 3NVNA 1L0QA 2AGYA 4JSNC 3RFGA 3UVNA 5IGOA 5FXYA 2PM9A 3SN6B 5IJ7E 2H9NA 2QXVA 2I0TA 3O4JA 3EI3A 3IUNA 3UKUC 4GQ1A 1JJUB 2XL3A 4OWRA 3ZDYA 5TEFA 2PM9B 5JWZA 3RMZD 2VZ3A 4GQ2P 3I7KA 4QQEA 4Y7RA 1JOFA 5M5VA 3K6SA 1YFQA 5EM2A 4LG8A 4A0AB 2HXCA 5HYNB 3V9FA 2I0SA 3V7DB 5IGQA 4A08A 2XZGA 4NSXA 3I8CA 3UVMA 4D0KA 2P9IC 1VZ2A 3JZNA 1JTDB 3JZHA 4A0BB 4I79A 4J81A 5E6SA 3PVUB 2AH0A 4A7JA 3ULEC 3ORVD 4BCCA 3JRPA 4A11A 4JHPC 3NIGA 4X61B 3SBPA 3IJCA 4J0XA 1U4CA 4J84A 1M1XA 1GXRA 2EBSA 2AGZA 2HJBA 3V4VA 2BCJB 2VDMA 4WK2A 1L5GA 5TF2A 4BH6A 1VZ3A 3K26A 2H14A 1N6FA 5GXHA 2GC4A 4O3UB 3PXTD 3IIWA 5M5SA 3EQ7A 4AMZA 1E8NA 5H1MA 4MMZA 3RRMC 3PSCB 3FCSA 1U8CA 3GC3B 3PSLA 4CI2A 4LGNA 3MZLA 2W18A 2H9MA 2VDPA 3FGBA 4CZYA 2CO0C 3MUOA 4G56B 4E5ZA 1O6GA 1SQJA 3BWSA 4FB1D 2P9PC 3PVWB 2CE8A 3UKRC 2P9SC 2HU7A 1B9XA 1Q47A 4Z8LA 3NVQA 4J8BA 4QAMA 3GREA 3K72A 4A09A 1PGUA 3SHFA 3DWLC 4FA1D 4K3JB 4FA5D 4ZOXA 5HE2B 5SXMA 3UVLA 2I0RA 2B4EA 3SVWD 2XYIA 2I3TA 3AH8B 5HE1B 2HJ4A 1E5TA 3KCIA 4ERYA 5M5TA 4E5ZB 4CI3A 4QT8A 4Z7NA 3IJEA 1QFMA 3SLED 4FAVD 3OW8A 1A12A 2IAAA 1RI6A 2PM7B 1JV2A 5EMLB 2BKLA 3PXWD 3I7PA 3DM0A 1GG2B 1NEXB 3MZKA 5IC7A 4L1QD 4R7AB 5HE3B 1UOPA 2OJYA 4WJKA 3SBQA 5CXCB 4CI8A 4OZUA 3EU7A 4PBZA 2EIDA 4A08B 4O3TB 3BG1A 5FKSA 3K71A 3AL8B 1I2MB 3SFZA 3FM0A 4HDJA 1NR0A 3F3FA 2IWKA 2H47A 4UM8A 3GFCA 3QI0A 5K1CC 1UTCA 4ERQA 3EWEA 3IUQA 3L4OD 3KRXB 5GXIA 5I5JA 3VI4A 3FCUA 5GSAA 4J82A 3QHYB 4GM9A 2YNPA 4A2LA 4Y5RD 3IUMA 4J79A 3VI3A 1E8MA 3I7LA 4ESGA 3SMRA
chains in the Genus database with same CATH topology
3VGZA 4CZXA 4A0AA 2B5MA 1FWXA 1PEVA 5HQGA 2AQ5A 5C2VB 2CNXA 3IKOA 4QL1A 4X3EA 3MKQA 3C5MA 1XKSA 3OKYB 1OLZA 3I8EA 1JMZB 3BG0A 1K8KC 2P9KC 5TEEA 2H68A 4H5JA 4EWRA 4KFMB 2AGXA 4O45A 3C9CA 2AGWA 2B5LA 5I5MA 4GM3A 3N0EA 3P4FA 3EI1B 3PE7A 2H3XA 4IMMA 4ZN4A 4L3HD 4GGDA 3PXSD 4J77A 2MTAH 4K3ID 5AMSA 1VYHC 1R5MA 2OK4A 3EG6A 5EM2B 4U7AA 2QC5A 2HESX 2P9UC 4GM8A 2P9LC 4YVDA 4A11B 5GMKn 4AOWA 1JMXB 1N6EA 4PC0A 4A0BA 3JB9L 3OKYA 2TRCB 4ES0A 4AEZA 3SCYA 3V5WB 1MDAH 3JROA 3DXKC 2J55H 5AFU3 4L3GD 5C2WB 4IA9A 2I3SA 4FWWA 3W15A 4GGAA 4J78A 5THAA 3VH0A 2AH1A 3I89A 4MK0B 4QRJA 1S4UX 4BUJC 1XIPA 3EI4B 3EI1A 3DXMC 2BBKH 1B9YA 2UZXB 5EALA 3EI3B 2H9PA 4PBYA 3I7NA 3J80g 4JT5C 5CYKB 4CC9A 1GP2B 3E0CA 1TYQC 3SXTD 2YMUA 1XHMA 4GGCA 3JZGA 2YNNA 2Q7QA 4XYIA 3CFVA 3F3GA 3AL8A 3IIYA 3OL2A 1PI6A 5C9ZB 3EI2A 2OVPB 4FHLA 1GOTB 5CYKA 4GQBB 2YBAA 2IUPA 2HKMA 4JT6C 3UR4A 5H14A 3VA6A 1QNIA 5KDOB 3KRWB 5K19A 1SHYB 5EAMA 3J81g 2UZYB 2B5NA 3AL9A 3EI4A 3MMYA 2J56H 5TDHB 3OTTA 2IUQA 3FRXA 3SJLD 4A09B 3RLMD 4JSPC 2IUVA 4X63B 4XYHA 2IWFA 3RN0D 4U1EI 4ERZA 4PSWB 2PBIB 5FLXg 1A0RB 4A2MA 2AGLA 4ZOZA 4D6VA 3CIKB 4CY1A 2GC7A 3ODTA 2P9NC 3RFHA 3OL2B 4ZOYA 4CI1A 3HFQA 3EI2B 3DSMA 5A2Qg 4XEIC 5FKQA 1U2VC 3A0FA 3SWSD 5EAPA 2IURA 3N0DA 5CXBA 5EMKB 4FAND 3C99A 4PSXB 3EMHA 5EARA 4CY3A 2G99A 3B7FA 2YNOA 2H13A 3MKSB 4L9OA 5IJ8E 4TZ4A 5EMMB 4FA9D 4GZ8A 2OVRB 4J87A 2CN2A 5AJAA 4JD2C 1MG2A 2CO0A 5CXBB 5FKTA 4PXWA 2XL2A 2G9AA 3C75H 1SQ9A 3IJ1A 2CE9A 4GMBA 4X60B 1ERJA 5HE0B 3I7HA 4E54B 3OKWA 4O9DA 3JPXA 4J73A 4BL0A 3SBRA 2HYEA 3AFCA 1TBGA 2XU7A 3IJ0A 4PNKB 4J86A 1N6DA 4J8GA 3F3PA 2Z2PA 2H6KA 5FKRA 2OIZA 4UI9R 3CFSB 4JSVC 2PM6B 4CY5A 2H6QA 2J57G 5FA5B 5EMJB 4LG9A 5FQDA 2OK6A 1MG3A 3JAMg 1OMWB 2H6NA 3ZWLB 5CXCA 3K27A 3UVKA 5B4WA 2HKRA 4JSXC 2H9LA 3UVOA 4ZOVA 4CY2A 2GNQA 3I7OA 1PBYB 4J0WA 3RSEC 4CZVA 4H5IA 4O1QD 3OKTA 5IT9g 2O9KA 1P22A 2YB8B 2Z2OA 3MXXA 5H17A 5I5IA 4E54A 2OVQB 3NVXA 3RN1D 4N14A 3I2NA 4JXMA 1K32A 2CN3A 4FA4D 3U4YA 2Z2NA 3L4MD 3NVNA 1L0QA 2AGYA 4JSNC 3RFGA 3UVNA 5IGOA 5FXYA 2PM9A 3SN6B 5IJ7E 2H9NA 2QXVA 2I0TA 3EI3A 3UKUC 4GQ1A 1JJUB 2XL3A 4OWRA 5TEFA 2PM9B 5JWZA 3RMZD 4GQ2P 3I7KA 4QQEA 4Y7RA 1JOFA 1YFQA 5EM2A 4LG8A 4A0AB 2HXCA 5HYNB 3V9FA 2I0SA 3V7DB 5IGQA 4A08A 4NSXA 3I8CA 3UVMA 4D0KA 2P9IC 3JZNA 3JZHA 4A0BB 4I79A 4J81A 3PVUB 2AH0A 4A7JA 3ULEC 3ORVD 3JRPA 4A11A 4X61B 3SBPA 3IJCA 4J0XA 1U4CA 4J84A 1GXRA 2EBSA 2AGZA 2HJBA 2BCJB 5TF2A 4BH6A 3K26A 2H14A 1N6FA 5GXHA 2GC4A 4O3UB 3PXTD 3IIWA 5H1MA 3RRMC 3PSCB 3PSLA 4CI2A 4LGNA 3MZLA 2W18A 2H9MA 3FGBA 4CZYA 2CO0C 4E5ZA 4G56B 1SQJA 3BWSA 4FB1D 2P9PC 3PVWB 2CE8A 3UKRC 2P9SC 1B9XA 1Q47A 4Z8LA 3NVQA 4J8BA 3GREA 4A09A 1PGUA 3SHFA 3DWLC 4FA1D 4K3JB 4FA5D 4ZOXA 5HE2B 5SXMA 3UVLA 2I0RA 2B4EA 3SVWD 2XYIA 2I3TA 3AH8B 5HE1B 2HJ4A 4ERYA 4E5ZB 4CI3A 4QT8A 3SLED 4FAVD 3OW8A 2IAAA 1RI6A 2PM7B 5EMLB 3PXWD 3I7PA 3DM0A 1GG2B 1NEXB 3MZKA 5IC7A 4L1QD 4R7AB 5HE3B 2OJYA 3SBQA 5CXCB 4CI8A 4OZUA 3EU7A 4PBZA 4A08B 4O3TB 3BG1A 5FKSA 3AL8B 3SFZA 3FM0A 4HDJA 1NR0A 3F3FA 2IWKA 2H47A 3GFCA 5K1CC 4ERQA 3EWEA 3L4OD 3KRXB 5GXIA 5I5JA 5GSAA 4J82A 4GM9A 2YNPA 4A2LA 4Y5RD 4J79A 3I7LA 4ESGA 3SMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGZ A;  4CZX A;  4A0A A;  2B5M A;  1FWX A;  1PEV A;  5HQG A;  2AQ5 A;  5C2V B;  2CNX A;  3IKO A;  4QL1 A;  4X3E A;  3MKQ A;  3C5M A;  1XKS A;  3OKY B;  1OLZ A;  3I8E A;  1JMZ B;  3BG0 A;  1K8K C;  2P9K C;  5TEE A;  2H68 A;  4H5J A;  4EWR A;  4KFM B;  2AGX A;  4O45 A;  3C9C A;  2AGW A;  2B5L A;  5I5M A;  4GM3 A;  3N0E A;  3P4F A;  3EI1 B;  3PE7 A;  2H3X A;  4IMM A;  4ZN4 A;  4L3H D;  4GGD A;  3PXS D;  4J77 A;  2MTA H;  4K3I D;  5AMS A;  1VYH C;  1R5M A;  2OK4 A;  3EG6 A;  5EM2 B;  4U7A A;  2QC5 A;  2HES X;  2P9U C;  4GM8 A;  2P9L C;  4YVD A;  4A11 B;  5GMK n;  4AOW A;  1JMX B;  1N6E A;  4PC0 A;  4A0B A;  3JB9 L;  3OKY A;  2TRC B;  4ES0 A;  4AEZ A;  3SCY A;  3V5W B;  1MDA H;  3JRO A;  3DXK C;  2J55 H;  5AFU 3;  4L3G D;  5C2W B;  4IA9 A;  2I3S A;  4FWW A;  3W15 A;  4GGA A;  4J78 A;  5THA A;  3VH0 A;  2AH1 A;  3I89 A;  4MK0 B;  4QRJ A;  1S4U X;  4BUJ C;  1XIP A;  3EI4 B;  3EI1 A;  3DXM C;  2BBK H;  1B9Y A;  2UZX B;  5EAL A;  3EI3 B;  2H9P A;  4PBY A;  3I7N A;  3J80 g;  4JT5 C;  5CYK B;  4CC9 A;  1GP2 B;  3E0C A;  1TYQ C;  3SXT D;  2YMU A;  1XHM A;  4GGC A;  3JZG A;  2YNN A;  2Q7Q A;  4XYI A;  3CFV A;  3F3G A;  3AL8 A;  3IIY A;  3OL2 A;  1PI6 A;  5C9Z B;  3EI2 A;  2OVP B;  4FHL A;  1GOT B;  5CYK A;  4GQB B;  2YBA A;  2IUP A;  2HKM A;  4JT6 C;  3UR4 A;  5H14 A;  3VA6 A;  1QNI A;  5KDO B;  3KRW B;  5K19 A;  1SHY B;  5EAM A;  3J81 g;  2UZY B;  2B5N A;  3AL9 A;  3EI4 A;  3MMY A;  2J56 H;  5TDH B;  3OTT A;  2IUQ A;  3FRX A;  3SJL D;  4A09 B;  3RLM D;  4JSP C;  2IUV A;  4X63 B;  4XYH A;  2IWF A;  3RN0 D;  4U1E I;  4ERZ A;  4PSW B;  2PBI B;  5FLX g;  1A0R B;  4A2M A;  2AGL A;  4ZOZ A;  4D6V A;  3CIK B;  4CY1 A;  2GC7 A;  3ODT A;  2P9N C;  3RFH A;  3OL2 B;  4ZOY A;  4CI1 A;  3HFQ A;  3EI2 B;  3DSM A;  5A2Q g;  4XEI C;  5FKQ A;  1U2V C;  3A0F A;  3SWS D;  5EAP A;  2IUR A;  3N0D A;  5CXB A;  5EMK B;  4FAN D;  3C99 A;  4PSX B;  3EMH A;  5EAR A;  4CY3 A;  2G99 A;  3B7F A;  2YNO A;  2H13 A;  3MKS B;  4L9O A;  5IJ8 E;  4TZ4 A;  5EMM B;  4FA9 D;  4GZ8 A;  2OVR B;  4J87 A;  2CN2 A;  5AJA A;  4JD2 C;  1MG2 A;  2CO0 A;  5CXB B;  5FKT A;  4PXW A;  2XL2 A;  2G9A A;  3C75 H;  1SQ9 A;  3IJ1 A;  2CE9 A;  4GMB A;  4X60 B;  1ERJ A;  5HE0 B;  3I7H A;  4E54 B;  3OKW A;  4O9D A;  3JPX A;  4J73 A;  4BL0 A;  3SBR A;  2HYE A;  3AFC A;  1TBG A;  2XU7 A;  3IJ0 A;  4PNK B;  4J86 A;  1N6D A;  4J8G A;  3F3P A;  2Z2P A;  2H6K A;  5FKR A;  2OIZ A;  4UI9 R;  3CFS B;  4JSV C;  2PM6 B;  4CY5 A;  2H6Q A;  2J57 G;  5FA5 B;  5EMJ B;  4LG9 A;  5FQD A;  2OK6 A;  1MG3 A;  3JAM g;  1OMW B;  2H6N A;  3ZWL B;  5CXC A;  3K27 A;  3UVK A;  5B4W A;  2HKR A;  4JSX C;  2H9L A;  3UVO A;  4ZOV A;  4CY2 A;  2GNQ A;  3I7O A;  1PBY B;  4J0W A;  3RSE C;  4CZV A;  4H5I A;  4O1Q D;  3OKT A;  5IT9 g;  2O9K A;  1P22 A;  2YB8 B;  2Z2O A;  3MXX A;  5H17 A;  5I5I A;  4E54 A;  2OVQ B;  3NVX A;  3RN1 D;  4N14 A;  3I2N A;  4JXM A;  1K32 A;  2CN3 A;  4FA4 D;  3U4Y A;  2Z2N A;  3L4M D;  3NVN A;  1L0Q A;  2AGY A;  4JSN C;  3RFG A;  3UVN A;  5IGO A;  5FXY A;  2PM9 A;  3SN6 B;  5IJ7 E;  2H9N A;  2QXV A;  2I0T A;  3EI3 A;  3UKU C;  4GQ1 A;  1JJU B;  2XL3 A;  4OWR A;  5TEF A;  2PM9 B;  5JWZ A;  3RMZ D;  4GQ2 P;  3I7K A;  4QQE A;  4Y7R A;  1JOF A;  1YFQ A;  5EM2 A;  4LG8 A;  4A0A B;  2HXC A;  5HYN B;  3V9F A;  2I0S A;  3V7D B;  5IGQ A;  4A08 A;  4NSX A;  3I8C A;  3UVM A;  4D0K A;  2P9I C;  3JZN A;  3JZH A;  4A0B B;  4I79 A;  4J81 A;  3PVU B;  2AH0 A;  4A7J A;  3ULE C;  3ORV D;  3JRP A;  4A11 A;  4X61 B;  3SBP A;  3IJC A;  4J0X A;  1U4C A;  4J84 A;  1GXR A;  2EBS A;  2AGZ A;  2HJB A;  2BCJ B;  5TF2 A;  4BH6 A;  3K26 A;  2H14 A;  1N6F A;  5GXH A;  2GC4 A;  4O3U B;  3PXT D;  3IIW A;  5H1M A;  3RRM C;  3PSC B;  3PSL A;  4CI2 A;  4LGN A;  3MZL A;  2W18 A;  2H9M A;  3FGB A;  4CZY A;  2CO0 C;  4E5Z A;  4G56 B;  1SQJ A;  3BWS A;  4FB1 D;  2P9P C;  3PVW B;  2CE8 A;  3UKR C;  2P9S C;  1B9X A;  1Q47 A;  4Z8L A;  3NVQ A;  4J8B A;  3GRE A;  4A09 A;  1PGU A;  3SHF A;  3DWL C;  4FA1 D;  4K3J B;  4FA5 D;  4ZOX A;  5HE2 B;  5SXM A;  3UVL A;  2I0R A;  2B4E A;  3SVW D;  2XYI A;  2I3T A;  3AH8 B;  5HE1 B;  2HJ4 A;  4ERY A;  4E5Z B;  4CI3 A;  4QT8 A;  3SLE D;  4FAV D;  3OW8 A;  2IAA A;  1RI6 A;  2PM7 B;  5EML B;  3PXW D;  3I7P A;  3DM0 A;  1GG2 B;  1NEX B;  3MZK A;  5IC7 A;  4L1Q D;  4R7A B;  5HE3 B;  2OJY A;  3SBQ A;  5CXC B;  4CI8 A;  4OZU A;  3EU7 A;  4PBZ A;  4A08 B;  4O3T B;  3BG1 A;  5FKS A;  3AL8 B;  3SFZ A;  3FM0 A;  4HDJ A;  1NR0 A;  3F3F A;  2IWK A;  2H47 A;  3GFC A;  5K1C C;  4ERQ A;  3EWE A;  3L4O D;  3KRX B;  5GXI A;  5I5J A;  5GSA A;  4J82 A;  4GM9 A;  2YNP A;  4A2L A;  4Y5R D;  4J79 A;  3I7L A;  4ESG A;  3SMR A; 
#chains in the Genus database with same CATH topology
 3V4P A;  3VGZ A;  4CZX A;  4A0A A;  1VE6 A;  5E6R A;  2B5M A;  1FWX A;  1PEV A;  2WQ8 A;  3T3P A;  5HQG A;  3ZDZ A;  4BCD A;  2AQ5 A;  1K3I A;  5C2V B;  2CNX A;  3IKO A;  4QL1 A;  4X3E A;  3MKQ A;  1VE7 A;  3C5M A;  1XKS A;  3OKY B;  1OLZ A;  3I8E A;  1JMZ B;  5HDB A;  3BG0 A;  1K8K C;  2P9K C;  4BP9 A;  5TEE A;  2H68 A;  4H5J A;  4EWR A;  4KFM B;  2AGX A;  4O45 A;  3C9C A;  1H2Z A;  2AGW A;  2B5L A;  5I5M A;  4GM3 A;  3N0E A;  3P4F A;  3EI1 B;  3PE7 A;  2H3X A;  4IMM A;  5FFO A;  4ZN4 A;  4Z7O A;  4L3H D;  4GGD A;  3PXS D;  4J77 A;  2MTA H;  4K3I D;  5AMS A;  2HU5 A;  1VYH C;  1R5M A;  2VDK A;  2OK4 A;  3O4G A;  3EG6 A;  1C9I A;  5EM2 B;  4U7A A;  2QC5 A;  2HES X;  2P9U C;  4GM8 A;  2P9L C;  4YVD A;  4A11 B;  4UM9 A;  2VZ1 A;  4D9S A;  5GMK n;  4AOW A;  1JMX B;  1N6E A;  4PC0 A;  1QFS A;  4A0B A;  3JB9 L;  2QZP A;  1O6F A;  3OKY A;  2TRC B;  4ES0 A;  4AEZ A;  3SCY A;  3V5W B;  1MDA H;  1BPO A;  3JRO A;  3DXK C;  2VDR A;  2J55 H;  5AFU 3;  4L3G D;  5C2W B;  4IA9 A;  2I3S A;  2JKX A;  4AX4 A;  4FWW A;  3W15 A;  4GGA A;  4J78 A;  5THA A;  3VH0 A;  2VC2 A;  2AH1 A;  3I89 A;  4MK0 B;  4QRJ A;  1S4U X;  4BUJ C;  1XIP A;  3EI4 B;  3EI1 A;  3DXM C;  2BBK H;  1B9Y A;  2VDL A;  2UZX B;  2XE4 A;  5EAL A;  3EI3 B;  2H9P A;  4PBY A;  3I7N A;  3J80 g;  4JT5 C;  5CYK B;  4CC9 A;  1GOG A;  1GP2 B;  2VDO A;  3E0C A;  1TYQ C;  3SXT D;  2YMU A;  1XHM A;  4GGC A;  3JZG A;  2YNN A;  2Q7Q A;  4XYI A;  3EQ9 A;  3CFV A;  3F3G A;  2QR5 A;  1YR2 A;  3DDU A;  3AL8 A;  3IIY A;  3OL2 A;  3NID A;  1PI6 A;  5C9Z B;  3EI2 A;  2OVP B;  5M5R A;  4FHL A;  1GOT B;  5CYK A;  4GQB B;  5C92 A;  4DNU A;  2YBA A;  2XDW A;  2IUP A;  4G55 A;  2HKM A;  4JT6 C;  3UR4 A;  5H14 A;  4NAA A;  1QNI A;  3VA6 A;  5KDO B;  3KRW B;  5K19 A;  1SHY B;  4NC4 A;  5EAM A;  3J81 g;  2UZY B;  2B5N A;  3AL9 A;  3EI4 A;  3MMY A;  4Z7Q A;  2J56 H;  5TDH B;  3OTT A;  2IUQ A;  3FRX A;  3ZE0 A;  3SJL D;  4A09 B;  1H2W A;  4JSP C;  3RLM D;  2IUV A;  4G1E A;  4X63 B;  4XYH A;  2IWF A;  4JHN A;  4RE5 A;  4BP8 A;  4L1M A;  3RN0 D;  4MMY A;  1GOH A;  4U1E I;  4ERZ A;  4PSW B;  2PBI B;  4AN0 A;  5FLX g;  1A0R B;  4A2M A;  2AGL A;  4ZOZ A;  4D6V A;  3CIK B;  5M61 A;  3MVD K;  4CY1 A;  2GC7 A;  3ODT A;  2P9N C;  3RFH A;  3OL2 B;  4ZOY A;  2VDN A;  4CI1 A;  3HFQ A;  3EI2 B;  3DSM A;  5A2Q g;  4XEI C;  5FKQ A;  1U2V C;  3A0F A;  3SWS D;  3IUJ A;  4MMX A;  4AN1 A;  1UOO A;  5EAP A;  3O4H A;  2IUR A;  3N0D A;  4O2W A;  3IUL A;  5CXB A;  5EMK B;  4FAN D;  3C99 A;  4G1M A;  4PSX B;  4O02 A;  3EMH A;  5EAR A;  4CY3 A;  2G99 A;  3B7F A;  2YNO A;  2H13 A;  4IRZ A;  3MKS B;  4L9O A;  5IJ8 E;  4TZ4 A;  5EMM B;  4FA9 D;  1H2X A;  4GZ8 A;  3ZE1 A;  2OVR B;  4J87 A;  5M5U A;  2CN2 A;  5AJA A;  4JD2 C;  3NIF A;  1MG2 A;  2CO0 A;  5CXB B;  5E6U A;  2HU8 A;  1C9L A;  5FKT A;  4PXW A;  2XL2 A;  2G9A A;  3C75 H;  1SQ9 A;  3IJ1 A;  3ZE2 A;  1H2Y A;  2CE9 A;  2VDQ A;  3MUN A;  4GMB A;  4X60 B;  1ERJ A;  5HE0 B;  3I7H A;  3O4I A;  4E54 B;  3OKW A;  4O9D A;  3JPX A;  3OF7 A;  1GOF A;  4J73 A;  4BL0 A;  3SBR A;  2HYE A;  2EIB A;  3GD1 I;  1T2X A;  3AFC A;  4WK4 A;  1TBG A;  2XU7 A;  3IJ0 A;  3IVM A;  1TYE A;  4PNK B;  4J86 A;  1N6D A;  4NEN A;  4J8G A;  3F3P A;  4BCB A;  2Z2P A;  2H6K A;  5FKR A;  2OIZ A;  4DNW A;  4UI9 R;  3CFS B;  4JSV C;  4AMY A;  2PM6 B;  4CY5 A;  5C86 A;  2H6Q A;  2EIE A;  2J57 G;  5FA5 B;  5EMJ B;  4LG9 A;  5FQD A;  2OK6 A;  1MG3 A;  3EQ8 A;  3JAM g;  1OMW B;  2H6N A;  3ZWL B;  5CXC A;  3K27 A;  3UVK A;  5B4W A;  2HKR A;  4JSX C;  2H9L A;  3UVO A;  4ZOV A;  4CY2 A;  2GNQ A;  4NBM A;  4RE6 A;  3I7O A;  1PBY B;  4J0W A;  3RSE C;  4CZV A;  1UOQ A;  4H5I A;  4O1Q D;  5FFG A;  3OKT A;  5IT9 g;  4DNV A;  2O9K A;  1P22 A;  2YB8 B;  2Z2O A;  3MXX A;  5H17 A;  5I5I A;  4E54 A;  3IUR A;  4WK0 A;  2OVQ B;  3T3M A;  3NVX A;  3RN1 D;  3ZDX A;  4N14 A;  2EIC A;  3I2N A;  4JXM A;  1K32 A;  2CN3 A;  4FA4 D;  3U4Y A;  2Z2N A;  3L4M D;  3NVN A;  1L0Q A;  2AGY A;  4JSN C;  3RFG A;  3UVN A;  5IGO A;  5FXY A;  2PM9 A;  3SN6 B;  5IJ7 E;  2H9N A;  2QXV A;  2I0T A;  3O4J A;  3EI3 A;  3IUN A;  3UKU C;  4GQ1 A;  1JJU B;  2XL3 A;  4OWR A;  3ZDY A;  5TEF A;  2PM9 B;  5JWZ A;  3RMZ D;  2VZ3 A;  4GQ2 P;  3I7K A;  4QQE A;  4Y7R A;  1JOF A;  5M5V A;  3K6S A;  1YFQ A;  5EM2 A;  4LG8 A;  4A0A B;  2HXC A;  5HYN B;  3V9F A;  2I0S A;  3V7D B;  5IGQ A;  4A08 A;  2XZG A;  4NSX A;  3I8C A;  3UVM A;  4D0K A;  2P9I C;  1VZ2 A;  3JZN A;  1JTD B;  3JZH A;  4A0B B;  4I79 A;  4J81 A;  5E6S A;  3PVU B;  2AH0 A;  4A7J A;  3ULE C;  3ORV D;  4BCC A;  3JRP A;  4A11 A;  4JHP C;  3NIG A;  4X61 B;  3SBP A;  3IJC A;  4J0X A;  1U4C A;  4J84 A;  1M1X A;  1GXR A;  2EBS A;  2AGZ A;  2HJB A;  3V4V A;  2BCJ B;  2VDM A;  4WK2 A;  1L5G A;  5TF2 A;  4BH6 A;  1VZ3 A;  3K26 A;  2H14 A;  1N6F A;  5GXH A;  2GC4 A;  4O3U B;  3PXT D;  3IIW A;  5M5S A;  3EQ7 A;  4AMZ A;  1E8N A;  5H1M A;  4MMZ A;  3RRM C;  3PSC B;  3FCS A;  1U8C A;  3GC3 B;  3PSL A;  4CI2 A;  4LGN A;  3MZL A;  2W18 A;  2H9M A;  2VDP A;  3FGB A;  4CZY A;  2CO0 C;  3MUO A;  4G56 B;  4E5Z A;  1O6G A;  1SQJ A;  3BWS A;  4FB1 D;  2P9P C;  3PVW B;  2CE8 A;  3UKR C;  2P9S C;  2HU7 A;  1B9X A;  1Q47 A;  4Z8L A;  3NVQ A;  4J8B A;  4QAM A;  3GRE A;  3K72 A;  4A09 A;  1PGU A;  3SHF A;  3DWL C;  4FA1 D;  4K3J B;  4FA5 D;  4ZOX A;  5HE2 B;  5SXM A;  3UVL A;  2I0R A;  2B4E A;  3SVW D;  2XYI A;  2I3T A;  3AH8 B;  5HE1 B;  2HJ4 A;  1E5T A;  3KCI A;  4ERY A;  5M5T A;  4E5Z B;  4CI3 A;  4QT8 A;  4Z7N A;  3IJE A;  1QFM A;  3SLE D;  4FAV D;  3OW8 A;  1A12 A;  2IAA A;  1RI6 A;  2PM7 B;  1JV2 A;  5EML B;  2BKL A;  3PXW D;  3I7P A;  3DM0 A;  1GG2 B;  1NEX B;  3MZK A;  5IC7 A;  4L1Q D;  4R7A B;  5HE3 B;  1UOP A;  2OJY A;  4WJK A;  3SBQ A;  5CXC B;  4CI8 A;  4OZU A;  3EU7 A;  4PBZ A;  2EID A;  4A08 B;  4O3T B;  3BG1 A;  5FKS A;  3K71 A;  3AL8 B;  1I2M B;  3SFZ A;  3FM0 A;  4HDJ A;  1NR0 A;  3F3F A;  2IWK A;  2H47 A;  4UM8 A;  3GFC A;  3QI0 A;  5K1C C;  1UTC A;  4ERQ A;  3EWE A;  3IUQ A;  3L4O D;  3KRX B;  5GXI A;  5I5J A;  3VI4 A;  3FCU A;  5GSA A;  4J82 A;  3QHY B;  4GM9 A;  2YNP A;  4A2L A;  4Y5R D;  3IUM A;  4J79 A;  3VI3 A;  1E8M A;  3I7L A;  4ESG A;  3SMR A; 
#chains in the Genus database with same CATH homology
 3VGZ A;  4CZX A;  4A0A A;  2B5M A;  1FWX A;  1PEV A;  5HQG A;  2AQ5 A;  5C2V B;  2CNX A;  3IKO A;  4QL1 A;  4X3E A;  3MKQ A;  3C5M A;  1XKS A;  3OKY B;  1OLZ A;  3I8E A;  1JMZ B;  3BG0 A;  1K8K C;  2P9K C;  5TEE A;  2H68 A;  4H5J A;  4EWR A;  4KFM B;  2AGX A;  4O45 A;  3C9C A;  2AGW A;  2B5L A;  5I5M A;  4GM3 A;  3N0E A;  3P4F A;  3EI1 B;  3PE7 A;  2H3X A;  4IMM A;  4ZN4 A;  4L3H D;  4GGD A;  3PXS D;  4J77 A;  2MTA H;  4K3I D;  5AMS A;  1VYH C;  1R5M A;  2OK4 A;  3EG6 A;  5EM2 B;  4U7A A;  2QC5 A;  2HES X;  2P9U C;  4GM8 A;  2P9L C;  4YVD A;  4A11 B;  5GMK n;  4AOW A;  1JMX B;  1N6E A;  4PC0 A;  4A0B A;  3JB9 L;  3OKY A;  2TRC B;  4ES0 A;  4AEZ A;  3SCY A;  3V5W B;  1MDA H;  3JRO A;  3DXK C;  2J55 H;  5AFU 3;  4L3G D;  5C2W B;  4IA9 A;  2I3S A;  4FWW A;  3W15 A;  4GGA A;  4J78 A;  5THA A;  3VH0 A;  2AH1 A;  3I89 A;  4MK0 B;  4QRJ A;  1S4U X;  4BUJ C;  1XIP A;  3EI4 B;  3EI1 A;  3DXM C;  2BBK H;  1B9Y A;  2UZX B;  5EAL A;  3EI3 B;  2H9P A;  4PBY A;  3I7N A;  3J80 g;  4JT5 C;  5CYK B;  4CC9 A;  1GP2 B;  3E0C A;  1TYQ C;  3SXT D;  2YMU A;  1XHM A;  4GGC A;  3JZG A;  2YNN A;  2Q7Q A;  4XYI A;  3CFV A;  3F3G A;  3AL8 A;  3IIY A;  3OL2 A;  1PI6 A;  5C9Z B;  3EI2 A;  2OVP B;  4FHL A;  1GOT B;  5CYK A;  4GQB B;  2YBA A;  2IUP A;  2HKM A;  4JT6 C;  3UR4 A;  5H14 A;  3VA6 A;  1QNI A;  5KDO B;  3KRW B;  5K19 A;  1SHY B;  5EAM A;  3J81 g;  2UZY B;  2B5N A;  3AL9 A;  3EI4 A;  3MMY A;  2J56 H;  5TDH B;  3OTT A;  2IUQ A;  3FRX A;  3SJL D;  4A09 B;  3RLM D;  4JSP C;  2IUV A;  4X63 B;  4XYH A;  2IWF A;  3RN0 D;  4U1E I;  4ERZ A;  4PSW B;  2PBI B;  5FLX g;  1A0R B;  4A2M A;  2AGL A;  4ZOZ A;  4D6V A;  3CIK B;  4CY1 A;  2GC7 A;  3ODT A;  2P9N C;  3RFH A;  3OL2 B;  4ZOY A;  4CI1 A;  3HFQ A;  3EI2 B;  3DSM A;  5A2Q g;  4XEI C;  5FKQ A;  1U2V C;  3A0F A;  3SWS D;  5EAP A;  2IUR A;  3N0D A;  5CXB A;  5EMK B;  4FAN D;  3C99 A;  4PSX B;  3EMH A;  5EAR A;  4CY3 A;  2G99 A;  3B7F A;  2YNO A;  2H13 A;  3MKS B;  4L9O A;  5IJ8 E;  4TZ4 A;  5EMM B;  4FA9 D;  4GZ8 A;  2OVR B;  4J87 A;  2CN2 A;  5AJA A;  4JD2 C;  1MG2 A;  2CO0 A;  5CXB B;  5FKT A;  4PXW A;  2XL2 A;  2G9A A;  3C75 H;  1SQ9 A;  3IJ1 A;  2CE9 A;  4GMB A;  4X60 B;  1ERJ A;  5HE0 B;  3I7H A;  4E54 B;  3OKW A;  4O9D A;  3JPX A;  4J73 A;  4BL0 A;  3SBR A;  2HYE A;  3AFC A;  1TBG A;  2XU7 A;  3IJ0 A;  4PNK B;  4J86 A;  1N6D A;  4J8G A;  3F3P A;  2Z2P A;  2H6K A;  5FKR A;  2OIZ A;  4UI9 R;  3CFS B;  4JSV C;  2PM6 B;  4CY5 A;  2H6Q A;  2J57 G;  5FA5 B;  5EMJ B;  4LG9 A;  5FQD A;  2OK6 A;  1MG3 A;  3JAM g;  1OMW B;  2H6N A;  3ZWL B;  5CXC A;  3K27 A;  3UVK A;  5B4W A;  2HKR A;  4JSX C;  2H9L A;  3UVO A;  4ZOV A;  4CY2 A;  2GNQ A;  3I7O A;  1PBY B;  4J0W A;  3RSE C;  4CZV A;  4H5I A;  4O1Q D;  3OKT A;  5IT9 g;  2O9K A;  1P22 A;  2YB8 B;  2Z2O A;  3MXX A;  5H17 A;  5I5I A;  4E54 A;  2OVQ B;  3NVX A;  3RN1 D;  4N14 A;  3I2N A;  4JXM A;  1K32 A;  2CN3 A;  4FA4 D;  3U4Y A;  2Z2N A;  3L4M D;  3NVN A;  1L0Q A;  2AGY A;  4JSN C;  3RFG A;  3UVN A;  5IGO A;  5FXY A;  2PM9 A;  3SN6 B;  5IJ7 E;  2H9N A;  2QXV A;  2I0T A;  3EI3 A;  3UKU C;  4GQ1 A;  1JJU B;  2XL3 A;  4OWR A;  5TEF A;  2PM9 B;  5JWZ A;  3RMZ D;  4GQ2 P;  3I7K A;  4QQE A;  4Y7R A;  1JOF A;  1YFQ A;  5EM2 A;  4LG8 A;  4A0A B;  2HXC A;  5HYN B;  3V9F A;  2I0S A;  3V7D B;  5IGQ A;  4A08 A;  4NSX A;  3I8C A;  3UVM A;  4D0K A;  2P9I C;  3JZN A;  3JZH A;  4A0B B;  4I79 A;  4J81 A;  3PVU B;  2AH0 A;  4A7J A;  3ULE C;  3ORV D;  3JRP A;  4A11 A;  4X61 B;  3SBP A;  3IJC A;  4J0X A;  1U4C A;  4J84 A;  1GXR A;  2EBS A;  2AGZ A;  2HJB A;  2BCJ B;  5TF2 A;  4BH6 A;  3K26 A;  2H14 A;  1N6F A;  5GXH A;  2GC4 A;  4O3U B;  3PXT D;  3IIW A;  5H1M A;  3RRM C;  3PSC B;  3PSL A;  4CI2 A;  4LGN A;  3MZL A;  2W18 A;  2H9M A;  3FGB A;  4CZY A;  2CO0 C;  4E5Z A;  4G56 B;  1SQJ A;  3BWS A;  4FB1 D;  2P9P C;  3PVW B;  2CE8 A;  3UKR C;  2P9S C;  1B9X A;  1Q47 A;  4Z8L A;  3NVQ A;  4J8B A;  3GRE A;  4A09 A;  1PGU A;  3SHF A;  3DWL C;  4FA1 D;  4K3J B;  4FA5 D;  4ZOX A;  5HE2 B;  5SXM A;  3UVL A;  2I0R A;  2B4E A;  3SVW D;  2XYI A;  2I3T A;  3AH8 B;  5HE1 B;  2HJ4 A;  4ERY A;  4E5Z B;  4CI3 A;  4QT8 A;  3SLE D;  4FAV D;  3OW8 A;  2IAA A;  1RI6 A;  2PM7 B;  5EML B;  3PXW D;  3I7P A;  3DM0 A;  1GG2 B;  1NEX B;  3MZK A;  5IC7 A;  4L1Q D;  4R7A B;  5HE3 B;  2OJY A;  3SBQ A;  5CXC B;  4CI8 A;  4OZU A;  3EU7 A;  4PBZ A;  4A08 B;  4O3T B;  3BG1 A;  5FKS A;  3AL8 B;  3SFZ A;  3FM0 A;  4HDJ A;  1NR0 A;  3F3F A;  2IWK A;  2H47 A;  3GFC A;  5K1C C;  4ERQ A;  3EWE A;  3L4O D;  3KRX B;  5GXI A;  5I5J A;  5GSA A;  4J82 A;  4GM9 A;  2YNP A;  4A2L A;  4Y5R D;  4J79 A;  3I7L A;  4ESG A;  3SMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...