2MTPA

The structure of filamin repeat 21 bound to integrin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
95
structure length
95
Chain Sequence
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism of integrin inactivation by filamin.
pubmed doi rcsb
molecule keywords Filamin-A
molecule tags Protein binding/cell adhesion
source organism Homo sapiens
total genus 4
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mtpA00
3CAFA 1G1CA 5CJBA 4XPTL 3THMH 2MTPA 4NHUB 1LK3H 4KRPB 1ZT7A 1XIWD 1H5BB 3GSUA 4X7FC 1N2RB 4HHAB 3HUJA 1QFHA 1J12A 2KZWA 2NY2D 3PDGA 4GKZA 1PDKA 2KL6A 3RGVA 3NBNA 3NZ8A 1K3IA 2FH8A 1AQDB 4Z7UB 4PTTB 4BFEA 3VFTB 4RMVA 2CUMA 2L7UA 1WICA 1E4XI 2Y5EA 1RJCA 4PJHE 4PJ9B 1RHFA 3HMXH 1MQ8A 3IU4L 2MKLC 2OL3A 3MOAL 3QA3B 4LP5A 3S36L 4Y4KD 5I30L 3BP5A 1DQQA 1OTTC 4JFPA 4WHCA 5D9SA 5AWNL 4P5KA 4ZDHA 4Z7VF 1EPFA 4G9FB 1TJHL 4Y2DC 1NKRA 4PGBA 3KYMB 5JO5B 1P53A 5IB3A 1X9QA 4ZXBA 1YEGH 1IEAA 3MNVB 4MSWA 1CLZH 4P23D 4TSBH 5E9DB 1F5WA 3OR6B 5HHNA 3CU1A 5D70L 3WFZA 4OFVA 3BUTA 2DJUA 5GGUA 2B5IB 3H7BB 1KIQA 4L9LC 4XCNB 4Q6IB 2WQ8A 2B2XL 3TJEL 4YGVA 3VXSE 1BZ9B 1X5GA 4M7KL 4KROC 2F8XC 3I02B 1CXHA 1VGEL 1QZ1A 1OGAB 2ZUSA 4UTBL 5E1AA 3JWOL 4LLDA 2DM2A 1H9VA 5BJTA 4NBXB 3ZKMC 4PREA 5SX5K 3DMMD 5EORL 5GIRB 4ERSL 3QQ3A 5JOEA 5BRZD 2W9DL 4H25A 3RVVC 3D0LA 4IIQC 4UT9L 1MHEB 4WUUB 2R69H 2VDML 4EXKA 4L1HA 3VXPA 3P11H 2PW1A 4PIRF 1A6WL 5ETUB 2ADJB 4C83B 4YR6B 5EO9B 5DHXB 4JQXC 4GOSA 2R4RL 2HA1A 4ODHH 4X6DA 3D9AH 5DZNA 3HE7A 5GISH 4YXKH 5C92A 1UENA 3CZFA 4XGZB 5MHSE 2E7BA 4KGJA 2FATH 4OZGA 4EI5D 3N06B 4UT7H 4X6FB 4S2SA 5D71L 2UZIH 4M93C 1LDPL 1F3JB 2QTEA 5F8QC 3K46A 4JZJA 4ONHA 3HAEH 4HUWB 4PBXA 3STZB 4PRIE 5CD3B 3QG6B 3UJTL 3P2TA 3V6OE 3TIEA 5KVDH 4XP6L 5MENE 4MXVE 5HGGS 1I9JH 2FWOA 5FYLE 2NQCA 3QUYA 2Y25A 2GTWA 2G2RB 5I1KL 4LVOC 2H26A 2VXVL 5TDPB 5GGSA 4R96B 3IXAB 1HYSC 1OGTB 3O2VL 1ZA3B 1IAOB 2FL5A 5FUOL 4K8RC 4M1GL 1I8IA 2CMRH 2XZAH 2FX7L 3UZQA 4S1SL 3QEQB 4FQQA 3KDMA 4X4ME 4PJGB 2DDQL 2QQNH 3HRPA 4R0LB 3RVUC 2Z31D 3F7YB 2YPLE 1FH5L 3GSWB 3UC0L 2R2EA 1KJ2B 3BQUB 4TSCL 1DDHA 3T65B 4P5MB 5MI0B 4F8TA 5HPOA 3DX8A 1R5VA 5I1IL 4LPCA 3WSQH 1FAIL 4AIZB 4GKNB 1S7VA 1DQDL 5F96L 1F90L 5CSBA 3KPTA 4R90H 2FBJL 3HZYB 3TO4B 3ULVH 4IS6B 1YEKH 3MNZB 5J56B 4AEIL 3GSNH 3C09B 5CGMA 1J8HD 2Q86A 4KPHH 4X7TB 5EIVA 3L5JA 4JG0L 1KPRB 3ZKSD 1ZHBA 4OI7A 3SDDA 3GIZH 4A2LA 5FOBA 5A3ID 4OM1L 3BHBA 4KAQH 5F1SA 3KJ6H 2VN4A 4BK5A 5D93B 5DMGC 3IFNL 1DZBA 4OGXH 3MRNA 2UZXB 4WFEE 4RFEA 2E6PA 3VXUA 5EA0H 5C0EA 4JPKH 1TQBB 4RGOH 1HIML 4Q9CA 3C60D 5CJ5A 5KSUA 3U4AA 4XWGL 4K3EL 4WTZG 3ZYJA 2V17L 1CXEA 2XZCL 4LSSH 3S6CA 5EB9A 5GGTH 1A7OH 2CDGA 1Q0YL 4K7PH 4MXQD 5DFWH 5EOCJ 3VW3H 1MLCA 2BMKA 2H8PA 2OJZL 1O7SA 4QTIH 5CWSA 3TBTA 5A2FA 4JJHA 4F80A 1NCDH 3PXJA 4NQEE 2XQYK 5T5NF 3AVEA 4LU5L 5DDHA 2SEBA 3QPQD 4QT5A 3L7EA 3LV3B 2YD6A 4X7SH 3BZFB 1HQ4B 5C07B 1BLNA 3PGFL 3WN5A 3IVKB 1JHKL 5HVHB 2NR6D 4I48B 1J7VR 5FGRA 3DX9A 5KSAA 1P4LA 2HJFB 4V1DD 5JQHC 2VWEE 3GMMA 3G5VB 4KXZH 1OF2A 3AREB 2VISA 1F6AA 4I5BA 1FZMA 5D7IB 1GSMA 3GSQB 4M6ML 1S7XB 3MRKA 5ICYA 1R24B 1JGUH 1JZ7A 2OXGA 4MHHG 4HPOH 4PJHA 1UWXK 1W0VB 4PLJD 5E56A 3U2SA 2FYYA 4ELMA 3RL2B 3RBGA 3VI3F 2ARWA 1C5CL 4HW6A 4ZYKB 5DQ9B 1EBAA 1MCPH 1J0YA 1L9MA 5LGJB 5DQJA 5I1AA 2PR4H 3MRJB 5GS0C 2BOCB 5HDLA 3NACL 3RKPA 2RFXA 4KJYB 3EYQC 4PJIA 2R1WA 5B4MC 5DFVC 4G6JH 1YMMD 3OR7A 4AEEA 2XWTA 3IFPA 2WUBH 3NIFE 1FRGH 3U6RB 3FQWA 3EJYD 3T0EC 4MWFA 4WCYH 2AV1B 2X1OA 5T1DH 1K4DB 2PXYC 2VL5B 3ARBC 3EOBA 2C3HA 5FYKE 4PP1D 2PTTB 3QQ4B 4ZS6D 5DJCA 3UO1H 3VXSA 3RDTB 1KIPB 1RFDH 4Y5YB 3S98A 5I75C 1FFOB 4OCWH 3SO3B 3TN0B 3LQZB 5H37H 2P8LB 2PW2A 4UTAL 1KB9J 1BEYL 4PRNA 4M1CC 2QR0A 4KJWC 1VB9A 4RRPA 5MEOB 3JWNC 2P5WD 1S9WA 4PYHA 5IB2B 2WMPA 4YDKL 2R0LL 2WP3T 4P57A 4H88H 2DICA 2COQA 1MH5A 2ZG1A 5F88A 5CEXA 4HIHA 5DVKA 3JBG7 4PV9B 1DLHB 3VWJD 1YNKH 1FE8L 1J0ZA 2BVOB 4Y4FA 2C4XA 1HSBA 1CD0A 2L4OA 3BPLC 3PV6A 2ZOLA 3EO1B 5KTEL 1MJ8L 3SE3C 5HYQA 5IROC 1G7LA 2NY7L 1TCRB 4QOKE 4X4YA 2M2DA 4PB0H 3UPRA 1NEZB 1I7RB 4KJPD 4F9PA 4OV5B 5D8JH 4H1LB 4QWWC 2MOVA 4CVWA 2CGRH 4IMLB 4TULL 2YC1A 3LKRB 2FO4B 1U41A 5ALCL 3SGEI 4PRIA 4HWBH 4R7NA 3V6OA 3H0TB 5MENA 3PDDA 2Y7QB 1T3FA 1D9KB 5TJWK 4KZDL 2GSGB 1WFTA 4KUZH 5DJ8A 3RNQB 3ULSB 2Z8RA 1WWCA 3UJJH 1C08B 4QGYA 2YBRA 4XBGA 1EEUA 4DZ8B 4F7TA 2P24A 5ISZB 1MCJA 5JPNA 2HJLB 1IM9A 1PEWA 3QXTA 5E6IA 5DJDB 2EYSA 4X4MA 3KYOB 3OKNA 4H26A 1E28B 1A7PH 1D6VL 1NANH 1XR8B 1ZOXA 2FH6A 2YPLA 3KPRB 2NCMA 2YZ1A 2YSSB 3O0RH 2BVQB 4TUOB 4H0HB 4H5SB 3FFDB 4HAGA 3V4PH 3VFSB 5D2LE 2XTJD 3C6SB 5EWIL 5GS1A 2IBGA 1DE4A 1UACL 4V1DE 1NMCB 2E9WA 2UVEA 4MYWB 5IW1B 2O5XL 4DGVL 3L7FB 4K3DL 1Q9OA 3QIUC 1M05B 3V4VH 4LNRA 3V0WL 4L5FH 1I7UB 1II4E 2BHZA 2K7QA 1NDMA 2DS4A 1MJJA 4I18A 1WFNA 2R2BB 4OD1L 2FECL 3L3IA 2B39A 2IGFH 2FDBP 3TZVD 5C0CD 1M4KA 1DJSA 4MX7A 1ZT7B 4H1LH 3GSUB 4X98B 2CKNA 4NZDA 5TE7H 1MHPH 3HUJB 2BNUA 1AXSA 3NH7H 1J88A 3WUWG 3F6IA 4LLQA 4GKZB 5FDWA 3CK0L 1WWBX 1DFBH 3Q2CA 4XPHL 1RK0A 3RGVB 5ICZA 1N5YL 3NZ8B 3EYVA 4P23A 4NOFA 1OPGL 2QSTA 4OGAD 4S0SD 4NCC1 2BNQD 4G8EA 1FGVL 1I1RA 4I0CC 3O45A 4YEEA 5CZVH 5IM7B 2Z0BA 4WUKL 4X80H 1RU9L 2O5YH 3OKLA 5KSBF 3BP5B 12E8H 4ZFGL 1DQQB 5TPWH 2DWDB 5K9KB 4JFPB 3P9MB 5D72L 5I6XB 1DN2A 4XCCH 4ZDHB 3NIGE 5FUZL 5DD1L 1WC7A 4PB9H 5DGQA 5F9OH 2HT4C 4OZHE 2AI0L 4NQEA 5IB3B 4ZXBB 5KZCB 4XPAH 2CUHA 3NA4A 4MSWB 3QI9A 3MV11 3CCHA 5HHNB 1KIQB 1QLFA 2DQDH 1T1ZA 2W92A 1O0VA 2AXFB 1T2QL 1WAAE 4YGVB 4QXUH 3DVNA 3MSPA 1Q72H 1PGRB 3U36B 1K3ZA 1ZK9A 5EU5B 1AXTL 4GRLD 3VFMA 4M7LH 4M48L 2A6IA 1BZQK 4XP1L 3IRPX 4LLDB 3ROOA 2I9LA 2Y06H 3BUYA 4OD3H 2JELL 4PREB 4JZOA 5T5NG 3V0VA 3NVQA 2XQBL 4QRTA 5BO1L 5KW9L 3E3QC 2E9IA 4LSVL 5EG6C 3WS6C 4ODTL 2WW8A 5IB4A 1ETZA 1FNEA 3DGCR 3ZO0A 3QNYA 3QZWG 1NFDB 2PW1B 2JIXB 4YHIA 3U9UA 1D7FA 3V6ZA 3QP3A 3NTCL 1FIEA 3T3MF 4ONFH 3VXMD 4BQ8A 4NRXA 3X13A 1C7TA 2V2XB 4X6DB 4GXVL 5JMRA 4HKXA 4C4KO 2WSKA 3HE7B 3GJFB 3TH3T 4PJFB 4UILL 2KQNA 3CZFB 3NGBB 4MVBD 1TPXC 4PJXE 1ADQL 3U4BH 4OZGB 2E7MA 5MERA 5AAMA 2ICCA 3M45A 4S2SB 4ONHB 3R4DA 2HT2D 5H94B 4HS8H 3GZKA 1F3DJ 2Z31A 3HA0A 5H35B 3TIEB 3WO4B 2LVCA 4XH2A 5J6GA 4FQLH 2XTJE 4HAFA 2FWOB 1A3QA 1XGYH 1LO0L 1X5ZA 3QUYB 2GTWB 2H26B 2CK0L 5GGSB 2VDRH 3JV4A 5GHWH 1YNTB 2HN7A 4CMHB 4NKIH 1A0QH 1I8IB 3NN8B 3X17A 2QQKH 3KDMB 4HBCH 1NCUA 3OPZH 4JQIH 4QOKA 4DTGH 4G7VH 1S78D 1R5WA 4NZUL 5C70A 2R2EB 4P99A 1A9EA 2LQRA 1NAMB 1DDHB 1YN6A 4IJ3B 3ZYIA 3DX8B 5ILTH 3H42H 4RMQA 1U8LA 2NY3D 4YXHL 4ODVH 1S7VB 3UAJC 5DF0A 5FYJD 5DVMA 3T1WA 2HRPH 5EZLB 3QWOA 1I8LC 5FOJA 1NBYB 4ALAL 2AGJH 5E2TL 3HI1A 3C5ZD 3GJFH 4LF3A 7CGTA 2NXYD 5CZXD 5FO7B 5C08E 4HUUB 3VDAA 1KTRL 3SDDB 4DUVA 3MUHL 4MJID 3BHBB 2VDQH 4HUNB 1FSKB 3U9PL 2EEAA 3MGOA 4FTVB 3T2NL 1S9VB 3LH2L 2A9NH 3MRNB 4FHBD 3VXUB 1MNUH 2DQUH 2D7TH 4JY5L 5KSUB 4DWHA 1LDSA 1NGWA 3A6CL 4LLVA 2E3VA 3ZZ1A 5HDQL 1BQLH 5CIPB 5TDOB 5DVLA 5D2LA 3QUMA 1RAMA 1P5UA 1KB5A 4V1DA 5TE4L 3MV7E 2CDGB 2B1AL 3EW3B 4U6VH 4M7JL 1MLCB 1QUNA 2H8PB 4QNPE 4GG6E 3W11D 4UAOB 4F2MB 1P7HL 1JPGA 2I9TA 2FZ3A 4XP4L 5I19H 5T3XL 2VAJA 3FJTA 1INDL 35C8L 4QT5B 4YC2B 3O6ML 4F33A 4XC3H 2VMFA 1GAFH 4Z7OF 1JJUA 1NAMH 2CLZB 1BLNB 2LU3A 2Y36H 4YHMH 4ZUTA 4JM2D 1AGFB 1ZGLM 1WCBA 1WZMA 2AKRA 3KYKL 3DSFL 2VLKD 4KKCC 2C1PB 1P4LB 4NQXA 4QRUB 1ZLSH 3GMMB 1OF2B 2EDEA 1F6AB 4OSUL 4O5LL 1FZMB 3CVIL 3MJ9H 4F3FB 2GT9A 3MRKB 5D6DC 5IHUH 5ICYB 5E7BA 6CGTA 5GS2D 3E2HB 2AJXL 4PJHB 3F7PC 3U2SB 2FYYB 4ELMB 2NY5C 5E4EC 5HYSG 5CGYD 5DQJB 5CBAB 5I1AB 1FG2A 5EUOE 4FABH 2RFXB 2X4UA 4PJIB 3QDME 4U7MA 4RNRA 2UY7A 4OZHA 4AM0B 3JVGC 1CFSA 1U93A 3EDEA 3NA9L 3OR7B 1N64H 1X4ZA 2DLFH 4MAYD 5DA0B 5CEZH 3IFPB 5B8CC 1IGTA 4L4VE 1MFAL 4U1NA 4I9WD 4P46D 3SDXE 3REWA 5CIPH 1U42A 2D0FA 3TJHC 4JFHD 1EO5A 1LHZA 2ZJSL 3A6OA 1HOCA 3UTTE 3EOBB 3JZ7A 1OW0A 1WAAA 2D31A 4D0BA 3UTSD 1YC8A 1I1AA 5DJCB 3VXSB 4OD2A 5F7FA 3O4LD 3PGCA 4WENB 1DBAL 2YOCA 3ARGD 1KOAA 2XN9E 2RR3A 5HHVH 2PW2B 2X44D 1G6RL 3D3VD 3K1DA 5DJ6B 3MYJA 2DQFA 3FRPA 2V2TA 4LMQI 1RZFL 4HT1L 4R97B 1ZEAL 3QUXC 1S9WB 4ORGA 3BKMH 4KI5E 3HZKA 5C0RH 4OCYL 4P57B 5IT2H 1EUUA 4YUEH 4PJEB 1MH5B 5F88B 1JRHH 3NIDF 5CEXB 5F7NC 3UP1A 2XWBA 3HUJF 4LEXH 5E8NA 3CUPB 1FNSH 4BFGA 2X9WA 2NZ9D 3PNWA 1U6AL 2DD8L 3VXNA 5GS3A 1HSBB 1JFQL 4GW4A 3PV6B 3ULUD 1INQA 1JWMA 2YXMA 5HYQB 1G7LB 3PP3H 3UPRB 1GGTA 4X4YB 3K80A 3OXRB 4D0CA 4WRLA 4MJIE 4IOFD 4HJGA 3FO2A 3QYCA 4PJXA 4I1NB 5FEBA 3CX5K 5DA4A 2R56H 4UT6H 1YNLL 3ARXA 2OMNA 4M7LT 4RFNC 4PJ8D 3HC3H 5JIIA 4R26H 4LLUA 1SHMA 3MC0A 4PJ7A 5E2WH 1QQDB 1AGEA 5SX4H 5E94B 3MLXH 1G0XA 1RVFL 3WLWC 5MENB 1W72A 4OT1L 3ES6A 4X9IA 3RU8L 1C5DA 5DJ8B 1F45A 1KB9K 5GRUH 1DQLL 4CGTA 3ARDD 2YBRB 4XBGB 1BFSA 5EU3A 2P24B 4F7TB 1NCAH 4NPYA 1W0WA 2B1HH 2CKBL 2V5SA 2Q7NA 4FQJH 5E6IB 4FZEL 1BECA 2VDLH 4M43L 1QFUL 4PJ5D 3WJLA 5ERWA 4HIEA 2YEZA 3UYPA 5JXAL 1S5HB 5I74B 4CL7A 4GRWE 4ENEC 4MHHI 1ZT1A 2QQLH 5GS1B 1DE4B 2NY2B 5TFSH 4JB9H 3C87A 1K8IA 5FYJU 1BOGB 2FIKA 2IC2A 1OP3H 5C7XL 3RTQA 1Q9OB 4MXWL 5E6ZA 3MUY1 5BMFL 2DI9A 3QAZC 3E8UL 3RIAK 1MJJB 2IJ0C 3CH1A 5ITFA 3OAZK 3HLAA 3L3IB 3OJMB 4Y4KB 5C08A 4N90D 2H32H 3MZGB 5IJKC 1CQKA 1CFTA 1Z9OA 2BNUB 1I1CA 1AXSB 2F19L 2GKIA 3FTGA 4JFFD 2P5ED 4NWTH 4CMMA 1NMBL 3G5YA 4FQXA 5FDWB 1I1FA 3BPCA 1RK0B 3QUKB 4F7CA 2EDTA 4P23B 1RURL 4NM4H 2IWGA 1G9NC 1VEOA 2FEDD 2WP3O 7FABH 3F62A 4NFBA 4WO4C 1U8JA 2G5BA 1EHLH 5KOMC 3ESUF 4LHUD 4OCSH 1KACB 4DKAA 3OKLB 1BQHA 1HHIA 3MV7A 2D7MA 2O26U 1ZLWH 1ZKAA 4GRLA 5I18L 4O4YH 1XCTA 1WC7B 4UDUA 4GG6A 4O2CA 2XZZA 4NQEB 5K9JH 1FIGL 3O4OB 5J1AB 4OV6F 3DMMB 4R7DA 3QI9B 4JN1L 5LGKA 2WUCL 3CCHB 4KKAC 1KYOJ 1QLFB 1YMHA 4Q0XL 1T1ZB 3LKPA 4E0RB 1U8QA 5E08L 2YD9A 2OCFD 3QCTH 1AR1D 3WFDL 1F8TH 1NCCL 1RV6X 3O8XD 1DBMH 3QXAB 4EI6B 3VFMB 4ODXA 4EBQL 4GJTB 2A6IB 2HTKD 4RISH 2UVFA 4NJ9H 4R2GC 3RIFF 4EOWL 2X4PA 2YZ8A 3WS3B 2I9LB 1C12B 5KVEL 4LKCA 3BUYB 4JZOB 2APBA 3HRZB 3V0VB 1NSNH 4L8DB 4EI5B 4DVBA 4QRTB 1NEZG 4I3GA 1SBSH 2XA8L 5EUOA 1ETZB 1FNEB 5JDSA 3QDMA 3QNYB 1NGZA 1F97A 5CAYB 1KT2A 4YHIB 1CVRA 3V6ZB 1NBVH 1DQMH 2OLDA 1ZS8A 1TNMA 3SCMC 2VERN 5J6HA 3RVWD 4FNLH 1QBLL 3OAUH 3LQMA 5DJAA 4L4VA 4HWEL 3FQTB 4HKXB 1A1MA 3AXLA 3SDXA 4B5EA 2QKIA 3WIHL 1AP2B 2ZSVB 4Q9RH 3UTTA 2M8XA 1JNLH 2Y6SC 1R0AH 1QBAA 5F89B 3LQAH 1CXFA 4YHKH 3ZYOA 5IMLA 2BJMH 2PYFB 1WIPA 3ILPB 4R4BB 2H1PH 1GOHA 1RJLA 2HLFC 2Z31B 25C8H 1CL7L 1UJTA 4U6HA 4XH2B 5I8KL 2IMNA 4K8RL 3TT3L 3U7WH 3VG9B 3MGTA 2EIBA 1A5FL 2GJ6D 2WBWB 5I1JH 2JCCE 1TVHA 2DLHA 2NY6B 3ETBF 3GBML 1HINL 4LSUH 1AKJA 4OLXL 1YEIL 2I07A 4DEPB 1LILA 3QCUH 2HN7B 1XF2A 1X6LA 4N8CL 4KKBC 3GJEA 3HFML 5FKPB 1J8HB 3C5ZA 2EE3A 4WY7H 5J11B 5KSVA 1F4YL 2R1YB 4QOKB 1MCSA 1NDGB 4GBXC 1JL8A 5CP3A 1R5WB 4Y7MA 3TH4T 3IS0X 4MJIA 4JFFE 1OQXA 3LS5L 1T1WA 1YN6B 4QCIA 5KVGH 2A38A 1JPTH 1U8LB 1MQKL 1MEXH 1DBBL 1EV2E 1OP5K 3RUGA 1DVFD 1NMAL 1FZOA 2JK5B 2OR8A 3N50A 5GRYA 1U8OA 4YDJB 3BN9D 5EO0A 5I1CL 4JREC 3QWOB 3TWCL 1U8MA 3BT2H 3T0AA 2GYSA 3LCYA 5I1LA 4LF3B 2CRIA 1JGEB 4KU1A 4CAGA 2YWZA 1P6FA 2DMBA 5E95B 1KNOA 4UBDD 3CLFH 2HKHH 1CT8A 1QKZL 3NAAH 2RHEA 4Z7QE 4URTB 1CK0H 4NN6B 3MGOB 4LOUC 3F58L 3G6JF 3MV8E 5JZ7D 1SJVA 3OG6B 3ARPA 1S9YA 1TNNA 3RWEA 2KPNA 1EUTA 5KANG 5IQ7L 3M1BA 1NGWB 5DK0B 4JM2A 4LLVB 4EDWL 4X8JA 3QUMB 3O6LL 1AJ7H 1KB5B 1T4KA 3QDHA 4V1DB 5F97E 3N9GH 3UBXB 2YPKB 3C08H 4GUPA 1QHOA 1IEHA 3QHTC 5JOPE 5ESQA 2GW5A 2ARJA 1J1OH 3MRQA 3VCLA 1JPGB 3KS0J 2FZ3B 4HG4J 3WHXA 4F33B 1CGSH 3L3KA 3QCVH 4B0MM 2FHBA 1J1PL 4YAQA 1MRFL 5HD8D 4ZUTB 2FLBT 3SKNA 5FA4A 2AKRB 3H3BC 1ND0A 1FNLA 1JIBA 4XMKL 1YMMB 5C0IA 1MSPA 4L8BA 2WINA 5D1QD 2ZCHL 5GS0L 5IEKA 4Y5VA 3PHOB 4JFOA 4LIQH 4JG1H 3C8KA 1WV7T 1A14L 4G8IA 5JW3L 3S37X 3UTSA 4NOBA 4YWGH 1H3VA 3HE6C 3R8BB 4WWKA 3HC0A 4KMTL 4K55A 1FG2B 1AIFB 1ZLVK 2OTUA 4OM0H 2X4UB 4HJ0D 4HEPG 3OG4B 4RNRB 2LAAA 5LCVH 3ZHKA 4OZHB 5IP4A 3UYOD 1CFSB 1U93B 1OHQA 2GQHA 4QXWA 4PLNC 4DAGH 2P5WB 3EOTH 4XPGL 4U1JA 1Q94A 3V52H 4XT1C 1K85A 2GJ6E 3EDFA 1TLKA 4TVSa 3PWPE 4U1NB 3REWB 2OYPA 1TZGH 1VEMA 3IDXL 5EFIA 3QUMH 3WIIH 1HOCB 1KB5H 4D0BB 4OLVH 1I1AB 3L1OL 3RWJA 4Y4HA 4P5TA 4JJ5A 3VWJB 1JBJA 3TIDA 4Z8FL 3ULVC 1PG7L 4Z6AT 3K7UA 1WBYA 5ACLA 4Z5RA 2ZCLH 3HI5H 3ZHDA 4YBLC 1T89A 2H45A 3MRGB 2VUYA 4LAJH 4Y88A 1A8JH 2DQFB 3RX7A 4PGDA 3X3FH 1QFWL 4DGIL 4Z77A 3G04A 4ORGB 5LWYL 4KMLB 3HZKB 2DQIL 3W2DH 3BKJL 3HN3A 5C09D 1SY6L 3VJ6A 3KLHD 3BIKA 2XACC 3BEVA 1I85C 3GM8A 3C9NA 4G5ZH 5EIQA 3PNWB 3VXNB 2XZQL 4S1QH 5GGVY 4XZUA 5K93A 5IMMA 1ITCA 1JWMB 2GTZB 3B5GA 4QXTA 1NGPH 2C1OA 3O3BB 4E42A 3C2AL 5TE6L 2J3SA 4PBWD 4XXCA 5JUEL 1P4IH 3FO2B 4PJXB 3UZVB 3MJ7A 3NCJH 1DUYA 2BVPB 3JTTB 1OP9A 1K8DA 4L8CA 4HCRA 3UXFA 3JV6A 2KH2B 4LLUB 1IGIH 4PJ7B 4FZ8H 4R0LC 5F93C 4P0DA 4L4TD 5I2IB 4JO2H 2J6EH 4P4RA 2UZYB 3BQUC 1YPZB 4BJLA 3WJJA 1I8MA 5DEGA 2H2PD 2XTJB 3ES6B 4HXAL 1C5DB 3RKDC 1IL1A 4Q74A 4NO2A 3JWDH 2EIEA 2JCCA 2ZUQB 5C0JA 2VABA 5DRWA 4LRIC 4J1UA 4HMDA 3F5WB 3UMTA 3TO4C 4KTYA 5EU3B 4TRPH 1MWAL 2ICWJ 2K7PA 4NPYB 1T03H 1IE5A 2DBLL 3B2VL 5E4IA 1W0WB 5DMIH 4MB4A 3C09C 4BH8A 4GW1A 4MA8H 4BSVA 3BXNB 4EVNA 1X5HA 4M6AA 5I1GL 2GJZA 5ERWB 3TZVB 5C0CB 2FX8H 4K23H 4KVCL 4P4KD 4HIEB 2YEZB 2IPKA 3TFKC 5IB5A 2BOBA 3UTPE 5DWUH 1ZT1B 3QEGL 4JFFA 5BOPA 2ZCKH 5D93C 1K8IB 5SX5H 1SQ2N 2UWEB 4LASL 1E6JH 1XZ0A 4Y1AE 5JIPA 1F4AA 2FIKB 3SGKC 4OI9A 1IQWL 2P47B 1WLHA 4ZFZA 2AABH 1SYSA 2FEEL 1RZ8A 3H9HA 2NY4D 4NBZB 4Y16D 1CE6A 3WDJA 1KCRL 3CSGA 3DOSA 5FHAL 3I6KA 3ZKND 3WFEL 4LLWB 1JUFB 3CH1B 4BK4A 2AJYH 4HWZB 3ARFD 3HLAB 3QG7H 4MGXA 5C08B 5JW4R 5IFJA 1RJZA 4APQD 2DF3A 2BFVL 2EXYC 4K07A 1CE1L 4Z0XB 1EEQA 4D9QE 3FZUD 2AJVH 1CFTB 2HFGL 3FTGB 4CMMB 1QLEH 2AJSL 1HKFA 3BPCB 3DYPA 4F7CB 3NCFB 1WJ3A 2VXUH 4KUCD 5JLZA 2ORBL 2AW2A 2V2WB 4AIOA 3O41A 2PNDA 1FBIL 1RZIB 4HIIB 1A4JA 5C9KA 1U8JB 3UTZA 3A67L 3C8HA 4TPRL 4AEHH 1CD1B 1NUDA 4ISVA 2A0LD 4GXUN 5AUMA 3ABZA 1OT1A 2A1WH 2E27L 1BQHB 1HILA 1HHIB 4GMSH 5E5UB 4AG4L 3WE6B 4LP4A 5JHDD 4IOSD 2IPTL 4GRLB 2EDRA 4UDUB 4GG6B 4O2CB 4KK8C 1MI5D 3D39D 5JXED 1KPUA 1OAXH 1CDUA 1UM6L 2DQGH 2M1KA 1PZ5A 4R7DB 1UH2A 1MAML 2BSTA 1QRNE 1YMHB 3K2MC 4KVNH 4RRPG 3LKPB 1FFRA 5JORA 1MCKA 1U8QB 4IOIA 1OCWH 1UCBH 1G7QA 4LSQL 4LK4A 4TTGA 1XAUA 2RBLA 3QPXL 1U3HD 1KJ3L 4LVNB 4NQCE 4B7LA 3GSXA 3S34H 2BRRH 4OQTL 3ECBA 4ODXB 1S3KH 3VWKD 2I27N 3KWWB 1GC1C 1T2JA 2WBKA 3UTQA 4ZSOB 2X4PB 5EOTA 3CFIC 5DD0L 2CLRA 2CR6A 4LSRL 1G7MB 4LKCB 1DLFH 3J8F7 2DTML 1C16B 2HT3D 3WUZA 4Y5YC 3EJZD 3Q5OA 3TN0C 1JHTA 1ITBB 1WUNT 3BD4A 5FB8A 3TESA 1KCSH 1K6QL 5TQ0H 1OTUC 5JDSB 1FVDA 4BZ2H 4GSDH 3BPOB 1KT2B 4M4PA 1DUZA 2Z92A 2JE8A 5DS8A 2JB6A 3L3DB 1ZS8B 5A43C 2XWJA 5J6HB 3TEUA 4JY6A 2GJ6A 1VERA 1ZANL 3AXLB 3SDXB 2QKIB 3TA3C 5IHLB 3BPNB 2Q20A 2VQ1A 5HGHB 2BXYA 5D2LF 4DW2L 4WGVB 3MODH 1FJ1A 4DKFH 3LPFA 5IMLB 3I2CL 5CJ8A 1KYOK 4DCQA 5L8KB 3LN4A 3TBYB 1HZHH 2W07A 3U0PB 5L0QB 5MP6L 5C2BL 1EH9A 1RJLB 4O2EA 2WK2A 4HUXA 4YHOH 1N6QH 1MCNA 4FFZL 1CICD 5DYOB 3VXTB 4KQ3L 3MGTB 4Y8AA 5GGVL 2NY3B 5HDBE 3DX7A 2F74A 4AYFA 1IZKA 1YA5A 4NGHH 3FT4A 4FRWA 1KV3A 1XF2B 5C0BD 1RULH 3I6LD 1G7IB 5I8OL 1J87A 2ICWI 2P46B 1KBGH 2FJHB 2HLAA 4K2UH 3C5ZB 5IJVA 1WZKA 2NXYB 2OSLB 5KSVB 5DGRA 3T09A 3P30H 4YBQC 1MFCL 4XNUL 1H3TA 4PBVC 1AI1L 4MJIB 4JR9L 3QUZA 3UZEA 1IGCH 1UWXH 2ZOKA 2LABA 3Q6GL 3QNZA 4E41D 4CRPA 3RUGB 1BAFH 1GPOL 4OZ4A 3HC4H 3PUCA 4FP8L 1MIEL 5E99L 1FZOB 1CDJA 3MV9D 1U8OB 2J8HA 4M7ZB 5DHVA 3ZDYF 1DANT 4OLUL 5I1LB 4KI5C 4XVUC 3WBDA 1KNOB 5DJYA 1WAAF 5GSRB 3I3EA 1ACYL 2WWMC 4F58L 3E6FA 3D39E 3D1MC 5ADOH 3DUUA 2CDEA 3KR3L 3S3JA 1NCBH 2BSED 1J9CT 3MJ6A 4DK3A 4ZQKA 2YD8A 5I15H 3D69A 4ELKA 3G6DH 3RWEB 3B9KC 1EFXD 3M1BB 5F9AC 4JM2B 5JW4M 3OGCB 2F54D 1GXEA 3SOBL 2VLKB 3RZWA 1JWSB 2K9UA 3I84A 2NY0C 5FYJH 3NCCB 5LQBL 1E4XH 4Y1AA 1EGJH 4JE4B 1JPFA 4FQ2H 4LVEA 4IDJH 3GK8H 3ARWA 3RVXC 1IT9H 5HVGB 1Z3GL 3SKJL 2ARJB 1R5IA 1MFNA 5J9PA 3MRQB 3VCLB 3G9AB 1DN0A 3WHXB 1P9MA 3CLEL 3BDYH 3FOMA 4YAQB 5EC2B 5I6XC 5FKAB 2B4CH 3BP7B 2FD6L 4M5YL 3C6LC 1LEGA 5I8EA 3MFGB 4M3KB 5CGTA 5F1KC 4OFIA 5C0IB 4MAYB 5IESL 4L8BB 2WINB 2VDKH 1CWVA 3AS1A 5IEKB 3NZHH 3LSOA 4Y5VB 4P46B 4JGUA 3RY6A 2FJFA 4LRNH 4PG2C 3GSOA 4XTRC 2MCPH 4U0RC 3ZE1E 3CVHL 2IAND 3UTSB 4N0YL 4DK6A 4DN3L 3HC0B 1CLOH 3O4LB 1MPAL 4S1RH 4M62H 2A6DA 3O81A 1NC4D 3ARGB 3P9LB 2E7HA 3W9EA 1RUAH 4QRQB 3D3VB 4CNIA 3C2SA 4U3HA 1HSAA 1KENL 4MA3A 1TFHA 1WF5A 5H2BA 1JV5A 1QVOB 1L7IH 3ZTJH 4U1JB 1Q94B 2YHGA 4KY1H 5C09A 3SQOL 1QRNA 1UKTA 1OAYL 2HH0L 5MEQA 1RK1A 4OCXH 3P77A 4OB5H 1I3GL 3VXOB 3GUTA 1YECH 4Y4HB 3G5XA 4P5TB 5GGQL 1T20A 1YEHH 2Q8AL 3OXSA 1WBYB 1DBKL 4Z5RB 3WKML 5GS2H 1QSFD 1ZXQA 2R2CA 5DLMH 4HF5L 4PGDB 4O58H 4YHPA 4Z77B 3MUGA 3RZCC 4G8FA 3G04B 3SKOA 1R3KB 4PFEA 1UKQA 3FQNA 5DQDH 4MQXD 1H3UA 1QBML 4PJ8B 1KCVL 3VJ6B 4HSQA 3Q3GA 3BIKB 3BEVB 1BJMA 1A6UL 3HS0B 4Z7VE 3C9NB 5K33A 3WXVH 2ED7A 2JB5H 3PQYD 4MNHA 4XZUB 3TBVA 1CBVL 2C1OB 4QHNA 4E42B 1WT5A 1WZ1L 3ARDB 1YYLL 3SE9H 5KANI 2OZ4L 3ZMRA 1ZTXH 3MJ7B 5BW7A 1LP9E 3VRJA 2AJUH 5DUPL 4OJFH 1U3JA 5HI3C 1K8DB 5FM4A 4JQVA 3JV6B 4QNPF 4Z7NF 4LPUA 1LO3H 4PJ5B 5FCSH 4KHTH 2ENYA 4YFLF 3B5TA 4P4RB 1AY1H 3OAYK 3W0WD 3ARUA 3KAAA 5DEGB 4P3CL 4OZFG 1IL1B 2JCCB 4FXGB 5C0JB 1ZHKA 5DRWB 5CKAA 3WLBA 4J1UB 5HI4C 3MXWH 3JSSA 5DD3L 2RCSL 2QHRL 3AM8C 3T0VA 5LKNA 1KXVC 3HB3C 4BH8B 5T3XE 3SQBA 1H8OA 4GW1B 5DUML 1KEGL 4BSVB 1UH3A 4MA1B 1B4JL 2GJZB 3EJJX 1JGVH 4AMKH 3NFSL 2CIIA 2BOBB 4TSAL 3PDOA 4UB0L 4JFFB 2P5EB 1V3JA 1CFQA 3RRQA 3SGJA 2W1NA 3K2UL 4PLKD 2DWEA 4JDTH 5EUOF 1XZ0B 2EE6A 3MR9A 2WIMA 3DUSA 4JRWA 1SYSB 1P7QD 3H9HB 4R4FL 5JQ6H 1CE6B 2IANE 3R1GL 4NCDA 4JPWH 2GAZA 4X7CC 3SDXF 5IFJB 1G9NL 4KDVA 1BZ7A 4XCYA 4RFOL 2I24N 4Z0BH 1GL4B 3FT2A 3NCYP 3OL2A 2ESVD 1XF5A 4U1IA 2FB4H 3GMRA 1J0IA 3D39A 1O7VA 1OAQH 5DR5H 1EJOL 1RZKH 3REVA 5BVPL 5FV2A 4KDTC 3FN0H 3I9GL 1OSPH 3GRWH 4YC2C 4XVTH 1PX3A 4ZFOL 5ACZA 4OF8A 4XAKD 5FO9A 4Q97A 4WHTB 3ZE0E 5MEPA 4IRJD 3B83A 4KRLB 1A4JB 4UQ2A 2E9BA 1UWEH 4DKEH 2OK0L 4KI5F 3UTZB 2NMSA 3KLSA 5CJOL 4ISVB 4LQFL 5EC1A 2NNAB 3SDCA 2AQ3A 2VXSL 3EBAA 1U3HA 2DQCH 2G60L 4RWYH 3HTLX 2DIBA 4U1KB 4KRPD 1N0LA 1RZ7H 2GI7A 15C8L 3JUZA 1HKLL 5AYUL 4M5ZL 4MJ6A 1X5KA 3EZJB 1I3RA 3S88H 3OB8A 3T08A 2EKSB 3C5SA 4KROD 3K8LA 2R9HC 4XPTH 4NC1E 8FABA 5TDNA 3RVTC 5GRJH 4GS7B 3EYSL 2BSTB 1J8KA 1YEEL 3FRPG 5DSCA 1YUHA 1GZQA 3O9WA 5JORB 1AQKL 1X5AA 1E27A 1CGXA 4L3ED 1BVLA 3DYOA 4PTUB 5FF6B 1RUKH 1A22B 1IM3B 2D9CA 5IB1A 1X5FA 2F5AH 1L4IA 3GSXB 1PD6A 3RVVD 4ZG1A 2J8UF 2RAMA 3X3GH 4GAYA 3UTQB 3VFGL 2V7HA 5SWQA 3NFNB 2CLRB 1KELL 5L7XH 1ADQA 2HKFL 2VITA 4N0FB 1ZHLA 3WFCH 2XY2A 4WFFD 2R15A 1JHTB 4HIXH 4KFZC 4LDOB 5FB8B 1ZGLP 4TYUA 1X5JA 4HXBL 5D2NE 5C0FB 3JWOC 4AY0A 1O5DT 1FVDB 3PIQA 5JIHA 3LKNB 4HWUA 2GSIA 1DUZB 3OKYA 4R97C 3MRBB 3V8CA 4TTDC 3EFFA 2JB6B 5D70H 4JKPH 2XWJB 1KN2H 2JJTA 5J3HD 4JY6B 4I0KA 1OGAD 4ZS7L 2GJ6B 2B2XH 4YE4H 3X12A 1A7QH 4GRWF 2MKWA 4XPFH 3FO0H 2IALA 3THML 1LK3L 5HHXH 1ONQA 1FJ1B 1VSCA 4JFDD 4ZTOH 4MS8C 4DCQB 1WQVT 3K4ZA 3OBAA 2X05A 1GGIL 4LLYB 2HVKB 5KN5A 4O2EB 2ADFH 5EORH 4B50A 5SV4A 1XF3B 3FONA 3F65A 4P2QD 3SGEH 3G9VA 3VI3E 1TETH 2VDMH 3RVUD 3DX7B 4EKXA 2F74B 5C9JB 2NY1C 1A6WH 1LO5A 2O5ZH 4I0PC 5HHME 1NGYA 2VJXA 4Z7VA 3U46A 2R4RH 5FHBL 1QBBA 2Y23A 1MHCA 1RQ5A 1X5XA 4BUHA 1T7XA 4W6XB 5I8CA 5IJVB 3GEWB 4PJBB 5CUSL 3DO7A 1YEGL 4POZC 1CLZL 4TSBL 4P2OD 1M1SA 5DJ2A 1UJ3B 4QF1B 2IAMA 5IHBA 1RUQH 2AXHA 5DT1H 3QNZB 1IILE 4ZOAA 1Q9LB 4I2XE 4MNQE 4OZ4B 5HHPA 1BJ1H 5E03A 3ALXA 3F12A 2AEPH 4ZPVA 1XIWC 4M1DH 4HFWA 4M6NH 4YZFE 4AZ8A 5DMGD 1S7QA 4WI5A 2BX5A 3O3EA 3QEQD 5FAAA 4C59B 4Y19D 1UB6A 3FB8B 4UIKH 2ENSA 4Z18A 5EOCH 4XBPA 4WGWB 5FCUH 2B20A 5ID1A 1P7KB 2XFXA 4JFEE 2VZ3A 4XHJD 3E6FB 3D5OF 1FGNH 4MZ3A 3DUUB 1BQHG 1N59B 4IRSC 2R69L 3EHBD 2DDQH 4L29A 1IAII 1QG3A 3QFDA 3K0WA 3P11L 5KJRH 3VXQB 1KG0A 3UC0H 4P59H 3D69B 4Y4KC 4LCCC 4ELKB 2GY5A 4J3SA 4ODHL 3D9AL 1RHHA 1ZLUK 1A6AA 1KN4H 4WV1B 3EZ8A 1KGCD 5GISL 4YXKL 1DQDH 3EYFA 1WBXA 1YQVL 4I13B 1AE6H 5F9JB 2FATL 1FORH 4JN2A 5BZWB 4IRZH 4UT7L 2CRZA 4FFVD 1MFDH 2UZIL 4XB7A 5D1QB 5DMKA 4JRYD 2X4QA 3K81A 1UZ8A 1XT5A 1MCBA 1R5IB 3OF6D 4RIRA 1AC6A 4RAVA 2EECA 2IANA 1DN0B 5KVDL 3HNTH 3KPMA 1I9JL 3FOMB 3LQAC 4MCZA 1NC4A 1FPTL 2EC9T 3FOLA 1WZLA 1J18A 4QHMB 3DETD 4AQ1B 3PF2A 1BP3B 4Q9BA 1LEGB 5I8EB 2VNCA 2VN7A 3O4OC 2X2YA 3G5ZA 4C58B 3DMMC 4RMSA 5GS0D 4OCLC 3LSOB 2XZAL 5B4MD 5DFVD 2FJFB 3GSOB 4N9GA 3AUVA 2QQNL 4OLWH 1JNHA 1VFBA 1Q0YH 1M7DB 3L5XH 3T0ED 4JFDE 2JCCF 2A6DB 5C07D 1DEDA 3W9EB 1U95A 1G6RA 4FQHA 5C0AD 2VLJE 4CNIB 1HSAB 4R90L 4MA3B 5FUCC 3OV6A 4UQ3B 5HTSA 3ULVL 1MHHA 2H6PA 1JV5B 4EI5C 1YEKL 5DJXA 3CMGA 3S9DB 1R3HA 4X5LA 2P48B 5C09B 3GSNL 3TNNA 2VLMD 1A47A 4M1CD 1B90A 1QRNB 4KPHL 1AHWA 5MEQB 1RK1B 1P84J 3GIZL 4M9PA 3G5XB 1A3RH 3HPLB 4DUXA 4YNYA 1T20B 4KK9D 3OXSB 1QO3A 2BK8A 1FCGA 4MDJB 2GUOA 3KJ6L 2VXTH 4LEOA 1J5OH 1XCQA 4OBSA 2BC4A 5F9WB 3QFJE 1T0NA 1N6UA 4UZGA 5IBUB 5EA0L 4QHLB 4JPKL 5CZKA 4RGOL 3NCBB 3DVGA 4XMLH 1BWMA 4MD4A 4PGZA 1G7HA 3SKOB 3DXAD 4OFYA 3FQNB 3OAZH 5CLWA 4LSSL 3L9RB 4LNVA 1A7OL 5CJXA 1KF9B 3I3DA 3BO8A 5L8LB 5D2NA 2X10A 1OD7A 4L4TB 3RPKA 3WD5H 3VW3L 4LCYA 4M02A 4QTIL 4OLYL 4ZAKD 2ILLA 1NCDL 4C56E 1FL3A 3VG9C 1EAPA 3AY4C 3TBVB 3U0TA 3MJ8A 1DTUA 4QHNB 3CFKA 4MD0B 3LN5A 5HYFA 4DEPC 2V5RA 4X7SL 3ROLA 3VRJB 1N4XL 2CKBA 3ARTA 1X5YA 3RIFK 5J11C 1EXUB 3GMQA 1U8NB 5DZLA 4RGNC 1UA6H 3QIWA 4P4KB 3G08A 3O3UN 3QIBC 1JGUL 3TPUA 2WANA 4HPOL 2FGWL 4GRMA 4NO5A 4TNWF 5D7KE 1MCPL 2X9XA 1OD9A 4JRYE 3C60C 2PR4L 1P7QA 1A6TA 2NY4B 1HXYA 4HUKB 2NY7H 2CPCA 4G6JL 4KKLD 4DOHE 4NNYA 3SKMA 4O51B 1XFPA 4GFTB 2WUBL 4MXQC 4NZTH 4WFGD 5B3NA 1NC2D 1EIBA 2IG2L 4WCYL 2CIIB 1D9KD 5T1DL 3PDOB 1CFQB 5ALCH 4OF3A 2DWEB 3QPQC 1H0DB 4I2XA 4MNQA 3UO1L 1RFDL 3MR9B 2PO6C 4OCWL 5C2UB 5ISZD 3T0DA 4Y2DA 4M8VA 1RIUH 1BFTA 2AK4D 1HN1A 4KK5D 2GAZB 5F1IA 1BZ7B 4U1HA 5E0QA 4L9LA 3CXHJ 2YXFA 4H88L 1J1XH 4JFEA 1XF5B 1EO8L 3GMRB 3WFBH 3DI3B 1MI5B 3D39B 2UUDK 3WL9B 4DVRH 4PLJC 2EYTA 4U6XB 3QDJE 1H15A 4PRPE 1YNKL 4QRRE 4P2RE 3P40A 4ZTPH 5ACZB 2AS5M 4QHUA 5FO9B 5MEPB 2IMMA 2IPUK 1QNZH 5EWIH 3OKOA 5EZIH 1UM4H 4UQ2B 4PB0L 5TF1H 3CFDA 5EPMA 4FMFA 4L3EA 1L7TH 1OTSC 4LSDA 4HK3J 3C8DA 5EC1B 3STLA 3BGFB 3SDCB 1RD6A 1B0WA 2VDPH 4FQIH 5D8JL 1F11A 4ZD3H 4A6YL 1U3HB 1Z0MA 3IDMA 4L3CA 3EJYC 2VLRD 3V0WH 3VWKB 4IIQA 2CGRL 1TJGH 3IFOA 4MJ6B 2EDWA 3HZVA 4R3SB 1I3RB 3IDUA 2Y5TB 3C5SB 2IFFH 4HWBL 3B3IA 5TF0A 3RGVD 4JQXA 4ZS6C 8FABB 5TDNB 3B43A 3VXRD 1GC1L 3RHWF 4KUZL 1DR9A 4YBHA 1VFOA 1YUHB 1GZQB 3O9WB 5I1DA 1E27B 3UJJL 3CK0H 1BVLB 4MJ5B 4XPHH 1FZJA 3NABH 5DRZA 5IB1B 3VMOA 3SDYH 1TZHA 3VGAB 2APWA 2R39A 5FA3A 2JJWA 1OP5H 4BH7A 4JCLA 1FGVH 4GAYB 3BI9X 3IJHA 2V7HB 5SWQB 4NUGH 3WIHA 1YEJH 3P0VL 1FVCB 2AP2A 4OZIE 1A7PL 1NUGA 3O0RL 3VWJC 5D72H 1J05A 2VZSA 1FO0H 4JFDA 5FUZH 4NT6A 4KWUA 2A77H 4X99A 1KCUH 3MA9H 1F3DH 4OIIH 4KJPC 3PIQB 2GSIB 1FC1A 5I17A 3V8OA 4BSWA 1D5BA 4L5FL 4TVPD 3RWHA 2EEDA 4E5XB 5HYSA 4NWUH 3X12B 4CJ0A 4Z7OE 1DSFH 2IGFL 2NXZC 4ONOA 2IALB 1BBDH 4OGYH 9CGTA 3SBWC 1ONQB 5EU4A 2OR9L 1AXTH 5BV7B 4HEME 5EBLA 3NH7L 1XEDA 4XPBL 4WVRA 3RNKA 2R23A 2WV3A 4QRPE 3QFJA 4FFYH 2W38A 3KPNB 1J0JA 2H2SD 4WFGE 3AS3A 4OUOA 1CN4A 4FG6D 5GJSH 3IF1A 5E8OA 5CZVL 4ODTH 4QY8B 4E41B 4EIGB 3IJYA 3H8NA 5HHOE 1VGKA 3RWIA 4DN4H 4MB3A 1HQRA 3NTCH 5TPWL 3MV9B 2ZKHL 5D1XC 2A73A 4Z7VB 3U46B 5TH2A 1JI1A 4XCCL 4YHYB 4Z7WE 5IF0A 4GXVH 2AK4E 4PB9L 5FGSA 4C56A 1QHPA 1AGDB 3GDBA 1GGCH 4PJCE 1MJ7H 3DO7B 4PPTA 4XPAL 2FBOJ 3ZKXB 2XKUA 3LAFA 3VFUA 5C3LD 3MLYH 5DJ2B 1X3DA 1WEJH 1G0YR 1JVKA 2DQJH 2DQDL 4WJ5A 1U2HA 3SY0A 4X5XA 1BVKA 4QXUL 4YPGA 1Q72L 3N1QC 4LCUA 4CVZA 3F7QA 4BFIA 2ITDA 1ZLVH 3TZVC 1VPOH 1EFXB 4M7LL 4ZPVB 4HFWB 2EDLA 3P73A 1XGPB 4D9RD 4F9LC 1S7QB 1H3XA 1E4JA 3LEXA 4P48A 2D7NA 5D1ZC 1UQSA 2AXGA 1QR1A 1BD2E 4OD3L 4DUWA 3PHSA 3D87B 1NLBH 5EBMA 5ID1B 2XFXB 4X0KA 4OGAC 5BV7H 3AU1A 4JRYA 1DL7H 3QEHA 1U8HA 3DROA 4L29B 3QFDB 4ZUVB 1KG0B 2DI7A 3MYZA 3CIQA 1RHHB 1A6AB 1F6LL 2V9RA 1WBZA 4YXHH 2IH1A 2D7QA 2APFA 3E3QE 1EHAA 4JN2B 4O2FB 3LEVH 4WU7B 3CFBB 3SDDD 3U7YH 3MCKB 5DMKB 2X4QB 3BE1L 3S35X 1UZ8B 2LVEA 4U6YA 4BELD 3V9FA 4RIRB 2IANB 3OJDB 1FHGA 1AGBA 1FYTE 4W4OC 3VXUD 3T0EA 3BAEH 5CEZD 4FQLL 4MCZB 1NC4B 4NYLB 1BMGA 3FOLB 2PXYA 5E8EA 1ZT4A 3ARBA 3IKKA 3LH2H 2VDRL 5E2VH 2MQ3A 5GHWL 5ABDE 3TCLA 4YH6A 3RJDA 3G5ZB 3QDJA 1QPXA 4PRPA 1A0QL 2X89D 4QRRA 4P2RA 3EO0A 2QQKL 4AENA 4N9GB 1WIOA 3OPZL 4JQIL 2WQRA 5TE4H 1EFQA 5FGCE 3L95B 4DTGL 2B1AH 3PL6C 4G7VL 5M7QA 1NAKH 2ICWA 2EDNA 1S9KC 4W4NA 5C86A 4LVNC 5HDBF 2A6KA 1U91A 5ILTL 3H42L 1U95B 4X9HA 6FABH 4ODVL 1QSFB 4RAHA 4FQHB 2F5BH 5KSAD 3MOBL 4MVBC 35C8H 4HIJA 5T5FH 3O6MH 1NBQA 1MHHB 2H6PB 2W0KA 2HRPL 5DJXB 3FAWA 4IMKC 5IW6A 2RGSA 1D5XB 3MBEC 3SE3A 1R3HB 5IROA 2XXCB 2EIDA 4JPVL 3KYKH 1SY6A 4EXPX 2AGJL 4JO1H 2GJJA 3GGWB 1TQCC 2HT2C 5E2UL 4PRHD 3DBXB 4PJAF 3BPOC 1Y6NR 4KTDH 4OSUH 2FJGA 4YNYB 1QO3B 5DXWA 2OJEA 1YY8A 1F6FB 2GUOB 4NQSB 4LEOB 2VDQL 1XCQB 1CXLA 1VCAA 1NJ9A 2A9NL 1FVEA 2EZ0D 1MNUL 1YZZA 3GMLA 4N0UA 3DVGB 4OZIA 2DQUL 2D7TL 4YDLC 1G7HB 1CDBA 4LCIH 3MREA 1AO7E 5D5ME 4WNQB 3S3SA 1BQLL 1ZMYA 5ADPH 4HMCA 1A4KA 1BFOA 1Q1JH 2D3VA 3LKOA 1LO2H 3BO8B 4U6VL 5D2NB 4HZLA 2APTA 1I3UA 1S78C 4WDIA 3VXSD 4LCYB 2GITA 1NFIA 1FL3B 2EDXA 1SM3L 3DO3A 2HVJA 2AERT 4LGRB 5GZOD 4MNGE 3U0TB 2NY3C 2ZJSH 3UDWC 3CFKB 5I19L 2FRGP 2DAVA 2YD5A 1QLRB 3V7MA 4OAWA 2Z4QB 4XC3L 2N4IA 4N9OB 5SWZE 1MWAA 3MRDB 3ROLB 2Y36L 1NAML 4YFLI 4YHML 4HUVA 2VKWA 3FQXA 2CQVA 1JGDB 4JFQA 1G9MH 4NO3A 5INDA 1A2YA 1ZLSL 1MCOH 3QIWB 1P84K 3QIUA 5A16A 5E7FA 3G08B 3MJ9L 4Y4FD 5I1HH 32C2A 4N8PA 2CRYA 5IHUL 4ZOBA 3TPUB 1PY4A 2W0LA 4LCWE 2B4CC 4HGMA 3DTXA 1PSKH 4G3YH 1AH1A 1QD0A 3H9YA 2NTFA 2OTPA 3IDGA 4WEMB 4NKDA 5HHOA 4QYOA 3L3HA 2DD8H 2VSCA 5MHSD 1CFNA 4WIQA 4JVWA 1J0HA 1P7QB 1F2QA 1NPUA 4O02H 4FABL 1TVBA 4Z7WA 4HFUH 1EEZA 2AK4A 1NBZA 1K5NA 3OJVC 3TP4A 4NNYB 3SKMB 1N64L 2DLFL 5DEZA 2P44B 4PRID 3N85H 1H3WM 3ZE1F 2P8PA 1HNFA 5CHNA 1OARH 5IVXF 3W11C 4TUKH 2Z9TA 3GM0A 5FYLD 4JRXE 4I2XB 1IGJA 4MNQB 3T4YB 1JHLH 2ED8A 1U9KA 1ODAA 3VFPA 4IRJB 1IGYA 2P8MA 5HHVL 5B39A 5J12B 4CW1B 1IM9D 5F7UA 5EU7C 3SKUD 1U8KB 1MOEA 1BIHA 1BD2A 3BKML 4OTXH 2HTLD 4U1HB 2NZIA 5C0RL 4L9LB 2YPLD 4Z95H 2PYEE 2VLRA 2ZG3A 4ETQB 5IT2L 1X7QA 3OHXA 4JFEB 4ZUUA 4WO4D 3TVMC 1JRHL 3KG5A 1D5ZA 4LEXL 1U92A 1FNSL 1BJ8A 2QHLA 4M6OH 2WZPD 4KROB 4QEGA 1H15B 5EZOH 1JWUA 3J7HA 3VXRA 3MTRA 4QHUB 3X11A 5CMAA 2E5EA 1UZ6E 3CFDB 1V3LA 5EPMB 4L3EB 4PRHE 2VC2H 1X5IA 3STLB 1IGML 1F2XK 4GLRI 4MAYC 2BCKA 3PWLA 4L8SC 3IDMB 5EH1A 4TNVF 2A6JA 3MLTA 4YXLH 4L3CB 2MJWA 4OQTA 5BVJA 4JHBA 5KVFH 3WS6A 2R56L 2W0PA 3BW9B 4PRDB 1H3GA 4IIQB 4P46C 3BH9A 3IFOB 3HC3L 5HGAB 3DV6A 4R26L 4HLZH 1SYVA 3LY6A 1OWRM 4BKLA 4MMZC 3B3IB 5CSGA 1HCVA 1R3LA 3L3JB 4WFED 1FYTA 1T83C 1BGXH 3T1FB 3K1KC 3ARGC 5IBUG 4BQ6A 3P4NB 1NMBH 5I1DB 2FSEB 1LP9F 1QSEE 4NZRH 5IG7B 4CU7A 1TZHB 3BOVA 5HPMA 3QRGH 3MRIA 5FA3B 2B1HL 4LBEA 4BH7B 3CXHK 3G6JE 3CXDH 3S8WA 3MRCA 3IJHB 3MRMB 4JCMA 5IMOA 5CD5D 4NQED 3VA6A 2BNRE 2YPVH 2VDLL 4J3XA 3SCMD 1PQZB 2NZ9C 3QI9D 1J05B 4KK6D 3BZEB 4JFDB 3DRTA 4NT6B 1F4WL 3LD8B 2QQLL 4NQTA 5D96C 4ZUSA 3ULUC 5TFSL 4WWID 4HX1B 4X99B 5KAQF 2W59A 2YUWA 3UCRA 2VR9A 2JKXA 1J0KA 4IOFC 5I17B 4LSTH 4BSWB 4LKXA 1IAKA 1D5BB 4P2QB 3RWHB 5HYSB 3TYFA 2P7TA 4PJ8C 2N1KA 5IIEA 1NCCH 2W65A 5EU4B 4JHWL 2ATPB 3WNMA 3DIFA 3CZJA 3KNBA 5EBLB 4NUJA 2HFFA 3RNKB 2R23B 3RAJH 2VIRA 5KVEH 3O6KH 1M7XA 4NM4L 3ARDC 1CTOA 2R1XA 4P2OB 1U8PA 3U4EA 2YRZA 1I8LA 3ZT7A 2GK0A 7FABL 3IF1B 5E8OB 3N1GC 4F37F 5F7EH 1BQSA 1AO7A 5D5MA 5L88H 1EHLL 1LK2A 4N8VA 5KSBB 3IJYB 4GBXD 4OCSL 4PR5A 1RZKC 1ZVSA 3VFOB 5B38A 1VGKB 1HQRB 3FB7B 2EYRA 5FYKD 3DURA 2A73B 5TH2B 4O4YL 5IF0B 2QSVA 2EDHA 4HWEH 4C56B 4NQVB 5K9JL 4Y19B 4MNGA 4PGEA 3ZE0F 3QHFH 1IKFH 4JY4B 1IBGH 4LAQH 4WJ5B 3SY0B 1T6WA 3KPPA 3V5KA 1BVKB 4YPGB 3QCTL 5TGBA 2NY6D 2BDNH 1FNGB 5GRZA 4X9GA 4LCUB 1B0GA 4CVZB 4BFIB 1F8TL 5I8KH 2ITDB 3KLDA 5I66A 3LEYH 4JAMB 3P73B 2XNAA 3L6FA 4RISL 1LE5B 2XYCA 2Q7YA 3HR5B 3LEXB 3PP4L 4LCWA 4OLXH 1QR1B 1YEIH 5JTWA 1EDQA 4QOKD 4J8RA 1A7NL 1NSNL 5EBMB 4TUJB 4X0KB 2FEDC 1V3KA 3HFMH 4QXGH 4JRYB 3QEHB 3ZL4L 3AB0C 3KS0H 1U8HB 3DROB 3O3AA 2AVGA 1SEBB 4DOHB 3IETA 5K9QG 1NBVL 1DQML 3NPSC 3Q6FA 3ZSSA 2YA0A 5D6DA 4FNLL 3OAUL 1E4WH 4OCRH 1GZPA 5BS0E 1A02N 1WBZB 2XV6B 2IH1B 2RIKA 3GSVA 5FK9A 4JO4H 3BGMA 1JNLL 2VDOH 1R0AL 4HJJH 5I1CH 3LQAL 3OSKA 2X89A 2R4SH 4YHKL 2BJML 1EK3A 3GKZA 1OSZA 5HYJE 5IBLD 1CGVA 3SDAC 3AROA 4XRCB 3JVGA 4U6YB 2H1PL 5CILH 3CVHA 5GGRB 25C8L 5I73B 5F6IC 5B8CA 3T0EB 3V7AE 1A3LH 3U7WL 3T0WA 1KJ2H 3O8XC 1QKZH 3VG0H 3T4AA 2O61A 4X9BA 2PYEA 1ZT4B 1LQSR 3ARBB 4K3GA 5C0AB 1LO4L 2AQ2A 4LSUL 5EN2A 5F1NA 3QCUL 2FR4A 5I75B 2AEIT 4WW2C 4UNTA 1IZJA 5FV1L 4NRYA 4QRRB 5T3ZL 4GS7C 2DMCA 3O2DH 3GO1H 4NC2B 4GKOA 4WY7L 4AENB 4OF7A 1A6PA 3CSYB 3DX6A 3OZ9H 3QUXA 4PRHA 1I1YA 5D7LE 2D2OA 3OAYH 2ICWB 3U0WH 5EU6E 1UGNA 4U05A 5ANME 5KVGL 3RVWC 1U91B 1I4FB 1T2XA 2VZTA 1MEXL 3M17A 4XHQA 3TF7C 1T7WA 3W39B 1N3NA 2X70B 2NX5E 4WI4A 4K9EH 4UMGA 4V2CB 4DKDC 1UWGL 1KFAL 3BPLB 5IW6B 1EA9C 2LTQC 1HWHB 3BT2L 3DXAB 4Q9QL 2Z91A 4MQTB 2ZG2A 3RA7H 5E5MA 1RPQA 3LOWA 1IGFH 4WEBH 2VOTA 1QSEA 1BX2B 1QACA 3EFDL 3CLFL 2HKHL 4ZAKB 5GS0H 1IQDA 3NAAL 1YY8B 2OJEB 1CK0L 5BZDA 3G6JA 4N1CA 1L0YA 2D03H 4YZFF 3HI6H 4JFXB 1FVEB 5DK2B 2BNRA 1IAIM 1IKNC 2ITCA 2OZ4A 4N0UB 4OZIB 4GAGH 4UV4L 1KEMH 1JNJA 2CLVA 2OI9B 3PV7A 2X4TB 1BFOB 2QQQA 3LKOB 2ZSWA 1XR9A 4CU6A 4HZLB 1I1AD 3C08L 2GITB 2YD4A 1NFIB 5DEFB 5KS9E 1B4RA 1JK8B 1J1OL 2EDBA 4CKVX 3S96A 1YN7A 5KG9A 3UEZA 1DVFC 1NUNB 1JTPA 3CSBA 3L1OH 5L2JA 2VH5H 1CGSL 3QCVL 2F53D 3HG1D 2G5RA 2ZPKH 3GHEH 4X4XA 3FQXB 3LMJH 3RKDD 3ULUF 4JFQB 1HNGA 4OCNC 1GGUA 4LVHC 3MRHA 4NO3B 1KTDA 2GEEA 5IBTH 4XNZB 4N1EA 5KAQG 5C6TH 5CSZA 5A16B 1NC2B 1G7PA 32C2B 5ITBH 1UJ3C 2VQTA 4LIQL 2DJSA 4JG1L 1TDQA 4QLRA 3DTXB 1MRDH 4G43A 1UH4A 2NTFB 1CIUA 1CYGA 4YWGL 4AH2A 3RWDA 5JZ7C 3IDGB 5FYKU 3TFKD 4NKDB 1JTOA 1MCCA 4QYOB 1CDCA 3L3HB 5IJKA 4OM0L 4YDIH 3VE0A 1TVBB 1E4KC 3O6FC 3ARZA 1EEZB 2AK4B 1NBZB 3DGGA 5LCVL 1AXIB 1K5NB 1WIUA 1BFVH 5E9DE 4DAGL 2X1XR 1P1ZA 1ZA6A 1CDYA 3U1SH 4K71B 2P8PB 2G9HA 5CHNB 4WO4A 1CTNA 5A2LH 1TZGL 5GSVA 3QUML 3OKKA 3WIIL 4XVSL 4OLVL 4UINH 1IGJB 1PLGL 4V2BA 1LD9B 3VFPB 4ZFOA 1IC4H 2ZCLL 3FN3A 3HI5L 2ZUTA 4O9HL 1ORSA 5HD8C 2P8MB 5B39B 1IC5H 4WV1C 3R8QA 3X3FL 3TGXA 4ORZC 5JOFA 5CBEA 3S35L 3W2DL 2VLRB 3ELAT 4I77H 5D1QC 3B2VH 3CDGA 4WUUE 1X7QB 4ZUUB 3TC9A 1D5ZB 3OX8A 4POYA 1U92B 3ULVE 1X4YA 4P9MH 5D7JC 1BM3H 5I1GH 3ZTNH 4ZUWA 4G5ZL 1MRCH 1JWUB 2UYLA 2H3NA 1Q0XH 3RTQD 4S1QL 3VXRB 3SEPA 1KULA 5CMAB 1NGPL 3GNML 4HJ0C 5BS0A 4OKVA 4RSVA 4HGWA 4N0RA 2VE6A 4RZCA 2OL3B 4X7DC 4YFDB 4CDHA 1P4IL 3BJLA 5C08D 2BCKB 3EOYG 3PWLB 5EUKA 2ARJQ 2YD1A 2A6JB 3MLTB 3NCJL 4FQCL 5D9SB 1PKOA 4XCFH 4HGKC 4P5KB 3MMEA 3MV01 3BH9B 3BDXA 1B2WH 2HJKA 2IQAA 3DV6B 4PGBB 3S5LA 1IGIL 1SYVB 4FQXD 4BFBD 4BKLB 2RB8A 3QQ9D 1IEAB 3ZDYE 3SCMA 4G6AD 1R3LB 1X44A 2J6EL 4JO2L 4WFHE 5DVOA 1U3ZA 5GGUB 3WNPA 5GRVK 1IFHH 3JWDL 1IC1A 2FX9H 3IDNA 5JIKA 2CIKA 3H2WA 4TRPL 3OJ2C 2IFGA 2J2ZA 3MV7D 1OM3L 5HPMB 1T03L 3HR6A 3MRIB 4XCEA 5DMIL 5E1AB 3MRCB 4MA8L 1JPSH 5IMOB 5BJTB 2E27H 4TN9A 4W81A 2F53E 2YWYA 5FGCB 5T1LD 2FX8L 2XY1A 4K23L 3HG1E 4XNXH 2IPTH 4J6RL 5CEYA 3LN9A 3QQ3B 1DANU 5EU6A 3DRTB 5ANMA 5DWUL 4H25B 4L4JA 2ZCKL 5F9WC 3OKEA 3D0LB 5HDOA 4NHCH 5DI8A 1E6JL 3VXPB 3GBLA 1A6ZA 2NX5A 4WW2F 4LKXB 2AABL 1IAKB 3MRLA 1I75A 1S9XA 1PYWA 3CPLA 1T7ZA 1PG7X 2QSCL 2DQEL 2AJYL 2P7TB 3D85A 3QG7L 4GBXA 3EOAA 2OL3H 3AMKA 3DYMA 3SN6N 2OTWA 4F57H 4EN3C 1PY9A 1ZLUH 3PJSA 4HC1L 2WNGA 5C0NC 3ET9F 2AJVL 1Z9SA 3KNBB 4J4PC 2HFFB 4NUJB 4XVJH 2H2PC 1QLEL 4JZJB 5IFAH 2IQ9H 2VIRB 3CMOH 3QDMD 3BRGC 4FQ1H 5DO2C 1C5BH 3KXFD 2VXUL 2R1XB 1U8PB 5FECA 3FFCE 4Y2OA 2GK0B 4H0GA 4HLZG 1WFOA 1LEKA 3Q1SL 4QKXB 1I9RH 4L4VD 1NLDH 5D5MB 1CDHA 1P2CA 4HKZA 4N8VB 4AEHL 1Z9LA 5AG9A 4PR5B 2A1WL 1ZVSB 5DMJB 4GMSL 4DJMA 5B38B 2DKUA 4RAUA 3UTTD 3V4UL 4P4KC 4J3UA 2VXQH 2FL5B 4P49A 1S7TA 4TVPH 1VDGA 3WEXA 1YEDA 5KS9A 1ZANH 2ZP0T 5JR1L 1F13A 4FQQB 1OAXL 2XN9D 4MNGB 1OAZH 2XICA 4PGEB 2YA1A 4NHUA 2ICEA 3IDYB 2EKJA 4NO0D 3UPAA 5F9DC 4KVNL 3MXVH 4KI5D 2NY4C 4XVUD 1R5VB 4Y16C 1OCWL 3KPPB 3V5KB 3ZKNC 1UCBL 4BZ1L 5TGBB 2QL1A 3ARFC 1AKJD 2BHYA 1AQDA 3KPOA 1B0GB 2XKNA 3VFTA 1OL0A 4APQC 2WWMD 2YN3A 5I66B 1S3KL 3FZUC 3L6FB 3T0BA 1Z9MA 3MACL 3QA3A 2Q86B 2Q7YB 1UM5L 1DLFL 3V2AR 4J8RB 5F71A 1ZHBB 3NCEB 3B9KD 4GQ9L 3EYUH 2YR3A 3L3OA 5FOBB 1UKSA 3BJ91 3AS2A 2BVEA 3HAEA 4I3SH 4D94A 5JO5A 3BMVA 3KJ4C 5AZ2H 2QJDA 3O3AB 4BZ2L 4GSDL 4XXDA 4AK1A 3MNVA 4RFEB 5E9DA 2J4WL 4OZFA 5C0EB 4P9HH 2VTFA 3CGTA 3ILQC 2FNBA 4OZIF 4MAUL 1GZPB 2R2HA 3JUYA 1LNUA 3MROA 4PYGA 5JXEC 3HE6A 3GSVB 5E4EB 1MIEH 3BGMB 4LSPH 3MODL 4DKFL 1P5VA 2BMKB 4OF5A 3TBTB 5CWSB 3ZE2E 4Z7NE 1OSZB 1FC2D 4OLUH 4N5ED 1HZHL 4M61A 5CJQH 5DDHB 2SEBB 5FFLA 5B8CB 5E24E 4YHOL 3SE8H 4TNWK 3L7EB 5HXMA 5GRXG 3H9ZA 3QXWA 3WN5B 2PYEB 3VWKC 4WUUA 3W5NA 3D25A 2UV3A 2Y9RT 5KSAB 3DX9B 4NGHL 1M71A 4C83A 2FR4B 3VRIA 2EDOA 5BQ7A 5EO9A 2VISB 1UXSA 1GGYA 4I5BB 3SGDI 4S11A 2E7CA 5IEHA 3GSNA 1QEWA 4NNXA 1KBGL 2JJSC 3SOBH 4XP9H 3VGEA 2EH8H 3HZMA 2C3XA 4MCYA 4L3AA 3QUXB 3H9SE 4PRHB 2ERJC 2FECI 2P43B 1IGCL 3DVFA 5DURD 1I7ZA 1Z3GH 5E5RB 5J7CC 2X41A 2R1WB 1WTLA 3QG6A 1I85A 3HC4L 3KXFE 4Z7WF 1N3NB 4NFDA 3BZDA 2XWTB 1LMKA 3FQWB 4PJCF 4MWFB 3PWUA 5DZOA 5E5MB 1BF8A 3EO9H 3F8UB 3LIZH 5IR1A 2NY5H 4QRSA 4I4WA 1KXQE 5ALBL 3IXAA 2X09A 1QSEB 3H3KA 1ZA3A 1X5LA 1IAOA 4WI3A 4WWKD 3VDBA 5CCKL 1CLYH 1CICC 4NN5C 5ADOL 2R0KL 4RFNB 3HCVA 4JGMA 3P4MA 3LRGA 5BZDB 4W70A 3G6JB 3IAGC 2ZZUT 3LKSA 5A2JH 4R0LA 1X4XA 4PRNB 1NCBL 2QR0B 2VZOA 4YFEA 4N0YH 3GSWA 4DN3H 3G6DL 2ITCB 3BQUA 2F53A 3HG1A 3BZ4A 3HNVH 3OKDA 4G6KH 5HGDA 1OAKH 3BESR 1CR9H 2CLVB 2EEBA 4GMTH 5FYJL 4HIHB 4LRIA 4IDLA 2ZSWB 1OB1A 3TO4A 4N5UA 1D3CA 3W81A 4IS6A 1EGJL 5I9QC 2I25N 4P5TD 4FQ2L 3MLUH 4IDJL 4Y4HD 4Y4FB 2UUDH 3V6FA 3TCXA 5HYEA 1IT9L 3RHWK 4NJAL 2LFGA 2ZOLB 1NGXA 1KPRA 3MRPA 3S96B 3O3DA 5K9QI 3BDYL 3N1PC 2Z8SA 3WNNA 2Q8AH 2YRPA 1DBKH 3PWJA 3L5IA 4GT7A 3VD4A 2GHWB 2B4CL 1MIMH 3OWEA 3GKWL 4ESKA 3MRHB 2YC1B 3BP6A 1JPST 5HI4D 3SGKA 2J8UE 4PRIB 4F15C 3ZKXC 3ZYZA 2IF7A 4R7NB 2VDKL 4Q7DA 5L6YH 3NZHL 3FFCA 3WFHA 1T3FB 3HB3D 3ORJA 4LRNL 5A1AA 1MFEH 2MCPL 1OAUH 1KCVH 4G43B 4LPYA 1RY7B 2X9YA 3RWDB 1CLOL 2QV2A 4MJ2A 4G9DA 4S1RL 3WXWH 4M62L 2JJVA 5IKCA 4FQPA 4C55A 5L2KD 4WI8A 3FO9A 4FXLA 3VE0B 1RUAL 4FFWD 4ZODA 5JPNB 1CVSC 1IM9B 3DGGB 1U36A 1XF1A 1WZ1H 2EYSB 3JV5A 3FT3A 3LV3A 3OKNB 4H26B 1YJDH 1L7IL 3BZFA 1ZA6B 2WBJC 2YPLB 5T1KD 3CFCH 2G9HB 4PGCA 1IAIH 2V9TA 3O11A 4WO4B 3FMGH 1F58L 5IWLC 5GSVB 4OCXL 4DQOH 3OKKB 4OB5L 1A1OA 2AK1H 1A7RL 4H8WC 1XF4A 4NN7B 4NNPH 1YEHL 3GSQA 4ZFOB 5A2KH 1P4BH 1A6VL 1V8HA 4LNRB 1MLBA 4P3CH 4Q2ZA 5DLML 1NDMB 4I18B 3RL2A 3QDGE 4O58L 4A6YA 3P3YA 2CJUL 5LGJA 4NFCA 3LS4H 5DD3H 2N7AA 2RCSH 2J88H 4G7YH 1K4CA 4MX7B 5CBEB 1UVQA 3CDGB 4UV7H 4XMPH 4KJYA 4XNQA 1NFDE 3OX8B 2PTUA 4LLQB 5C3TA 4ZUWB 5ICZB 2DL2A 3WXVL 1CU4H 3U6RA 3EYVB 3MCG1 1MCQA 2UYLB 2H3NB 4XC1L 1N0XL 1CLCA 1FLRH 5JW4Q 4R2GB 4PJFE 3T0XA 4G8EB 2VL5A 3WCYA 2C3VA 3OGOE 3O45B 4OKVB 5FYLH 1PZUB 4OZGE 2VE6B 3QQ4A 4RZCB 4RCAA 5D5MF 1CQYA 1RZJC 4Y5YA 3SE9L 3BSZL 1UCTA 3R06A 3TN0A 1ZTXL 3B5HA 3LQZA 2C9AA 1FNAA 4U0QB 5HYIA 4R4FH 3JXAA 2AJUL 4W68A 4OJFL 2FO1A 2IQAB 3MLRH 3QWRA 5DTFA 1BBJA 3T8XA 3S5LB 1LO3L 4KHTL 5T1LA 1WCQA 3SCMB 2B0SH 1JNNH 5J57B 1AY1L 3MV8D 1SJXA 3PE9A 2LU7A 2XI9A 2AJ3A 3TA3A 4C54A 3QT2A 1G9MC 4U3XA 4H20H 3IDNB 5ELIA 3DVNB 1DLHA 2BVOA 2CIKB 3MXWL 4JDVA 3ULUL 4XCEB 4R8WH 1INEL 1TCRA 4NKOA 3MLVL 5JOPD 3ROOB 4OV5A 5IQ9A 3BMWA 4WHYG 1SMAA 4TTDD 2G60H 1JGVL 3H9SA 1HI6A 1A21A 2EDQA 4AMKL 4H1LA 1T6VN 4P3WA 2ADGA 5CEYB 4ZNCD 1VFUA 3I6GA 1N26A 3LB6C 3B9VA 5TQ2H 5ANMB 4IMLA 3S37H 3LKRA 3BWAA 2FO4A 3AAZA 5IB4B 3KGRA 4JDTL 3KXFA 1A6ZB 4HPYL 3FKUS 3H0TA 5EDXA 3U9UB 3MRLB 3VGHA 3ZT6A 4BUGA 4NRXB 3X13B 4Y5XC 1PYWB 3CPLB 5JQ6L 2BRQA 3ULSA 4WTXA 3LRHA 3W9DA 2EO9A 1Z2KA 3D85B 4JPWL 4GBXB 5L2KE 3PJSB 5MERB 3IFLH 3ALPA 4Z0BL 4PS4H 3INUH 3SE4C 4FTVE 1FP5A 2FB4L 4RX4D 5DJDA 1OAQL 3Q0HA 1B88A 3DHJA 2NY1D 3KYOA 2XN9A 1RZKL 2E7LC 1KELH 2NTSP 3FL7A 3GI8H 1E28A 3B9DA 5F7MC 3FN0L 1OSPL 1MVUA 1AFVH 3GRWL 4LGSB 4TUOA 4XVTL 2I5YH 5FECB 4NO0A 5J6GB 3VFSA 4D2NA 4N1HB 1LEKB 3SJVD 4DKEL 1UWEL 3NCMA 4JHZA 3B9EA 4ZNEE 3PWPD 1N7MH 4XNYH 2DQCL 3JV4B 2QADC 4RWYL 5HJ3A 1RZ7L 1M05A 1Q38A 2EC9U 1I7UA 1S7TB 3QEUA 3QDAA 1YEDB 3WEXB 5C71A 1BQUA 2C4FT 2WLYA 3S88L 4XP5H 4PLKC 4CJ1A 3B9KA 1UZ6F 2APVA 5GRJL 2ZUYA 3E6HA 2ICEB 5B39G 4X98A 3MLWH 1F42A 3W5MA 1IC7H 1A9EB 3AS0A 1GGIH 5AYQA 2OMBA 2OP4H 1RUKL 2IBZX 3KPOB 1V7MH 2F5AL 2XKNB 2XRAH 1GIGH 1LGVA 1MCRA 2J8UA 4R9HA 1FAKT 2VSDA 2J5LB 5DC4B 1ES0A 3O2WH 3X3GL 4IRSD 2Y07L 4ELME 5IM7A 1B3JA 3HI1B 2P1YA 5L7XL 1S5IH 3WFCL 2YS4A 2DWDA 5K9KA 5FYKH 3P9MA 3L3OB 4PJIE 5DC0A 5FHBH 3QUZD 4JANA 4HIXL 4IRJC 1SEQH 3C6LA 3HAEB 5J12C 3U48A 4WHDA 2KKQA 2XKSA 5CUSH 4XXDB 5T33H 1GJIA 4OZFB 4JKPL 2ED9A 1KN2L 4KRPC 3BYTA 4PG2A 1H5BC 2AXFA 2DIJA 2R2HB 2VL4A 4YE4L 1A7QL 1LNUB 3MROB 3STBA 5D2LB 4XPFL 3U36A 3HE6B 3FO0L 2DI8A 3MO1A 5EU5A 5HHXL 4YIQA 3MJGX 5IFHL 1JZ6A 4NKQB 3UJIH 2J12B 4ZTOL 4B53A 1MREH 4M61B 4PJ9C 4AT6A 3S4SA 2I9TB 3S7GA 2ADFL 2EE9A 4GH7B 2EDFA 2AAVA 3QDGA 4PRAA 2EO1A 4PJEE 4TQEH 4UOW0 1KIUA 4HBQA 2Q8BH 1FL6A 1TETL 1WCBB 4M3JA 5E8PA 3D25B 3UTPD 3MUZ1 1NFDA 2JIXA 1M71B 4NQXB 2O5ZL 3VRIB 5BQ7B 2D9QB 4Y1AD 2V2XA 5F7LB 5T3ZD 1UXSB 4YBLB 5CS7A 5IEHB 2GT9B 3GSNB 1QEWB 1YC7A 4NNXB 2B5IC 3GJFA 4PJFA 5AAWA 1YQVH 4Q6IC 5E00A 1NEUA 3HZMB 4MCYB 3RZCA 3VGBA 2CR3A 5B3JE 5J3HC 5ESAA 4CVUA 1I7ZB 1RUQL 5DT1L 4F7EA 8CGTA 3DHMA 5H94A 4D9QD 4NM8L 5H35A 1M6OA 3F6LA 1CF8L 4OZFH 3B9AA 3RWGA 1JE6A 2AEPL 3SJVE 4M1DL 3MBXL 1NGQH 1IGTB 3QNXA 1FPTH 4M6NL 4N0CD 3VA2C 1YEFH 3PWUB 3LD8C 1RIHH 4G6MH 2VO5A 4KQ4L 3EYOA 5IR1B 4ODSH 1RUPL 4I4WB 4QRSB 4UIKL 1OT2A 4XBEL 4XI5D 1YNTA 5EOCL 2D31B 5FCUL 3M07A 4I3RH 3GBNH 4OD2B 1T66C 4N8VG 3NN8A 3PGCB 1FGNL 3QISA 3HCVB 3P4MB 4MLSA 5B38G 4PD4J 4E9LA 3TYGH 3LKSB 3TH2T 3MYJB 5KJRL 2V2TB 3GI9L 5D7SH 4P59L 2ZUUA 2F53B 1NAMA 4TNVK 4X83A 3HG1B 3BZ4B 2C7UA 3OKDB 4KKNA 1KN4L 5HGDB 3PWNA 2YK1H 4JFZH 5IMKA 4BQ9A 1QRND 3TT1H 3OB0K 3B8SA 1AE6L 2XWBB 3PHQA 5E8NB 1OB1B 1FORL 4IRZL 5LG1A 3G6AA 1MFDL 3AM8A 1I3VA 3MJ9A 5EZLA 4P2OC 3N1FC 1G84A 3V6FB 4NQCD 3A6BL 4XNMA 1NBYA 4GW4B 1INQB 3NPZB 1NGXB 5FO7A 3RBSA 1RUML 2F58H 3MRPB 4HUUA 4RGND 5I1EH 3O3DB 1T7VA 3HNTL 5C0GA 3RWCA 4D0CB 4OLZH 3MLSH 4HJGB 3FQUA 3QIBD 1REIA 5L2KA 3PWJB 4PRBA 4FTVA 1S9VA 1FCCA 1NCWL 3BP6B 1BJ1J 2VAAA 4JHAL 4FS0A 5K59E 1AGEB 3RI5F 5T1KA 4XHJC 3FFCB 3WFHB 3IRZA 5CIPA 1W72B 4M4RA 5DD6A 5TDOA 3BP4A 4X6BA 5MI0C 2J1KA 3V5DA 1UB5A 3ZDZF 4OLWL 3EHBC 4ZNEA 2QEJA 3L5XL 5HI5D 4ETYA 2FLRT 3CJJA 4G9DB 4OLYH 5FM5O 5IKCB 3FO9B 3VD5A 1T21A 4D8PA 4F2MA 1FFPA 1ZWIA 1TITA 4YK4B 4KDTA 3QQNA 4K94H 1XGUA 1LVEA 5BRZE 3FT3B 2PO6D 4LPWA 4B41A 1MF2L 4FFVC 2CLZA 1F4XH 1N4XH 1AGFA 1A1NA 1CL7I 4PGCB 3O11B 2VZVA 5T1MA 2C1PA 1DBJH 1PG7W 4BZYA 1A1OB 1U8IA 4QRUA 1FN4A 4CADA 1XF4B 1FDLL 5GXBB 4K9EC 4UIMA 1A3RL 3EDKA 5T3ZE 2NLJA 43CAA 4F3FA 3RTQB 1TQBC 1KJMA 3LHPH 5C6PB 3LPGA 2VXTL 1J5OL 1KTKE 1HDMA 5FUCE 1MLBB 4Q2ZB 4F37K 1YQ2A 3DETC 2DYPD 4OFKA 4G6FD 2FGWH 5ITFB 1E6OH 4A6YB 4XMLL 4KHXH 4HKBA 5CBAA 3MQIA 4U1GB 1K4CB 1OLZA 1UVQB 3TLRA 4H0IA 4XNQB 2XT1B 1OTSD 4AM0A 3QXVA 2IPUG 2YD7A 3G5YB 4FQXB 1HXMA 1RIVH 1B6DA 1I1FB 5I73C 3CX5J 3WD5L 3BKCH 3F7VA 3MV8A 2IG2H 3HKFA 4BQCA 4YX2H 1W72H 1CGTA 5HVHC 2C3VB 2G5BB 1BVZA 1RMFH 2DTSA 3R06B 2F9BT 3MV7B 3AREC 1A64A 3UTOA 4RQQA 1RI8A 1XCTB 1ERNA 5DJ6A 1TVDA 5DTFB 3L3GA 1BBJB 3T8XB 5F3HA 3GHBL 5KS9F 4NDMA 2X1WL 1UA6L 5T1LB 5FGBC 4KK9C 4PJEA 2CXGA 1EO8H 3GSRA 2I60H 2AJ3B 4LLAA 3TA3B 3CUPA 1Y6KR 4G42A 2E6JA 3SDCD 4M8QA 4EUPG 4JDVB 1J8HE 4Z7UF 4KZEL 4D3CH 1ZVHA 5EIIA 1CZ8H 5DD5H 4NKOB 4RGNE 3H7LA 2N7BA 1I9IH 5CINH 3OXRA 4U1LA 4YHLH 4X6CE 4FOMA 1QTYT 2R29L 3MOQA 1EMTL 1EHXA 2HWZH 3TV3H 5IQ9B 5JW4N 4A6YH 4OF0A 3H9SB 1HI6B 4NZTL 1BWWA 5JHLH 2H32A 4DVBB 3D2UA 2ADGB 3RDTC 3VMNA 4EZMA 3I6GB 4ZAKC 3SO3C 5F7DA 4NBYB 5BCAA 1NFKA 4RX4A 5F6HJ 3E0GA 3BWAB 1NUFA 5EUOB 3AAZB 3O9WD 2NXZD 3QDMB 1QQDA 1NGZB 4I0PA 4JDZA 5E94A 3KXFB 2EIZA 4LIQE 5EOQH 1GC1H 4GAJH 3K4DA 1RIUL 2BSSA 3SJVA 5DJAB 4L4VB 2OI9C 3EUUA 3PWPA 1FZKA 1A1MB 3W9DB 1GHFH 5LGHH 3FQRA 3UTTB 2VLLA 5KOVC 1MFBH 1ZHNA 1J1XL 1JYNA 3WFBL 2EH7H 1ZSDA 4DVRL 3IAPA 2XN9B 3P0VH 5D1XD 1MVUB 3BD5A 2DB8A 4U6HB 1XIWA 1S5HA 4NO0B 1MELA 4ZTPL 1NKOA 4K7PX 1QNZL 2NYYD 5LBSH 5EZIL 1UM4L 5TF1L 3S97C 1L7TL 1H8NA 3IJSA 4KKLC 4J3VA 1TVHB 1BOGA 1AKJB 1HE7A 2VDPL 4FQIL 4RWHA 2I07B 4ZD3L 4XNZC 1I8KA 5HJ3B 3ULVF 1WWAX 3WMSA 1CI5A 4IRSA 2VDNH 1TJGL 3QEUB 3GJEB 3RPIA 2IBZY 1D9KC 2DM7A 2IFFL 4JKLA 4Y4KA 4IBLT 2M26A 4LCCA 3B9KB 3E6HB 2OR9H 1S8DA 1QYGH 2R8SH 1QFWI 3WDIA 1EVTC 1T1WB 4QCIB 2D0HA 4XPBH 1HK6A