2MTQA

Solution structure of a de novo designed peptide that sequesters toxic heavy metals
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
b'MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Peptide
publication title Apoprotein Structure and Metal Binding Characterization of a de Novo Designed Peptide, alpha 3DIV, that Sequesters Toxic Heavy Metals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 23
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2mtqA00
2MTQA 2A3DA
chains in the Genus database with same CATH superfamily
2JIWA 5AQSB 5AQVB 2CXLA 5HXSA 1E1HB 2VWAA 2P9BA 4P1NA 2GK9A 3ZMUB 5C8YE 3P8CD 1LVKA 2MOZA 4EV6A 3PDYA 3I0OA 2OA5A 4JEUB 1WYBA 2A2FX 2V7LA 2YEVC 1MNDA 4U33A 2ODVA 3PTRB 1NAFA 2NR4A 3K1SA 2LOSA 3OVUA 4HTEA 2WWVA 4YTPA 2X67A 2XPKA 5L3FB 4UELA 3DTOA 2XHEB 1XNRT 5HWYA 3KBUA 4KI0F 3UQ7A 5JDGA 4HWFA 2HPLA 3T8OA 1M62A 4BAYB 4ZS3A 2BS3A 4Q25A 1IZNB 2N1GA 3CKDA 2X9XA 2ZMAA 2BZBA 3EDUA 2W61A 5HXHA 1SUMB 4Z8XA 1Y01A 1OEDC 3IA3A 5JQGE 4U2YA 2N2NA 3ZJ2A 3P7IA 3UT5E 5HXCA 4JI6T 4OHFA 2KWIB 3G06A 1NEKA 5JH7E 2XY8B 3N9MA 1WR0A 3PUVF 4LF6T 1HF8A 2FJAA 2OLTA 5FXXA 2SPCA 1XWMA 4QKNA 4ZOLE 5DQVA 3PUQA 3ZKRA 2XTLA 2W63A 2ZM2A 3H37A 3I0QA 4Z91A 1B7TA 3RQUA 1BR0A 4MBQA 4DV0T 4AKIA 3TLVA 3SFEA 4ISSA 2CLYB 2VVSA 3JAEA 2XM1A 4O4HE 3CX8B 4YSXA 1J5ET 1W09A 5HYAA 5L4HA 2KT9A 2X66A 2LM2A 2CXFA 2JPFA 2Q9QA 3K3QC 3BK9A 2KZ7B 2DLRA 4P0AA 2K9AA 5H6QB 4CI3B 1G73A 4TNWA 4UVBB 4HGAA 3NVOA 4J2CA 4EIWA 1AJ3A 4H9QC 1MIWA 2W2UA 5LBMA 4AI6A 3X1DA 2CM0A 4A97A 4EGWA 4LF9T 5FY1A 3ZC0A 2KMFA 4EYUA 4X62T 2Y48B 2H3RA 4ILBA 1U4QA 3KV4A 3UU8A 4CI2B 4JI8T 3AECA 1QUUA 3LJCA 5BMVE 4JLEA 3AA6B 3AAIA 2C5KT 4YTMA 3T1HT 1MIVA 3AE4A 3ZCIA 4HFEA 5L47A 3LK3B 4XZCA 4DR7T 4JI5T 5HEGA 2I0MA 3TLUA 2UXCT 2K24A 4AQFC 2Y6XA 1HNXT 3P4SA 2XUEA 3NZPA 3WAKA 3ZYMA 4AQYT 3ZLIA 4NPPA 2HH7A 1KK7A 4KBMB 4ZI3D 4JI3T 2V8SV 4HFIA 5L2LA 3CQCB 3MA9A 4B3RT 4YFSA 4ZI3C 3AB3B 4YXDA 4F8HA 4HFCA 3PJAA 2XZEA 5F3JA 2BG9A 2CLYC 4XAXB 1IBLT 2LOPA 5J1GA 3Q5XA 5AQKB 5LHGB 5HAXA 4YT0A 2XAHB 4ZI2D 3HL6A 5KXJA 3ZJ1A 4H9SE 4P09A 2PBIA 4IE6A 4ZI2C 4Z90A 2XAQB 4JI7T 3RIAA 3KVAA 2XQAA 5HCJA 2C5JA 4HWDA 3GA8A 5LHHB 3P4WA 4A5XA 4F6RC 4DVDA 2LKGA 4K0UA 5ETWA 3HA4A 1FMVA 2LKHA 4CN1A 5JREA 4JI0T 2WQYA 2BKPA 1HNZT 2V5DA 2QVAA 4MALA 4CI1B 4PK6A 4L5GA 4YHJA 3MKDA 1OEDA 3FZLB 5GONE 4KHPT 5L3EB 2WDVA 4XBFB 3AE3A 5FL0A 3RLFF 2B1EA 4HKAA 4ADZA 5LCYA 4PK5A 3AE2A 1U5PA 5KDMC 3AEGA 2WU5A 2J47A 5FY7A 1UX4A 3KV6A 1ZV4X 5ABHA 3E0ZA 4DV5T 3RYIE 3DP7A 4O4LE 3KDSE 2IIUA 3AE5A 3RIUC 1HNWT 4DO0A 2JQHA 5FXVA 3ABVA 3RYCE 2BVLA 1DU2A 5HXEA 3O1IA 1X79A 2WWUA 4COFA 4KP3C 2VURA 2WZIA 3F57A 4ZXLA 2VKOA 4YTNA 4EZHA 4MLKA 5F8PA 2BBJA 2LT3A 3QC9A 5JRCA 4BJMA 5AQJB 4ZEYA 1G8XA 3BQLA 4JI4T 4O2BE 4WBOA 3UFGA 2E5LT 4UV9B 3A7MA 2X9HA 3AVSA 2BG9B 1D0YA 2I59A 2V7JA 3P4QA 4HFBA 3ZC1A 4DR5T 4JV5T 3I9WA 3Q2MA 2HHHT 2WDRA 3GWHA 2M67A 2VQFT 3CMLA 4QHOA 3IHRA 3B13A 4O4JE 5FP3A 2XQ4A 2A9UA 2IDOB 3AEDA 4I43B 5AQPB 1IBKT 2YDQA 2KSRA 2K5BB 3O9XA 2DWGA 2PTFA 5L3BB 2WP9A 5C2TA 2CEAA 2WZHA 4U3CA 2XAJB 4PNIA 4DV2T 4U74A 4TN7B 1D0ZA 3C98B 4AQFA 4DMVA 3KFWX 3PU8A 4PK4A 1S35A 4QXCB 4X66T 3L3PA 3HKBE 4GK5E 1HR0T 3RYFE 1UK5A 4G63A 2W66A 4X20E 3E08A 5AQFB 2A3DA 5AQLB 4DBRA 4DV7T 3U78A 3A8YC 5AQGB 2RPAA 2W67A 3OPCA 1Y64B 2CRBA 4MFRA 2UUBT 1QSDA 5E0OA 5JVDE 4WYVA 5LB7B 1OXZA 3VHLA 3FZHB 4QH1A 2PG8A 1BR4A 5CJ5A 4KMCA 4EYYR 2A72A 2WS3A 3ZEFB 2MPKA 3RGLA 2MAWA 3RI5A 1YD8G 3VR9A 2L9QA 5FXWA 3HKCE 4CQIA 1UURA 3MXZA 2FJDA 4QXBB 3Q9DA 4YLHA 2WMOA 3QB5K 2BG9C 2YU1A 2ES0A 5JRCB 1MIYA 4DUYT 4BJNA 2HPJA 1CHUA 1Z8UA 2XQ5A 1FEWA 3CX7B 4L9IA 3ONJA 4UR9A 1XZYA 2JMKA 4WW0A 3CX6B 2R6GF 5AQQB 1W0BA 2XQ7A 2CBJA 4LMJA 5AQUB 2VVNA 2H89A 3JCFA 4H9PC 4HWHA 3EHZA 5IYZE 5HXRA 5FMNA 2V1DB 5LGUB 2L8KA 3PUAA 4PJNA 2XM2A 3UUBA 2XSBA 4U31A 2CHOA 4H9RC 3RIUA 2X51A 2D0TA 2YDRA 3OTOT 2CXDA 4YSZA 5LJNA 2BKNA 3PJAJ 1MMAA 3ZCJA 4ILCA 2NW8A 3H3MA 3LK42 3HR0A 4YJ3E 4ILAA 3AAEB 3N9LA 3CQGB 4IE7A 4IGUA 4LF8T 3KINB 4C90A 4G2AA 4X5TA 2CWYA 2LM9A 3CIRA 5JDMA 2VB6A 4LMLA 2YU2A 3ZT5A 1NWMX 2VASA 2XAFB 3PV0F 3FB2A 2G0UA 2VKDA 3N9PA 3O1HA 3U3IA 4B3MT 2UUAT 4NXNT 3PUZF 2VKJA 4IE0A 4TX5A 4OYJA 2DCFA 3KV9A 2UXDT 2E9XB 5HEUA 4X65T 2HN2A 5FYMA 4IDPA 1KNPA 2MTQA 3I9YA 3SFDA 1ZOYA 3N9OA 1BR2A 4TWFA 1YKHB 3AEFA 4UVAB 1XDPA 1I94T 3WI3A 5JDLA 5HCMA 2N9DA 2YINA 3HKDE 5J2TE 4YY3T 1SE7A 4MHCA 4CN6A 4KHZF 3OYXA 4LF5T 3V5UA 4LFBT 5EK3A 5TAOA 4E7ZA 3AE7A 2H7OA 3RH3A 3ZT6A 2JRKA 2KXPB 4UIGA 4U7IA 1HTJF 2X9YA 2KNDA 3EABA 4X1IE 5L3CB 3PUYF 4GKJT 4LFCT 4IE4A 4UF0B 3AE8A 3L09A 2KLQA 5EK2A 1X9BA 3TLTA 4OK0A 3J9X1 3O1JA 5AQIB 5FNVE 3C4WA 5JDHA 4DV6T 2VK9A 3KBTA 3SRZA 3ZMVB 5FKYA 5C3JA 1J5WA 2VQET 4K0KT 3Q5DA 4HWIB 3FBLA 2IHR1 1D1CA 3DJBA 4TZ4C 4GK0E 5CB4E 5J2UE 2IC6A 1XMQT 2WMNA 2WM9A 3CK6A 5JDFA 3UU5A 3ZMSB 3UULA 3ZT7A 5AQMB 4WBNE 5IUXA 2NOXA 4HN9A 4PJMA 4GOUA 4X1KE 5JTGA 3RC3A 4LMKA 5LJMA 4IDOA 5CA0E 2D0UA 2I6HA 5FY0A 4PFPA 4IL9A 4H63V 5L4EA 1ZEEA 3LSVA 1OWAA 1KFYA 1N33T 2LSJA 2YDSA 3ZSTA 4NIQA 3MZKB 2BDEA 5LG3A 4CXWA 1KNRA 1WRDA 3UUMA 2K3WA 3OJAA 5HEOA 3C64A 4X1YE 4DR4T 2BG9E 2JJ9A 4EEDA 3TKLB 2BKOA 2ZM6T 1W9RA 1T8BA 5A1LA 2UXXB 3NWIA 5L3DB 4JEHB 5CGMA 1E2AA 4N78D 4UEMA 1KEYA 1VCSA 2X9WA 3I1AA 3R84B 2V6XA 2CBIA 1WFDA 2CMRA 2BBHA 1MMNA 5LHIB 4I0UA 1VOMA 2FJEA 4HE8A 2X0HA 4WNKA 5EZYE 1CUNA 1H7CA 3AE6A 1VRBA 3AE1A 5ABGA 1OEDE 4DIDB 1YQ3A 4UXNB 2E8IA 2XASB 3NZQA 4B3TT 5LBQB 5HEHA 3PUGA 5JDNA 2C0SA 2PFVA 3RX6A 5IWAT 4O4IE 3UQ4A 2XQ6A 3BQIA 2LEHA 3F31A 4NUVA 5H6RB 4PJLA 3F2EA 3RIFA 2WDQA 2V7KA 3VKGA 3AVRA 2NTXA 3VRAA 2V26A 2W00A 1YQ4A 3ZYLA 2DWKA 2AXDS 4NXMT 4B6XA 1MNEA 2CPTA 3AA0B 3GN5A 3ONLC 5HEJA 2V5CA 1WR6A 4C91A 2UUCT 2FBWA 3RRWA 3N2OA 1W0AA 2CA5A 2ACXA 3LBXB 2EHOA 1SHZC 1MMDA 3K3OA 4CN4A 5AFUL 4NUUA 2V7IA 3ZN1B 2WBLA 4DR3T 3K3NA 2JQ9A 5AQNB 3NBXX 4GIWA 4JBWF 2ACZA 2ZLYA 3Q5EA 2UU9T 2CE7A 1HG5A 3TLSA 3V5SA 2OV9A 1N36T 3C50A 4DBQA 5F5WA 2J62A 1IBMT 1Z0PA 4JUYA 2WSSV 2D2SA 3JC6D 1JNZA 2IUBA 3ONXA 2W62A 3JADA 3VRBA 3PUXF 4LF7T 4I55E 3JC6C 5L3GB 1D1BA 3W15B 1UGOA 2W0GA 4DMWA 1HX1B 2E9XA 4IT4A 1FJGT 2NW9A 4V1Av 1M7KA 2QRXA 2YKSA 4QH5A 2K48A 2CCQA 5EK4A 4PFOA 3RKGA 2IW5B 4AQGA 2DNXA 1KF6A 3ETUA 4IIJE 3FZFB 4EXTA 4DR2T 5FVLA 1NENA 5DABA 3EI0A 4OYKA 2YOEA 4QX8B 4AISA 3NKZA 4PW8A 4TV8E 3VU7H 3MJXA 4YSYA 4AKGA 4QH4A 1HG2A 4QWNB 4QX7B 5DQWA 4UF0A 2LSKA 3B57A 3A5XA 3N2GE 1XDOA 4IL4A 2LSIA 1YKEB 3L39A 3T1YT 4KX6A 4FI5A 3GN5B 5LGNB 2E2AA 2YK0A 1ZHCA 3MK7C 5LMNT 2KWHA 2EHOB 3AEBA 5FL1A 2FJBA 1R8IA 2L3LA 4TWDA 2JQKA 4FJOA 5ADXL 4AKHA 3IBPA 4M1PA 1WCRA 5LA6E 1SA0E 1IAPA 4EAHA 5M4YA 5JR9A 2V7MA 1E7PA 5ABFB 3RYHE 3R6NA 4LF4T 3ETVA 1HS7A 2IAKA 3IF8B 3ZN0B 4O8SA 1UCUA 4L0RA 5FVKA 2UXBT 1XNQT 3C4ZA 2X68A 5LNKA 3FHNA 3AXJA 4ZZCA 3IEEA 3RQWA 2JMHA 2V6YA 1O3XA 4JI1T 4U2ZA 2XQ9A 1S94A 3L8RA 2F4VT 2BS2A 2X0YA 1FMWA 3RPUA 4EB6E 2RP4A 4GYSA 3M3ZB 4TWHA 3S4UA 1N32T 1UX5A 3ZMTB 4QXHB 1YW0A 5AQRB 2WU2A 4DV3T 3OKQA 4EZ4A 2M6BA 3M65A 3H3AA 3UUXB 4ISTA 3KVBA 1YXRA 2LRLA 3OBVE 3UFEA 2NTYA 3AEAA 4HFDA 3PE0A 2EHOD 3ZSSA 4ZHQE 3O4XE 2LRKA 1GQEA 1UUSA 1N34T 2EHOC 1IJ5A 1WLXA 5LMUT 2XQYA 3QNUA 4TNVA 2LJLA 5ABEA 1FIOA 4CZZB 3RRCA 1HCIA 4YJ2E 2AE9A 3EAMA 5AQTB 2VL0A 1T98A 4UVCB 1HFAA 3BQKA 2NWBA 2LHNA 1VCTA 3AE9A 3Q5WA 5LOVE 4PAGA 1IJ6A 3SS1A 3CVRA 3VR8A 1J1JA 3QK6A 4HFVA 5JDQA 1T7SA 5JR9B 3GMIA 4I4TE 2UXNB 3UUNA 5LGTB 2W4XA 5AQOB 2JQQA 3EUHA 3QOFA 4AXPA 1LKXA 1QLBA 2QGSA 3WAJA 2X0LB 2E9XD 3LK2B 1V9DA 1JNRA 4ASKA 4ZS2A 3NRXA 2ODUA 4HWCA 3AXJB 2Z6EA 2KINB 2V6YB 2E9XC 2WCAA 4AKLA 4YHHT 4BA9A 3LG7A 2IMLA 1EZ3A 3ANWA 2YN6A 3CPZA 3FZMB 3OYZA 3TLWA 2VKHA 3LBXA 3AA1B 1L0VA 2J4GA 2BVMA 2PJQA 3PURA 3FZKB 2Q9QB 5KMGP 2Y8DA 4ANJA 4WZXA 4UV8B 1LRZA 4A98A 3FXDB 3PUSA 4AIUA 2LLYA 2CHNA 4IE5A 3C4XA 1BR1A 2XAGB 2XQ8A 3SWHA 3UU3A 2LSGA 4DUZT 1US7B 3KV5A 5LP6E 1I6ZA 5AQHB 3SOLA 4DNDA 1MMGA 2ZM0A 4TUYE 4OX9T 3ZMZB 2H88A 2QA7A 3JAFA 2VL8A 4X64T 2WAUA 3EDVA 3HKEE 3P4PA 5IHYA 4B3ST 5LG4A 4ZZBA 3NRYA 1HX8A 3RC8A 2DL1A 4DR1T 5CA1E 4HEAA 4IDQA 2J1DG 4U7YA 3PUWF 5JR9C 4U72A 4DV1T 3VKHA 3RF1A 3E22E 4I50E 4OFZA 1KNZA 2NW7A 4P0BA 2LE8A 3AA7B 3UU6A 3N9NA 4CXXA 4DV4T 1ZKEA 4ILUA 3QUJA 4KUMB 4H9NC 1ZP0A 4H9OC 5BR8T 5HWXA 1XMOT 3ZYKA 3K8PC 4CXYA 3EVYA 2B76A 2DI4A 4JI2T 3C51A 3RKOA 3PU3A 2LSYA 4PJJA 2FUPA 4IREA 1LVFA 4IHJE 2Q9QD 2ZM8A 2HN1A 3D0TA 5LYJE 4A56A 3P4RA 3RHWA 4EOZB 2D9DA 4H63H 2Q9QC 3ANWB 3N9QA 2XJ7A 4ZI7E 2D5UA 4IDZA 2C5IT 5LXTE 4LFAT 3UTKA 5CFBA 3LFMA 4TV9E 2E5VA 3FXEB 3B5MA 4AKRB 4DR6T 2LHRA 2WY2A 3N5LA 1T72A 2XSAA 2CWOA 5FXZA 2XQ3A 4EEBA 3N2KE 2MYSA 4JYAT 5ABFA 3AAAB 2DHRA 4GKKT 2WB5A 5DJQC 3MACA 4ERRA 5KX5E 2RA1A 3ZPOA 2IC9A 3LDQB 1OEDB 3J7Yq 4IDNA 2H7VC 1D0XA 4O2AE 3CQXC 2NP9A 4GYRA 2M6IA 2BS4A 3P50A 5J0ZA 3QB5A 2MBGA 1D1AA 3UU4A 1WYCA 4E7SA 4HFHA 3HI2A 3CWZB 3ESLA 2QYWA 3AEEA 3FBZA
chains in the Genus database with same CATH topology
3DJBA 5F8PA 4TZ4C 4GK0E 2LT3A 3QC9A 5CB4E 5JRCA 4BJMA 5J2UE 2IC6A 1G8XA 2CXLA 3BQLA 2WMNA 2WM9A 5JDFA 5HXSA 1S94A 1E1HB 3ZMSB 4O2BE 4WBOA 2VWAA 2P9BA 3UULA 2GK9A 3ZMUB 5C8YE 3P8CD 1LVKA 2MOZA 4WBNE 4UV9B 3PDYA 2NOXA 2X9HA 3AVSA 4HN9A 1D0YA 4PJMA 3I0OA 2I59A 4GOUA 1FMWA 2V7JA 3RPUA 3ZC1A 4EB6E 2RP4A 2OA5A 4JEUB 1WYBA 4X1KE 4GYSA 3I9WA 3Q2MA 3RC3A 3S4UA 3GWHA 2A2FX 2M67A 5LJMA 2V7LA 2YEVC 3CMLA 4QHOA 1MNDA 1UX5A 3ZMTB 4QXHB 5CA0E 1YW0A 2ODVA 3PTRB 2D0UA 3IHRA 1NAFA 3B13A 5FY0A 4PFPA 4O4JE 3OKQA 4EZ4A 5FP3A 4H63V 2LOSA 4HTEA 3M65A 3H3AA 3UUXB 1ZEEA 1OWAA 2LSJA 2X67A 4I43B 4ISTA 3KVBA 5L3FB 4UELA 3OBVE 3MZKB 2K5BB 3DTOA 2XHEB 2BDEA 2DWGA 3O9XA 5L3BB 3UFEA 2NTYA 5HWYA 3KBUA 4CXWA 3PE0A 2CEAA 5JDGA 1WRDA 2EHOD 4ZHQE 3UUMA 2XAJB 3O4XE 4PNIA 2HPLA 3T8OA 4BAYB 4ZS3A 3OJAA 4U74A 3C64A 4X1YE 4TN7B 1D0ZA 1IZNB 2N1GA 3CKDA 2JJ9A 3TKLB 2X9XA 3C98B 2ZMAA 4AQFA 2EHOC 2BZBA 4DMVA 1IJ5A 1WLXA 3KFWX 3PU8A 4PK4A 1S35A 4QXCB 3EDUA 3L3PA 5A1LA 2UXXB 2W61A 2XQYA 3HKBE 4GK5E 5HXHA 2LJLA 1FIOA 4Z8XA 3RYFE 4G63A 4CZZB 4X20E 3RRCA 5L3DB 4JEHB 1HCIA 3E08A 4YJ2E 5JQGE 2A3DA 2N2NA 4DBRA 4N78D 4UEMA 3ZJ2A 1T98A 3P7IA 3UT5E 3U78A 5HXCA 2X9WA 3I1AA 4UVCB 1Y64B 4OHFA 1HFAA 2KWIB 3BQKA 4MFRA 1QSDA 2NWBA 5E0OA 5JVDE 3R84B 5JH7E 2LHNA 1OXZA 3N9MA 1HF8A 3VHLA 3Q5WA 5LOVE 2CMRA 4PAGA 2PG8A 5FXXA 1BR4A 2SPCA 4KMCA 4QKNA 4EYYR 2A72A 4ZOLE 3ZEFB 1MMNA 1IJ6A 5DQVA 5LHIB 3PUQA 3CVRA 3SS1A 3QK6A 1VOMA 1YD8G 4HE8A 4HFVA 2XTLA 2W63A 5JDQA 2L9QA 2ZM2A 5JR9B 3GMIA 3H37A 3I0QA 5FXWA 4I4TE 1B7TA 2UXNB 3HKCE 3UUNA 1BR0A 5LGTB 4MBQA 4WNKA 2JQQA 5EZYE 4CQIA 3EUHA 4AXPA 3MXZA 1LKXA 2QGSA 4AKIA 3WAJA 2X0LB 1CUNA 1H7CA 2E9XD 4QXBB 3Q9DA 3LK2B 1V9DA 4ISSA 1VRBA 4ASKA 4YLHA 4ZS2A 2CLYB 3NRXA 2ODUA 4O4HE 2WMOA 4UXNB 3CX8B 2E8IA 2XASB 3NZQA 2Z6EA 2KINB 5LBQB 2E9XC 3PUGA 5HYAA 2YU1A 5JDNA 2KT9A 2X66A 4AKLA 2ES0A 2C0SA 2CXFA 5JRCB 2PFVA 4BA9A 1MIYA 3LG7A 2JPFA 3RX6A 2Q9QA 1EZ3A 4O4IE 3K3QC 3BK9A 4BJNA 2KZ7B 3ANWA 2HPJA 2DLRA 4P0AA 2K9AA 5H6QB 4CI3B 1G73A 3BQIA 4UVBB 1FEWA 3CX7B 4HGAA 4L9IA 3CPZA 3OYZA 2LEHA 3F31A 4NUVA 5H6RB 4J2CA 4PJLA 2VKHA 3F2EA 3LBXA 2V7KA 3AA1B 3VKGA 2JMKA 3AVRA 4EIWA 2NTXA 2BVMA 2PJQA 3PURA 1AJ3A 2V26A 2W00A 4WW0A 3CX6B 2DWKA 3ZYLA 4H9QC 2Q9QB 5KMGP 1MIWA 4B6XA 1MNEA 5LBMA 2Y8DA 4ANJA 3AA0B 3GN5A 4UV8B 1LRZA 4AI6A 3FXDB 2CM0A 1WR6A 3PUSA 5FY1A 4C91A 3ZC0A 2KMFA 3RRWA 3N2OA 4EYUA 2CA5A 3LBXB 2ACXA 2EHOA 2Y48B 4H9PC 4IE5A 3C4XA 2H3RA 1U4QA 3KV4A 4CI2B 1BR1A 1SHZC 2XAGB 5IYZE 3SWHA 1MMDA 5HXRA 1QUUA 2V1DB 5FMNA 5LGUB 3LJCA 5BMVE 2L8KA 3K3OA 4JLEA 3PUAA 3AA6B 4PJNA 2LSGA 3AAIA 5AFUL 2C5KT 1US7B 3KV5A 1MIVA 5LP6E 4NUUA 2V7IA 3ZN1B 3SOLA 4DNDA 1MMGA 2WBLA 2ZM0A 3ZCIA 4TUYE 4H9RC 3K3NA 3ZMZB 2QA7A 2X51A 2D0TA 3LK3B 2VL8A 4XZCA 2WAUA 3NBXX 3EDVA 3HKEE 4GIWA 2ZLYA 2CXDA 5LJNA 5IHYA 5LG4A 2K24A 4AQFC 2Y6XA 2CE7A 1MMAA 3ZCJA 2XUEA 3NZPA 3WAKA 2NW8A 3ZYMA 1HG5A 3ZLIA 3V5SA 2HH7A 1KK7A 3NRYA 3LK42 4KBMB 1HX8A 3C50A 4DBQA 3HR0A 4ZI3D 3RC8A 5CA1E 4HEAA 1Z0PA 4JUYA 2WSSV 4YJ3E 5L2LA 2D2SA 3AAEB 3CQGB 2J1DG 3FBZA 3JC6D 3N9LA 3CQCB 3MA9A 4IE7A 5JR9C 4IGUA 3ONXA 4YFSA 4U72A 4ZI3C 2W62A 3AB3B 3KINB 3VKHA 4C90A 3E22E 4I50E 4OFZA 4G2AA 4I55E 1KNZA 3JC6C 2NW7A 4P0BA 2CWYA 5L3GB 2LE8A 2LM9A 3AA7B 1D1BA 3W15B 3N9NA 4CXXA 5F3JA 5JDMA 2VB6A 1ZKEA 2W0GA 4ILUA 2YU2A 2CLYC 4XAXB 4DMWA 3QUJA 2E9XA 2LOPA 5J1GA 1NWMX 2VASA 2XAFB 4H9NC 4KUMB 3Q5XA 5LHGB 5HAXA 3FB2A 2G0UA 2XAHB 4ZI2D 2VKDA 3N9PA 3O1HA 4H9OC 3HL6A 2NW9A 3ZJ1A 3U3IA 4V1Av 4H9SE 5HWXA 4P09A 3ZYKA 3K8PC 4CXYA 2PBIA 3EVYA 4IE6A 2DI4A 3RKOA 3C51A 2K48A 3PU3A 2CCQA 2LSYA 2VKJA 4IE0A 5EK4A 4TX5A 4OYJA 4PFOA 4ZI2C 4PJJA 2DCFA 1LVFA 3KV9A 4IHJE 2IW5B 2E9XB 2XAQB 4AQGA 2DNXA 3ETUA 4IIJE 2Q9QD 2ZM8A 5FYMA 3KVAA 4EXTA 2MTQA 2C5JA 3I9YA 3GA8A 5LHHB 3D0TA 5DABA 5LYJE 4A56A 4EOZB 4OYKA 4F6RC 3N9OA 4QX8B 4H63H 1BR2A 1YKHB 2Q9QC 4K0UA 4DVDA 3ANWB 3N9QA 4PW8A 4UVAB 3HA4A 5ETWA 1FMVA 2D5UA 4ZI7E 4TV8E 3WI3A 3VU7H 4IDZA 2C5IT 5JDLA 3MJXA 2N9DA 5LXTE 4AKGA 2YINA 3HKDE 5J2TE 5JREA 3UTKA 3LFMA 4TV9E 1HG2A 3FXEB 4QWNB 4QX7B 4AKRB 4MHCA 2LHRA 3OYXA 3N5LA 3V5UA 4MALA 5DQWA 4UF0A 2LSKA 3B57A 4CI1B 4PK6A 3A5XA 5EK3A 3N2GE 5TAOA 2CWOA 2LSIA 4E7ZA 1YKEB 5FXZA 2H7OA 3RH3A 4L5GA 4FI5A 3N2KE 4YHJA 3MKDA 3GN5B 5LGNB 5GONE 2YK0A 1ZHCA 2MYSA 2JRKA 2KXPB 4UIGA 1HTJF 3MK7C 5L3EB 4XBFB 2KWHA 2X9YA 2EHOB 2KNDA 2DHRA 3AAAB 2B1EA 4HKAA 4X1IE 4ADZA 5L3CB 5LCYA 5DJQC 2L3LA 3MACA 4ERRA 4IE4A 4PK5A 4UF0B 5KX5E 3L09A 1U5PA 2KLQA 2RA1A 5EK2A 5KDMC 4FJOA 5ADXL 3ZPOA 5FY7A 1UX4A 3KV6A 1ZV4X 4AKHA 3IBPA 4M1PA 2IC9A 4OK0A 3E0ZA 3RYIE 5LA6E 3J9X1 3J7Yq 1SA0E 3O1JA 3DP7A 2H7VC 1IAPA 1D0XA 4O4LE 5FNVE 4EAHA 3C4WA 4O2AE 5JDHA 3KDSE 2VK9A 5M4YA 3CQXC 5JR9A 2V7MA 4DO0A 3KBTA 3SRZA 3RYHE 3R6NA 5FXVA 3ETVA 1HS7A 3RYCE 3ZMVB 2BVLA 2NP9A 2IAKA 4GYRA 5HXEA 3O1IA 1X79A 2MBGA 3IF8B 2WWUA 3ZN0B 4KP3C 4O8SA 1UCUA 1D1AA 4L0RA 3F57A 1WYCA 4E7SA 2VKOA 3C4ZA 2X68A 5LNKA 3FBLA 3FHNA 4EZHA 3HI2A 3CWZB 3ESLA 4MLKA 3IEEA 2JMHA 1D1CA 1O3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTQ A;  2A3D A; 
#chains in the Genus database with same CATH topology
 2JIW A;  5AQS B;  5AQV B;  2CXL A;  5HXS A;  1E1H B;  2VWA A;  2P9B A;  4P1N A;  2GK9 A;  3ZMU B;  5C8Y E;  3P8C D;  1LVK A;  2MOZ A;  4EV6 A;  3PDY A;  3I0O A;  2OA5 A;  4JEU B;  1WYB A;  2A2F X;  2V7L A;  2YEV C;  1MND A;  4U33 A;  2ODV A;  3PTR B;  1NAF A;  2NR4 A;  3K1S A;  2LOS A;  3OVU A;  4HTE A;  2WWV A;  4YTP A;  2X67 A;  2XPK A;  5L3F B;  4UEL A;  3DTO A;  2XHE B;  1XNR T;  5HWY A;  3KBU A;  4KI0 F;  3UQ7 A;  5JDG A;  4HWF A;  2HPL A;  3T8O A;  1M62 A;  4BAY B;  4ZS3 A;  2BS3 A;  4Q25 A;  1IZN B;  2N1G A;  3CKD A;  2X9X A;  2ZMA A;  2BZB A;  3EDU A;  2W61 A;  5HXH A;  1SUM B;  4Z8X A;  1Y01 A;  1OED C;  3IA3 A;  5JQG E;  4U2Y A;  2N2N A;  3ZJ2 A;  3P7I A;  3UT5 E;  5HXC A;  4JI6 T;  4OHF A;  2KWI B;  3G06 A;  1NEK A;  5JH7 E;  2XY8 B;  3N9M A;  1WR0 A;  3PUV F;  4LF6 T;  1HF8 A;  2FJA A;  2OLT A;  5FXX A;  2SPC A;  1XWM A;  4QKN A;  4ZOL E;  5DQV A;  3PUQ A;  3ZKR A;  2XTL A;  2W63 A;  2ZM2 A;  3H37 A;  3I0Q A;  4Z91 A;  1B7T A;  3RQU A;  1BR0 A;  4MBQ A;  4DV0 T;  4AKI A;  3TLV A;  3SFE A;  4ISS A;  2CLY B;  2VVS A;  3JAE A;  2XM1 A;  4O4H E;  3CX8 B;  4YSX A;  1J5E T;  1W09 A;  5HYA A;  5L4H A;  2KT9 A;  2X66 A;  2LM2 A;  2CXF A;  2JPF A;  2Q9Q A;  3K3Q C;  3BK9 A;  2KZ7 B;  2DLR A;  4P0A A;  2K9A A;  5H6Q B;  4CI3 B;  1G73 A;  4TNW A;  4UVB B;  4HGA A;  3NVO A;  4J2C A;  4EIW A;  1AJ3 A;  4H9Q C;  1MIW A;  2W2U A;  5LBM A;  4AI6 A;  3X1D A;  2CM0 A;  4A97 A;  4EGW A;  4LF9 T;  5FY1 A;  3ZC0 A;  2KMF A;  4EYU A;  4X62 T;  2Y48 B;  2H3R A;  4ILB A;  1U4Q A;  3KV4 A;  3UU8 A;  4CI2 B;  4JI8 T;  3AEC A;  1QUU A;  3LJC A;  5BMV E;  4JLE A;  3AA6 B;  3AAI A;  2C5K T;  4YTM A;  3T1H T;  1MIV A;  3AE4 A;  3ZCI A;  4HFE A;  5L47 A;  3LK3 B;  4XZC A;  4DR7 T;  4JI5 T;  5HEG A;  2I0M A;  3TLU A;  2UXC T;  2K24 A;  4AQF C;  2Y6X A;  1HNX T;  3P4S A;  2XUE A;  3NZP A;  3WAK A;  3ZYM A;  4AQY T;  3ZLI A;  4NPP A;  2HH7 A;  1KK7 A;  4KBM B;  4ZI3 D;  4JI3 T;  2V8S V;  4HFI A;  5L2L A;  3CQC B;  3MA9 A;  4B3R T;  4YFS A;  4ZI3 C;  3AB3 B;  4YXD A;  4F8H A;  4HFC A;  3PJA A;  2XZE A;  5F3J A;  2BG9 A;  2CLY C;  4XAX B;  1IBL T;  2LOP A;  5J1G A;  3Q5X A;  5AQK B;  5LHG B;  5HAX A;  4YT0 A;  2XAH B;  4ZI2 D;  3HL6 A;  5KXJ A;  3ZJ1 A;  4H9S E;  4P09 A;  2PBI A;  4IE6 A;  4ZI2 C;  4Z90 A;  2XAQ B;  4JI7 T;  3RIA A;  3KVA A;  2XQA A;  5HCJ A;  2C5J A;  4HWD A;  3GA8 A;  5LHH B;  3P4W A;  4A5X A;  4F6R C;  4DVD A;  2LKG A;  4K0U A;  5ETW A;  3HA4 A;  1FMV A;  2LKH A;  4CN1 A;  5JRE A;  4JI0 T;  2WQY A;  2BKP A;  1HNZ T;  2V5D A;  2QVA A;  4MAL A;  4CI1 B;  4PK6 A;  4L5G A;  4YHJ A;  3MKD A;  1OED A;  3FZL B;  5GON E;  4KHP T;  5L3E B;  2WDV A;  4XBF B;  3AE3 A;  5FL0 A;  3RLF F;  2B1E A;  4HKA A;  4ADZ A;  5LCY A;  4PK5 A;  3AE2 A;  1U5P A;  5KDM C;  3AEG A;  2WU5 A;  2J47 A;  5FY7 A;  1UX4 A;  3KV6 A;  1ZV4 X;  5ABH A;  3E0Z A;  4DV5 T;  3RYI E;  3DP7 A;  4O4L E;  3KDS E;  2IIU A;  3AE5 A;  3RIU C;  1HNW T;  4DO0 A;  2JQH A;  5FXV A;  3ABV A;  3RYC E;  2BVL A;  1DU2 A;  5HXE A;  3O1I A;  1X79 A;  2WWU A;  4COF A;  4KP3 C;  2VUR A;  2WZI A;  3F57 A;  4ZXL A;  2VKO A;  4YTN A;  4EZH A;  4MLK A;  5F8P A;  2BBJ A;  2LT3 A;  3QC9 A;  5JRC A;  4BJM A;  5AQJ B;  4ZEY A;  1G8X A;  3BQL A;  4JI4 T;  4O2B E;  4WBO A;  3UFG A;  2E5L T;  4UV9 B;  3A7M A;  2X9H A;  3AVS A;  2BG9 B;  1D0Y A;  2I59 A;  2V7J A;  3P4Q A;  4HFB A;  3ZC1 A;  4DR5 T;  4JV5 T;  3I9W A;  3Q2M A;  2HHH T;  2WDR A;  3GWH A;  2M67 A;  2VQF T;  3CML A;  4QHO A;  3IHR A;  3B13 A;  4O4J E;  5FP3 A;  2XQ4 A;  2A9U A;  2IDO B;  3AED A;  4I43 B;  5AQP B;  1IBK T;  2YDQ A;  2KSR A;  2K5B B;  3O9X A;  2DWG A;  2PTF A;  5L3B B;  2WP9 A;  5C2T A;  2CEA A;  2WZH A;  4U3C A;  2XAJ B;  4PNI A;  4DV2 T;  4U74 A;  4TN7 B;  1D0Z A;  3C98 B;  4AQF A;  4DMV A;  3KFW X;  3PU8 A;  4PK4 A;  1S35 A;  4QXC B;  4X66 T;  3L3P A;  3HKB E;  4GK5 E;  1HR0 T;  3RYF E;  1UK5 A;  4G63 A;  2W66 A;  4X20 E;  3E08 A;  5AQF B;  2A3D A;  5AQL B;  4DBR A;  4DV7 T;  3U78 A;  3A8Y C;  5AQG B;  2RPA A;  2W67 A;  3OPC A;  1Y64 B;  2CRB A;  4MFR A;  2UUB T;  1QSD A;  5E0O A;  5JVD E;  4WYV A;  5LB7 B;  1OXZ A;  3VHL A;  3FZH B;  4QH1 A;  2PG8 A;  1BR4 A;  5CJ5 A;  4KMC A;  4EYY R;  2A72 A;  2WS3 A;  3ZEF B;  2MPK A;  3RGL A;  2MAW A;  3RI5 A;  1YD8 G;  3VR9 A;  2L9Q A;  5FXW A;  3HKC E;  4CQI A;  1UUR A;  3MXZ A;  2FJD A;  4QXB B;  3Q9D A;  4YLH A;  2WMO A;  3QB5 K;  2BG9 C;  2YU1 A;  2ES0 A;  5JRC B;  1MIY A;  4DUY T;  4BJN A;  2HPJ A;  1CHU A;  1Z8U A;  2XQ5 A;  1FEW A;  3CX7 B;  4L9I A;  3ONJ A;  4UR9 A;  1XZY A;  2JMK A;  4WW0 A;  3CX6 B;  2R6G F;  5AQQ B;  1W0B A;  2XQ7 A;  2CBJ A;  4LMJ A;  5AQU B;  2VVN A;  2H89 A;  3JCF A;  4H9P C;  4HWH A;  3EHZ A;  5IYZ E;  5HXR A;  5FMN A;  2V1D B;  5LGU B;  2L8K A;  3PUA A;  4PJN A;  2XM2 A;  3UUB A;  2XSB A;  4U31 A;  2CHO A;  4H9R C;  3RIU A;  2X51 A;  2D0T A;  2YDR A;  3OTO T;  2CXD A;  4YSZ A;  5LJN A;  2BKN A;  3PJA J;  1MMA A;  3ZCJ A;  4ILC A;  2NW8 A;  3H3M A;  3LK4 2;  3HR0 A;  4YJ3 E;  4ILA A;  3AAE B;  3N9L A;  3CQG B;  4IE7 A;  4IGU A;  4LF8 T;  3KIN B;  4C90 A;  4G2A A;  4X5T A;  2CWY A;  2LM9 A;  3CIR A;  5JDM A;  2VB6 A;  4LML A;  2YU2 A;  3ZT5 A;  1NWM X;  2VAS A;  2XAF B;  3PV0 F;  3FB2 A;  2G0U A;  2VKD A;  3N9P A;  3O1H A;  3U3I A;  4B3M T;  2UUA T;  4NXN T;  3PUZ F;  2VKJ A;  4IE0 A;  4TX5 A;  4OYJ A;  2DCF A;  3KV9 A;  2UXD T;  2E9X B;  5HEU A;  4X65 T;  2HN2 A;  5FYM A;  4IDP A;  1KNP A;  2MTQ A;  3I9Y A;  3SFD A;  1ZOY A;  3N9O A;  1BR2 A;  4TWF A;  1YKH B;  3AEF A;  4UVA B;  1XDP A;  1I94 T;  3WI3 A;  5JDL A;  5HCM A;  2N9D A;  2YIN A;  3HKD E;  5J2T E;  4YY3 T;  1SE7 A;  4MHC A;  4CN6 A;  4KHZ F;  3OYX A;  4LF5 T;  3V5U A;  4LFB T;  5EK3 A;  5TAO A;  4E7Z A;  3AE7 A;  2H7O A;  3RH3 A;  3ZT6 A;  2JRK A;  2KXP B;  4UIG A;  4U7I A;  1HTJ F;  2X9Y A;  2KND A;  3EAB A;  4X1I E;  5L3C B;  3PUY F;  4GKJ T;  4LFC T;  4IE4 A;  4UF0 B;  3AE8 A;  3L09 A;  2KLQ A;  5EK2 A;  1X9B A;  3TLT A;  4OK0 A;  3J9X 1;  3O1J A;  5AQI B;  5FNV E;  3C4W A;  5JDH A;  4DV6 T;  2VK9 A;  3KBT A;  3SRZ A;  3ZMV B;  5FKY A;  5C3J A;  1J5W A;  2VQE T;  4K0K T;  3Q5D A;  4HWI B;  3FBL A;  2IHR 1;  1D1C A;  3DJB A;  4TZ4 C;  4GK0 E;  5CB4 E;  5J2U E;  2IC6 A;  1XMQ T;  2WMN A;  2WM9 A;  3CK6 A;  5JDF A;  3UU5 A;  3ZMS B;  3UUL A;  3ZT7 A;  5AQM B;  4WBN E;  5IUX A;  2NOX A;  4HN9 A;  4PJM A;  4GOU A;  4X1K E;  5JTG A;  3RC3 A;  4LMK A;  5LJM A;  4IDO A;  5CA0 E;  2D0U A;  2I6H A;  5FY0 A;  4PFP A;  4IL9 A;  4H63 V;  5L4E A;  1ZEE A;  3LSV A;  1OWA A;  1KFY A;  1N33 T;  2LSJ A;  2YDS A;  3ZST A;  4NIQ A;  3MZK B;  2BDE A;  5LG3 A;  4CXW A;  1KNR A;  1WRD A;  3UUM A;  2K3W A;  3OJA A;  5HEO A;  3C64 A;  4X1Y E;  4DR4 T;  2BG9 E;  2JJ9 A;  4EED A;  3TKL B;  2BKO A;  2ZM6 T;  1W9R A;  1T8B A;  5A1L A;  2UXX B;  3NWI A;  5L3D B;  4JEH B;  5CGM A;  1E2A A;  4N78 D;  4UEM A;  1KEY A;  1VCS A;  2X9W A;  3I1A A;  3R84 B;  2V6X A;  2CBI A;  1WFD A;  2CMR A;  2BBH A;  1MMN A;  5LHI B;  4I0U A;  1VOM A;  2FJE A;  4HE8 A;  2X0H A;  4WNK A;  5EZY E;  1CUN A;  1H7C A;  3AE6 A;  1VRB A;  3AE1 A;  5ABG A;  1OED E;  4DID B;  1YQ3 A;  4UXN B;  2E8I A;  2XAS B;  3NZQ A;  4B3T T;  5LBQ B;  5HEH A;  3PUG A;  5JDN A;  2C0S A;  2PFV A;  3RX6 A;  5IWA T;  4O4I E;  3UQ4 A;  2XQ6 A;  3BQI A;  2LEH A;  3F31 A;  4NUV A;  5H6R B;  4PJL A;  3F2E A;  3RIF A;  2WDQ A;  2V7K A;  3VKG A;  3AVR A;  2NTX A;  3VRA A;  2V26 A;  2W00 A;  1YQ4 A;  3ZYL A;  2DWK A;  2AXD S;  4NXM T;  4B6X A;  1MNE A;  2CPT A;  3AA0 B;  3GN5 A;  3ONL C;  5HEJ A;  2V5C A;  1WR6 A;  4C91 A;  2UUC T;  2FBW A;  3RRW A;  3N2O A;  1W0A A;  2CA5 A;  2ACX A;  3LBX B;  2EHO A;  1SHZ C;  1MMD A;  3K3O A;  4CN4 A;  5AFU L;  4NUU A;  2V7I A;  3ZN1 B;  2WBL A;  4DR3 T;  3K3N A;  2JQ9 A;  5AQN B;  3NBX X;  4GIW A;  4JBW F;  2ACZ A;  2ZLY A;  3Q5E A;  2UU9 T;  2CE7 A;  1HG5 A;  3TLS A;  3V5S A;  2OV9 A;  1N36 T;  3C50 A;  4DBQ A;  5F5W A;  2J62 A;  1IBM T;  1Z0P A;  4JUY A;  2WSS V;  2D2S A;  3JC6 D;  1JNZ A;  2IUB A;  3ONX A;  2W62 A;  3JAD A;  3VRB A;  3PUX F;  4LF7 T;  4I55 E;  3JC6 C;  5L3G B;  1D1B A;  3W15 B;  1UGO A;  2W0G A;  4DMW A;  1HX1 B;  2E9X A;  4IT4 A;  1FJG T;  2NW9 A;  4V1A v;  1M7K A;  2QRX A;  2YKS A;  4QH5 A;  2K48 A;  2CCQ A;  5EK4 A;  4PFO A;  3RKG A;  2IW5 B;  4AQG A;  2DNX A;  1KF6 A;  3ETU A;  4IIJ E;  3FZF B;  4EXT A;  4DR2 T;  5FVL A;  1NEN A;  5DAB A;  3EI0 A;  4OYK A;  2YOE A;  4QX8 B;  4AIS A;  3NKZ A;  4PW8 A;  4TV8 E;  3VU7 H;  3MJX A;  4YSY A;  4AKG A;  4QH4 A;  1HG2 A;  4QWN B;  4QX7 B;  5DQW A;  4UF0 A;  2LSK A;  3B57 A;  3A5X A;  3N2G E;  1XDO A;  4IL4 A;  2LSI A;  1YKE B;  3L39 A;  3T1Y T;  4KX6 A;  4FI5 A;  3GN5 B;  5LGN B;  2E2A A;  2YK0 A;  1ZHC A;  3MK7 C;  5LMN T;  2KWH A;  2EHO B;  3AEB A;  5FL1 A;  2FJB A;  1R8I A;  2L3L A;  4TWD A;  2JQK A;  4FJO A;  5ADX L;  4AKH A;  3IBP A;  4M1P A;  1WCR A;  5LA6 E;  1SA0 E;  1IAP A;  4EAH A;  5M4Y A;  5JR9 A;  2V7M A;  1E7P A;  5ABF B;  3RYH E;  3R6N A;  4LF4 T;  3ETV A;  1HS7 A;  2IAK A;  3IF8 B;  3ZN0 B;  4O8S A;  1UCU A;  4L0R A;  5FVK A;  2UXB T;  1XNQ T;  3C4Z A;  2X68 A;  5LNK A;  3FHN A;  3AXJ A;  4ZZC A;  3IEE A;  3RQW A;  2JMH A;  2V6Y A;  1O3X A;  4JI1 T;  4U2Z A;  2XQ9 A;  1S94 A;  3L8R A;  2F4V T;  2BS2 A;  2X0Y A;  1FMW A;  3RPU A;  4EB6 E;  2RP4 A;  4GYS A;  3M3Z B;  4TWH A;  3S4U A;  1N32 T;  1UX5 A;  3ZMT B;  4QXH B;  1YW0 A;  5AQR B;  2WU2 A;  4DV3 T;  3OKQ A;  4EZ4 A;  2M6B A;  3M65 A;  3H3A A;  3UUX B;  4IST A;  3KVB A;  1YXR A;  2LRL A;  3OBV E;  3UFE A;  2NTY A;  3AEA A;  4HFD A;  3PE0 A;  2EHO D;  3ZSS A;  4ZHQ E;  3O4X E;  2LRK A;  1GQE A;  1UUS A;  1N34 T;  2EHO C;  1IJ5 A;  1WLX A;  5LMU T;  2XQY A;  3QNU A;  4TNV A;  2LJL A;  5ABE A;  1FIO A;  4CZZ B;  3RRC A;  1HCI A;  4YJ2 E;  2AE9 A;  3EAM A;  5AQT B;  2VL0 A;  1T98 A;  4UVC B;  1HFA A;  3BQK A;  2NWB A;  2LHN A;  1VCT A;  3AE9 A;  3Q5W A;  5LOV E;  4PAG A;  1IJ6 A;  3SS1 A;  3CVR A;  3VR8 A;  1J1J A;  3QK6 A;  4HFV A;  5JDQ A;  1T7S A;  5JR9 B;  3GMI A;  4I4T E;  2UXN B;  3UUN A;  5LGT B;  2W4X A;  5AQO B;  2JQQ A;  3EUH A;  3QOF A;  4AXP A;  1LKX A;  1QLB A;  2QGS A;  3WAJ A;  2X0L B;  2E9X D;  3LK2 B;  1V9D A;  1JNR A;  4ASK A;  4ZS2 A;  3NRX A;  2ODU A;  4HWC A;  3AXJ B;  2Z6E A;  2KIN B;  2V6Y B;  2E9X C;  2WCA A;  4AKL A;  4YHH T;  4BA9 A;  3LG7 A;  2IML A;  1EZ3 A;  3ANW A;  2YN6 A;  3CPZ A;  3FZM B;  3OYZ A;  3TLW A;  2VKH A;  3LBX A;  3AA1 B;  1L0V A;  2J4G A;  2BVM A;  2PJQ A;  3PUR A;  3FZK B;  2Q9Q B;  5KMG P;  2Y8D A;  4ANJ A;  4WZX A;  4UV8 B;  1LRZ A;  4A98 A;  3FXD B;  3PUS A;  4AIU A;  2LLY A;  2CHN A;  4IE5 A;  3C4X A;  1BR1 A;  2XAG B;  2XQ8 A;  3SWH A;  3UU3 A;  2LSG A;  4DUZ T;  1US7 B;  3KV5 A;  5LP6 E;  1I6Z A;  5AQH B;  3SOL A;  4DND A;  1MMG A;  2ZM0 A;  4TUY E;  4OX9 T;  3ZMZ B;  2H88 A;  2QA7 A;  3JAF A;  2VL8 A;  4X64 T;  2WAU A;  3EDV A;  3HKE E;  3P4P A;  5IHY A;  4B3S T;  5LG4 A;  4ZZB A;  3NRY A;  1HX8 A;  3RC8 A;  2DL1 A;  4DR1 T;  5CA1 E;  4HEA A;  4IDQ A;  2J1D G;  4U7Y A;  3PUW F;  5JR9 C;  4U72 A;  4DV1 T;  3VKH A;  3RF1 A;  3E22 E;  4I50 E;  4OFZ A;  1KNZ A;  2NW7 A;  4P0B A;  2LE8 A;  3AA7 B;  3UU6 A;  3N9N A;  4CXX A;  4DV4 T;  1ZKE A;  4ILU A;  3QUJ A;  4KUM B;  4H9N C;  1ZP0 A;  4H9O C;  5BR8 T;  5HWX A;  1XMO T;  3ZYK A;  3K8P C;  4CXY A;  3EVY A;  2B76 A;  2DI4 A;  4JI2 T;  3C51 A;  3RKO A;  3PU3 A;  2LSY A;  4PJJ A;  2FUP A;  4IRE A;  1LVF A;  4IHJ E;  2Q9Q D;  2ZM8 A;  2HN1 A;  3D0T A;  5LYJ E;  4A56 A;  3P4R A;  3RHW A;  4EOZ B;  2D9D A;  4H63 H;  2Q9Q C;  3ANW B;  3N9Q A;  2XJ7 A;  4ZI7 E;  2D5U A;  4IDZ A;  2C5I T;  5LXT E;  4LFA T;  3UTK A;  5CFB A;  3LFM A;  4TV9 E;  2E5V A;  3FXE B;  3B5M A;  4AKR B;  4DR6 T;  2LHR A;  2WY2 A;  3N5L A;  1T72 A;  2XSA A;  2CWO A;  5FXZ A;  2XQ3 A;  4EEB A;  3N2K E;  2MYS A;  4JYA T;  5ABF A;  3AAA B;  2DHR A;  4GKK T;  2WB5 A;  5DJQ C;  3MAC A;  4ERR A;  5KX5 E;  2RA1 A;  3ZPO A;  2IC9 A;  3LDQ B;  1OED B;  3J7Y q;  4IDN A;  2H7V C;  1D0X A;  4O2A E;  3CQX C;  2NP9 A;  4GYR A;  2M6I A;  2BS4 A;  3P50 A;  5J0Z A;  3QB5 A;  2MBG A;  1D1A A;  3UU4 A;  1WYC A;  4E7S A;  4HFH A;  3HI2 A;  3CWZ B;  3ESL A;  2QYW A;  3AEE A;  3FBZ A; 
#chains in the Genus database with same CATH homology
 3DJB A;  5F8P A;  4TZ4 C;  4GK0 E;  2LT3 A;  3QC9 A;  5CB4 E;  5JRC A;  4BJM A;  5J2U E;  2IC6 A;  1G8X A;  2CXL A;  3BQL A;  2WMN A;  2WM9 A;  5JDF A;  5HXS A;  1S94 A;  1E1H B;  3ZMS B;  4O2B E;  4WBO A;  2VWA A;  2P9B A;  3UUL A;  2GK9 A;  3ZMU B;  5C8Y E;  3P8C D;  1LVK A;  2MOZ A;  4WBN E;  4UV9 B;  3PDY A;  2NOX A;  2X9H A;  3AVS A;  4HN9 A;  1D0Y A;  4PJM A;  3I0O A;  2I59 A;  4GOU A;  1FMW A;  2V7J A;  3RPU A;  3ZC1 A;  4EB6 E;  2RP4 A;  2OA5 A;  4JEU B;  1WYB A;  4X1K E;  4GYS A;  3I9W A;  3Q2M A;  3RC3 A;  3S4U A;  3GWH A;  2A2F X;  2M67 A;  5LJM A;  2V7L A;  2YEV C;  3CML A;  4QHO A;  1MND A;  1UX5 A;  3ZMT B;  4QXH B;  5CA0 E;  1YW0 A;  2ODV A;  3PTR B;  2D0U A;  3IHR A;  1NAF A;  3B13 A;  5FY0 A;  4PFP A;  4O4J E;  3OKQ A;  4EZ4 A;  5FP3 A;  4H63 V;  2LOS A;  4HTE A;  3M65 A;  3H3A A;  3UUX B;  1ZEE A;  1OWA A;  2LSJ A;  2X67 A;  4I43 B;  4IST A;  3KVB A;  5L3F B;  4UEL A;  3OBV E;  3MZK B;  2K5B B;  3DTO A;  2XHE B;  2BDE A;  2DWG A;  3O9X A;  5L3B B;  3UFE A;  2NTY A;  5HWY A;  3KBU A;  4CXW A;  3PE0 A;  2CEA A;  5JDG A;  1WRD A;  2EHO D;  4ZHQ E;  3UUM A;  2XAJ B;  3O4X E;  4PNI A;  2HPL A;  3T8O A;  4BAY B;  4ZS3 A;  3OJA A;  4U74 A;  3C64 A;  4X1Y E;  4TN7 B;  1D0Z A;  1IZN B;  2N1G A;  3CKD A;  2JJ9 A;  3TKL B;  2X9X A;  3C98 B;  2ZMA A;  4AQF A;  2EHO C;  2BZB A;  4DMV A;  1IJ5 A;  1WLX A;  3KFW X;  3PU8 A;  4PK4 A;  1S35 A;  4QXC B;  3EDU A;  3L3P A;  5A1L A;  2UXX B;  2W61 A;  2XQY A;  3HKB E;  4GK5 E;  5HXH A;  2LJL A;  1FIO A;  4Z8X A;  3RYF E;  4G63 A;  4CZZ B;  4X20 E;  3RRC A;  5L3D B;  4JEH B;  1HCI A;  3E08 A;  4YJ2 E;  5JQG E;  2A3D A;  2N2N A;  4DBR A;  4N78 D;  4UEM A;  3ZJ2 A;  1T98 A;  3P7I A;  3UT5 E;  3U78 A;  5HXC A;  2X9W A;  3I1A A;  4UVC B;  1Y64 B;  4OHF A;  1HFA A;  2KWI B;  3BQK A;  4MFR A;  1QSD A;  2NWB A;  5E0O A;  5JVD E;  3R84 B;  5JH7 E;  2LHN A;  1OXZ A;  3N9M A;  1HF8 A;  3VHL A;  3Q5W A;  5LOV E;  2CMR A;  4PAG A;  2PG8 A;  5FXX A;  1BR4 A;  2SPC A;  4KMC A;  4QKN A;  4EYY R;  2A72 A;  4ZOL E;  3ZEF B;  1MMN A;  1IJ6 A;  5DQV A;  5LHI B;  3PUQ A;  3CVR A;  3SS1 A;  3QK6 A;  1VOM A;  1YD8 G;  4HE8 A;  4HFV A;  2XTL A;  2W63 A;  5JDQ A;  2L9Q A;  2ZM2 A;  5JR9 B;  3GMI A;  3H37 A;  3I0Q A;  5FXW A;  4I4T E;  1B7T A;  2UXN B;  3HKC E;  3UUN A;  1BR0 A;  5LGT B;  4MBQ A;  4WNK A;  2JQQ A;  5EZY E;  4CQI A;  3EUH A;  4AXP A;  3MXZ A;  1LKX A;  2QGS A;  4AKI A;  3WAJ A;  2X0L B;  1CUN A;  1H7C A;  2E9X D;  4QXB B;  3Q9D A;  3LK2 B;  1V9D A;  4ISS A;  1VRB A;  4ASK A;  4YLH A;  4ZS2 A;  2CLY B;  3NRX A;  2ODU A;  4O4H E;  2WMO A;  4UXN B;  3CX8 B;  2E8I A;  2XAS B;  3NZQ A;  2Z6E A;  2KIN B;  5LBQ B;  2E9X C;  3PUG A;  5HYA A;  2YU1 A;  5JDN A;  2KT9 A;  2X66 A;  4AKL A;  2ES0 A;  2C0S A;  2CXF A;  5JRC B;  2PFV A;  4BA9 A;  1MIY A;  3LG7 A;  2JPF A;  3RX6 A;  2Q9Q A;  1EZ3 A;  4O4I E;  3K3Q C;  3BK9 A;  4BJN A;  2KZ7 B;  3ANW A;  2HPJ A;  2DLR A;  4P0A A;  2K9A A;  5H6Q B;  4CI3 B;  1G73 A;  3BQI A;  4UVB B;  1FEW A;  3CX7 B;  4HGA A;  4L9I A;  3CPZ A;  3OYZ A;  2LEH A;  3F31 A;  4NUV A;  5H6R B;  4J2C A;  4PJL A;  2VKH A;  3F2E A;  3LBX A;  2V7K A;  3AA1 B;  3VKG A;  2JMK A;  3AVR A;  4EIW A;  2NTX A;  2BVM A;  2PJQ A;  3PUR A;  1AJ3 A;  2V26 A;  2W00 A;  4WW0 A;  3CX6 B;  2DWK A;  3ZYL A;  4H9Q C;  2Q9Q B;  5KMG P;  1MIW A;  4B6X A;  1MNE A;  5LBM A;  2Y8D A;  4ANJ A;  3AA0 B;  3GN5 A;  4UV8 B;  1LRZ A;  4AI6 A;  3FXD B;  2CM0 A;  1WR6 A;  3PUS A;  5FY1 A;  4C91 A;  3ZC0 A;  2KMF A;  3RRW A;  3N2O A;  4EYU A;  2CA5 A;  3LBX B;  2ACX A;  2EHO A;  2Y48 B;  4H9P C;  4IE5 A;  3C4X A;  2H3R A;  1U4Q A;  3KV4 A;  4CI2 B;  1BR1 A;  1SHZ C;  2XAG B;  5IYZ E;  3SWH A;  1MMD A;  5HXR A;  1QUU A;  2V1D B;  5FMN A;  5LGU B;  3LJC A;  5BMV E;  2L8K A;  3K3O A;  4JLE A;  3PUA A;  3AA6 B;  4PJN A;  2LSG A;  3AAI A;  5AFU L;  2C5K T;  1US7 B;  3KV5 A;  1MIV A;  5LP6 E;  4NUU A;  2V7I A;  3ZN1 B;  3SOL A;  4DND A;  1MMG A;  2WBL A;  2ZM0 A;  3ZCI A;  4TUY E;  4H9R C;  3K3N A;  3ZMZ B;  2QA7 A;  2X51 A;  2D0T A;  3LK3 B;  2VL8 A;  4XZC A;  2WAU A;  3NBX X;  3EDV A;  3HKE E;  4GIW A;  2ZLY A;  2CXD A;  5LJN A;  5IHY A;  5LG4 A;  2K24 A;  4AQF C;  2Y6X A;  2CE7 A;  1MMA A;  3ZCJ A;  2XUE A;  3NZP A;  3WAK A;  2NW8 A;  3ZYM A;  1HG5 A;  3ZLI A;  3V5S A;  2HH7 A;  1KK7 A;  3NRY A;  3LK4 2;  4KBM B;  1HX8 A;  3C50 A;  4DBQ A;  3HR0 A;  4ZI3 D;  3RC8 A;  5CA1 E;  4HEA A;  1Z0P A;  4JUY A;  2WSS V;  4YJ3 E;  5L2L A;  2D2S A;  3AAE B;  3CQG B;  2J1D G;  3FBZ A;  3JC6 D;  3N9L A;  3CQC B;  3MA9 A;  4IE7 A;  5JR9 C;  4IGU A;  3ONX A;  4YFS A;  4U72 A;  4ZI3 C;  2W62 A;  3AB3 B;  3KIN B;  3VKH A;  4C90 A;  3E22 E;  4I50 E;  4OFZ A;  4G2A A;  4I55 E;  1KNZ A;  3JC6 C;  2NW7 A;  4P0B A;  2CWY A;  5L3G B;  2LE8 A;  2LM9 A;  3AA7 B;  1D1B A;  3W15 B;  3N9N A;  4CXX A;  5F3J A;  5JDM A;  2VB6 A;  1ZKE A;  2W0G A;  4ILU A;  2YU2 A;  2CLY C;  4XAX B;  4DMW A;  3QUJ A;  2E9X A;  2LOP A;  5J1G A;  1NWM X;  2VAS A;  2XAF B;  4H9N C;  4KUM B;  3Q5X A;  5LHG B;  5HAX A;  3FB2 A;  2G0U A;  2XAH B;  4ZI2 D;  2VKD A;  3N9P A;  3O1H A;  4H9O C;  3HL6 A;  2NW9 A;  3ZJ1 A;  3U3I A;  4V1A v;  4H9S E;  5HWX A;  4P09 A;  3ZYK A;  3K8P C;  4CXY A;  2PBI A;  3EVY A;  4IE6 A;  2DI4 A;  3RKO A;  3C51 A;  2K48 A;  3PU3 A;  2CCQ A;  2LSY A;  2VKJ A;  4IE0 A;  5EK4 A;  4TX5 A;  4OYJ A;  4PFO A;  4ZI2 C;  4PJJ A;  2DCF A;  1LVF A;  3KV9 A;  4IHJ E;  2IW5 B;  2E9X B;  2XAQ B;  4AQG A;  2DNX A;  3ETU A;  4IIJ E;  2Q9Q D;  2ZM8 A;  5FYM A;  3KVA A;  4EXT A;  2MTQ A;  2C5J A;  3I9Y A;  3GA8 A;  5LHH B;  3D0T A;  5DAB A;  5LYJ E;  4A56 A;  4EOZ B;  4OYK A;  4F6R C;  3N9O A;  4QX8 B;  4H63 H;  1BR2 A;  1YKH B;  2Q9Q C;  4K0U A;  4DVD A;  3ANW B;  3N9Q A;  4PW8 A;  4UVA B;  3HA4 A;  5ETW A;  1FMV A;  2D5U A;  4ZI7 E;  4TV8 E;  3WI3 A;  3VU7 H;  4IDZ A;  2C5I T;  5JDL A;  3MJX A;  2N9D A;  5LXT E;  4AKG A;  2YIN A;  3HKD E;  5J2T E;  5JRE A;  3UTK A;  3LFM A;  4TV9 E;  1HG2 A;  3FXE B;  4QWN B;  4QX7 B;  4AKR B;  4MHC A;  2LHR A;  3OYX A;  3N5L A;  3V5U A;  4MAL A;  5DQW A;  4UF0 A;  2LSK A;  3B57 A;  4CI1 B;  4PK6 A;  3A5X A;  5EK3 A;  3N2G E;  5TAO A;  2CWO A;  2LSI A;  4E7Z A;  1YKE B;  5FXZ A;  2H7O A;  3RH3 A;  4L5G A;  4FI5 A;  3N2K E;  4YHJ A;  3MKD A;  3GN5 B;  5LGN B;  5GON E;  2YK0 A;  1ZHC A;  2MYS A;  2JRK A;  2KXP B;  4UIG A;  1HTJ F;  3MK7 C;  5L3E B;  4XBF B;  2KWH A;  2X9Y A;  2EHO B;  2KND A;  2DHR A;  3AAA B;  2B1E A;  4HKA A;  4X1I E;  4ADZ A;  5L3C B;  5LCY A;  5DJQ C;  2L3L A;  3MAC A;  4ERR A;  4IE4 A;  4PK5 A;  4UF0 B;  5KX5 E;  3L09 A;  1U5P A;  2KLQ A;  2RA1 A;  5EK2 A;  5KDM C;  4FJO A;  5ADX L;  3ZPO A;  5FY7 A;  1UX4 A;  3KV6 A;  1ZV4 X;  4AKH A;  3IBP A;  4M1P A;  2IC9 A;  4OK0 A;  3E0Z A;  3RYI E;  5LA6 E;  3J9X 1;  3J7Y q;  1SA0 E;  3O1J A;  3DP7 A;  2H7V C;  1IAP A;  1D0X A;  4O4L E;  5FNV E;  4EAH A;  3C4W A;  4O2A E;  5JDH A;  3KDS E;  2VK9 A;  5M4Y A;  3CQX C;  5JR9 A;  2V7M A;  4DO0 A;  3KBT A;  3SRZ A;  3RYH E;  3R6N A;  5FXV A;  3ETV A;  1HS7 A;  3RYC E;  3ZMV B;  2BVL A;  2NP9 A;  2IAK A;  4GYR A;  5HXE A;  3O1I A;  1X79 A;  2MBG A;  3IF8 B;  2WWU A;  3ZN0 B;  4KP3 C;  4O8S A;  1UCU A;  1D1A A;  4L0R A;  3F57 A;  1WYC A;  4E7S A;  2VKO A;  3C4Z A;  2X68 A;  5LNK A;  3FBL A;  3FHN A;  4EZH A;  3HI2 A;  3CWZ B;  3ESL A;  4MLK A;  3IEE A;  2JMH A;  1D1C A;  1O3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...