2MTQA

Solution structure of a de novo designed peptide that sequesters toxic heavy metals
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Peptide
publication title Apoprotein Structure and Metal Binding Characterization of a de Novo Designed Peptide, alpha 3DIV, that Sequesters Toxic Heavy Metals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 23
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2mtqA00
2MTQA 2A3DA
chains in the Genus database with same CATH superfamily
5FNVE 4TN7B 2VK9A 2C5KT 2KT9A 3CK6A 2HPJA 4NXNT 4OX9T 4YHHT 2V5CA 4UR9A 1KEYA 3TLSA 1XWMA 4P0AA 2NTXA 2NR4A 5AQMB 3HL6A 1WYCA 3O1IA 1ZKEA 3PV0F 3ZSTA 4QXHB 3N2OA 3ZC1A 3ZMUB 5L4HA 1W09A 4HTEA 3MZKB 3JC6D 1HG5A 3D0TA 3V5SA 1Z8UA 3ZEFB 2VKOA 3BQIA 3P50A 4AKGA 5F5WA 1I94T 4C90A 5HEOA 3J7Yq 4MLKA 5FXWA 3ZMZB 2DI4A 3UUXB 4AKIA 4JI2T 2MPKA 3RIAA 5FY7A 2LSGA 3KV9A 5J1GA 2V1DB 3HA4A 3ZMSB 5EK2A 1YW0A 1S94A 3FBLA 5FL0A 4COFA 3GWHA 1S35A 1D0ZA 4G2AA 4WBOA 2M6IA 4QXCB 3AVSA 4JI1T 4TUYE 5EK4A 5KXJA 2KZ7B 2LSKA 1SE7A 2XASB 3PUZF 3ONXA 1U4QA 2XQ9A 5JDNA 4F8HA 5E0OA 3FZMB 3AB3B 1XNQT 1I6ZA 5ABGA 4E7ZA 4OK0A 3QNUA 2UUAT 2FJDA 3GN5A 3HKBE 5HCMA 2WAUA 3CQXC 1OEDB 3E08A 5AQVB 3AXJA 1YKEB 4DBQA 1MMDA 2WWUA 1FIOA 3MACA 4X1YE 3DJBA 1Y64B 2L9QA 3IEEA 4KI0F 1HNWT 4U33A 1OWAA 5FXVA 2VKHA 5L47A 4HGAA 1KNRA 4H9QC 3RLFF 3KFWX 4WBNE 2IC9A 3RRCA 3PJAA 4JI7T 4LMLA 2R6GF 2VASA 3L3PA 3UU5A 2V26A 4HFVA 4AQFC 2UXBT 2L8KA 5FY0A 2M67A 1BR2A 2VB6A 3FZLB 1D0YA 4O2BE 5JDQA 2FJBA 4JV5T 2W61A 2WP9A 2H89A 4HWIB 2MBGA 4YY3T 5ABHA 5FVKA 5ADXL 2WZIA 3KINB 3PU3A 2HPLA 5AQHB 4I0UA 3QC9A 1FEWA 5IUXA 4K0UA 4ILCA 2BG9A 3ONJA 4O4JE 1AJ3A 5LJNA 4YT0A 2YEVC 2X0LB 3N2KE 2E9XA 1FMVA 1VOMA 3AE5A 3ZYMA 2WBLA 3RYHE 2CEAA 3RRWA 5JTGA 4ZHQE 2NW8A 3JAEA 3HKCE 2CPTA 2VKDA 2PFVA 3N9OA 2X0HA 1D1CA 2HN1A 4CI3B 1MIYA 4EEBA 4EXTA 3QOFA 4X62T 4YJ3E 3U78A 3B57A 3UU3A 3VKGA 3RHWA 4UIGA 3HR0A 4I55E 1JNRA 1J1JA 5AQGB 3PUVF 1SA0E 4HE8A 2VL0A 5LBQB 1HFAA 3UQ7A 2WM9A 4TWDA 4OYJA 3A7MA 1J5ET 2X66A 3P4QA 1M7KA 4GK0E 4HFBA 4YXDA 3I0OA 4L0RA 2FJAA 3ZJ1A 3AAEB 2WDQA 2LRKA 2NW9A 1XMOT 4G63A 5JDLA 4FJOA 3NBXX 4B6XA 3MA9A 3KV4A 3LBXA 4AKHA 4B3RT 2YK0A 2Y6XA 2WU5A 3NRYA 2LT3A 2LM9A 2VKJA 2V7IA 3UULA 2V6XA 2X68A 3WAJA 3RKOA 1U5PA 3UTKA 4YTNA 4LF9T 2ZM8A 2E5VA 5JRCA 3PE0A 4MALA 1US7B 4ANJA 5J2TE 2CXDA 4O8SA 4QX7B 3ZN1B 4OFZA 3Q2MA 4LFBT 1E2AA 2DWKA 3LK3B 4WYVA 3UU8A 2W63A 2Q9QB 2FBWA 2J62A 4QHOA 2FJEA 4DV7T 4DV1T 4NXMT 4HFCA 4IL9A 2BS4A 2VWAA 3CKDA 4EIWA 5AQUB 5JDFA 2LHRA 3FXDB 1IZNB 1HS7A 2LSIA 2CBIA 4AI6A 5LGTB 2LE8A 1FJGT 2YDRA 1W0BA 5AQJB 3OYXA 2CE7A 4ISSA 5C8YE 3EHZA 2XAHB 3BQKA 4U7IA 4GK5E 4H63V 3UU4A 4IDQA 3AE1A 5L3BB 4QH1A 3C4ZA 5H6RB 4IIJE 2BKOA 2LHNA 4GOUA 4TWFA 1UGOA 2CHOA 3FXEB 2XUEA 4X1KE 1KNZA 5LB7B 2JQ9A 3MXZA 2XZEA 1KF6A 2HN2A 2YDSA 3PJAJ 4H63H 4YHJA 4GYRA 5JR9B 2UUBT 2EHOA 5L3CB 3UT5E 4XBFB 3EABA 5FL1A 3AEBA 3AEEA 2PJQA 3F57A 3PUSA 2OLTA 1OEDC 4U74A 3ONLC 1LVKA 2V5DA 1ZHCA 5TAOA 2H3RA 2V7KA 4IDOA 5HWYA 3KV5A 4ILBA 4B3ST 4KP3C 2XQ4A 4GKKT 3UUBA 2XM2A 1BR0A 3FHNA 5LP6E 2KLQA 3LK42 5JREA 1WRDA 2OV9A 2WU2A 4P09A 2V6YA 1YQ3A 2JMHA 3PUQA 4LF6T 3AAAB 4CXWA 2BVLA 3Q9DA 2YDQA 2I0MA 5IYZE 1X79A 4UVCB 1YXRA 2KNDA 4ILUA 2OA5A 3P4RA 1D1BA 3AA6B 3ETVA 4ZEYA 4LF5T 1H7CA 3K3NA 4NUVA 2CMRA 4J2CA 2WY2A 2BG9E 2DWGA 3ZYKA 2I6HA 2XQ3A 4DIDB 2LJLA 3GA8A 2MTQA 4X5TA 4OYKA 1UK5A 5JVDE 4LF7T 5FKYA 5LMUT 2BS3A 2XHEB 4YSYA 2N9DA 2LEHA 4EEDA 4YSZA 4BJMA 2ACXA 3VR9A 4HEAA 3N9QA 2MYSA 2W62A 3UFEA 3GMIA 2YINA 5LJMA 4A98A 1IAPA 4U2YA 1SHZC 3ZT7A 5DQVA 3CQCB 1WYBA 1KNPA 2HHHT 4PJNA 2J1DG 1W0AA 3H37A 3I9YA 1CUNA 4JLEA 3EAMA 3CIRA 2DNXA 3N9LA 5BR8T 1D0XA 4BJNA 2CLYC 4LFAT 2NOXA 5AQKB 4U7YA 5HXEA 4MFRA 3TLVA 5FVLA 3RIUC 2XQ5A 2YU1A 4IDZA 1IJ6A 4EAHA 3BQLA 3W15B 1ZEEA 4ADZA 4DV3T 4DV4T 4JEHB 2BBJA 2K24A 1XDPA 2W00A 4AKRB 5ABFA 2CA5A 4EB6E 4QXBB 4L5GA 1EZ3A 3FBZA 4PAGA 5DABA 2X0YA 1HX1B 4AQFA 3MKDA 2YN6A 5H6QB 1KFYA 2N1GA 5M4YA 2E8IA 3NVOA 4N78D 2QRXA 3IA3A 3AEDA 5LMNT 4DR6T 5FXXA 2G0UA 4TWHA 1IBMT 3SS1A 1X9BA 4JUYA 4TNVA 2WQYA 3ZC0A 4O4LE 3K1SA 5C3JA 4EYUA 3TKLB 2LLYA 3AE8A 2DL1A 4FI5A 3K8PC 4O2AE 4UVAB 4QH4A 3L09A 3VHLA 3NRXA 4UF0A 2IAKA 2RP4A 4H9SE 5IWAT 1UX5A 1W9RA 2Q9QC 4IE6A 5LCYA 4DV0T 2QVAA 4ZI3D 2A3DA 4LFCT 4C91A 3PURA 3KDSE 3RKGA 2Y48B 3C51A 2C0SA 3LG7A 1T8BA 5LG4A 3N9MA 5FYMA 3ZMVB 1LKXA 4E7SA 1CHUA 4YFSA 4U2ZA 5ABEA 3PU8A 3OPCA 2WZHA 2KMFA 4CZZB 1T98A 2X67A 2WS3A 4M1PA 2UUCT 2BKNA 4I43B 2WMNA 4IL4A 3P4WA 3LFMA 3ANWA 4DR5T 4O4IE 2BS2A 2WCAA 1HG2A 5HEUA 3E0ZA 4YSXA 5JR9C 2CLYB 2X9WA 2UU9T 5IHYA 2XAGB 1HR0T 5AQOB 5JDMA 3ZT5A 4HWCA 1XNRT 2XQ6A 4PW8A 5AQRB 5L4EA 5ETWA 3FZKB 4WW0A 1Y01A 2LM2A 5LOVE 4CN1A 3X1DA 1WCRA 3NWIA 1YKHB 4JI3T 4QX8B 5DJQC 3IBPA 3O4XE 2IUBA 3V5UA 1J5WA 2XPKA 2ZMAA 4HFDA 4DMVA 4GYSA 3GN5B 4CXYA 3PUWF 5FXZA 4JEUB 4PJLA 2ODUA 2LKHA 1VCSA 3AXJB 3IF8B 1WLXA 2XAJB 3CMLA 1HNXT 3VRAA 4QH5A 2CBJA 2D9DA 4DVDA 2CXLA 3CX7B 2VVNA 4CXXA 2XQYA 2C5JA 4A97A 5EZYE 2BDEA 2KXPB 4TV8E 4JI5T 5AQQB 4XAXB 2XAQB 2E5LT 2LOPA 1G8XA 3UUMA 5LYJE 2VL8A 3BK9A 3WI3A 1LVFA 3RI5A 1BR4A 4IDNA 2L3LA 3HKEE 2KWHA 2A9UA 2JRKA 3RQWA 2V8SV 2B76A 4EZ4A 1MIWA 2PBIA 3RF1A 3K3QC 4KHPT 3AVRA 4JI4T 5LBMA 5CJ5A 4GIWA 3TLTA 2CHNA 3C64A 3AA7B 3RC3A 2JMKA 4ZI3C 3ZSSA 4PNIA 4Z90A 3OJAA 4U3CA 4UVBB 5AQLB 2C5IT 3C98B 4DMWA 1UURA 3N9NA 4Z91A 5CA1E 3RC8A 5HEGA 4UXNB 3B13A 1D1AA 2BG9B 3ZMTB 1OXZA 5LNKA 2KWIB 3RPUA 4ZOLE 4EYYR 5AQFB 1OEDA 2V7MA 2E9XB 1V9DA 5F3JA 4PK5A 5CFBA 3RQUA 3FB2A 4GKJT 3L39A 3JAFA 2K3WA 4I50E 2JIWA 1NEKA 4I4TE 4PJJA 2RPAA 4OHFA 1MMGA 1ZP0A 4U72A 1G73A 3NKZA 4IDPA 1Z0PA 2NWBA 3PTRB 4A5XA 2XJ7A 1VRBA 4CI2B 2JQHA 1E1HB 2QYWA 4CN6A 3P7IA 4HWDA 4ZZCA 3H3MA 3U3IA 2EHOC 1YQ4A 3WAKA 1HX8A 2LOSA 2Q9QD 2WMOA 2CWYA 1MIVA 4LF8T 2YOEA 3IHRA 5LG3A 3EI0A 5AQTB 3J9X1 5L3EB 4AQGA 3AEFA 4NIQA 3AEGA 4B3MT 3KVBA 3G06A 2JPFA 1DU2A 1XDOA 4X64T 2D2SA 5HEHA 3ZYLA 4X1IE 3KBUA 2XQ7A 2XAFB 4IT4A 4KUMB 4HN9A 2H7OA 5DQWA 3LBXB 2XY8B 3FZHB 3Q5XA 3AE3A 3UQ4A 3PDYA 4IE5A 2A72A 3OYZA 2BVMA 4H9NC 4ZXLA 2GK9A 3F2EA 2CWOA 4DV6T 2V7LA 3OKQA 4PJMA 3E22E 3A5XA 5JRCB 1T7SA 3L8RA 4PK6A 2E9XD 1UX4A 2WDRA 2ZM2A 3AA0B 4DBRA 2BBHA 2M6BA 3EDUA 3RYFE 5LGNB 5FP3A 2PG8A 3OVUA 1SUMB 1ZV4X 2PTFA 1HCIA 3TLUA 2XQ8A 3SWHA 2H7VC 2ZM6T 1UCUA 3HKDE 4HWHA 3S4UA 3RX6A 5A1LA 2RA1A 3PUXF 4A56A 4U31A 5KX5E 5J2UE 3HI2A 3RIUA 3O1JA 4WZXA 4MHCA 2J47A 4KX6A 2JJ9A 1UUSA 3ZJ2A 2XSBA 4KMCA 4ERRA 1IBLT 4QWNB 3EVYA 3LSVA 1B7TA 4JI0T 4TZ4C 1T72A 2CRBA 3KV6A 2IHR1 5CA0E 3P4PA 4H9RC 5HEJA 4DR1T 2NTYA 2ACZA 5JDHA 3M65A 3MK7C 3UFGA 3ZN0B 4EV6A 4PK4A 5AQIB 4L9IA 4TV9E 4UV8B 2K48A 2BKPA 2VURA 2WWVA 5AFUL 5L2LA 4IGUA 4YJ2E 4AKLA 2EHOB 1IBKT 4K0KT 4DUZT 1WR0A 3CPZA 4TX5A 3I0QA 2ES0A 4KHZF 4P0BA 1HTJF 1N36T 4X65T 1ZOYA 4CQIA 3EUHA 3I1AA 3PUGA 3AE4A 1KK7A 2V7JA 4PFPA 2W4XA 3RH3A 2D0UA 3CWZB 2Q9QA 4DR3T 2ZM0A 2VQFT 4AIUA 2I59A 4UV9B 3M3ZB 1YD8G 3SOLA 4UEMA 5HXCA 4YLHA 4AXPA 2V6YB 3ZKRA 3I9WA 4X66T 3PUYF 4LF4T 3KVAA 3ZCIA 2LSYA 1IJ5A 4XZCA 5LGUB 2WSSV 4BAYB 2VQET 4Z8XA 4ASKA 3QB5A 5JQGE 5C2TA 4NPPA 2CXFA 4DV5T 3R6NA 1QSDA 3Q5WA 4H9PC 4EZHA 5KDMC 2AE9A 3LK2B 4IE0A 1NENA 4Q25A 2X9YA 2IDOB 5CGMA 2Z6EA 2W0GA 5HYAA 4YTPA 4AISA 2X51A 3NZQA 4ILAA 3ABVA 3SRZA 4X20E 2DCFA 2IIUA 4HFEA 3N2GE 3VU7H 5EK3A 1OEDE 5FY1A 4CI1B 4DUYT 2K5BB 3ETUA 2LRLA 1NAFA 5JR9A 5F8PA 4PFOA 3JCFA 1QUUA 4UELA 2BG9C 3T1HT 1R8IA 3AE7A 2IMLA 2BZBA 2E9XC 2DLRA 3JC6C 2ODVA 3AAIA 4P1NA 2IW5B 2VVSA 2EHOD 2E2AA 3OBVE 3PUAA 3QB5K 5HAXA 4O4HE 2Y8DA 4B3TT 3JADA 3T8OA 2NP9A 2HH7A 4ZI2D 3QUJA 5LHHB 2XSAA 2XTLA 5FMNA 3UU6A 1BR1A 4AQYT 3P4SA 3T1YT 4ZS2A 3ZPOA 3A8YC 4HKAA 4EOZB 4HFHA 1LRZA 4CN4A 2CM0A 2N2NA 1N33T 3F31A 5LHGB 5LXTE 2W67A 2QA7A 2X9HA 2LSJA 5AQPB 3O9XA 4DR4T 4JI8T 4HFIA 5GONE 4DNDA 3RGLA 5LA6E 4DV2T 1M62A 3LJCA 5AQNB 3Q5DA 3VRBA 2MOZA 4IHJE 4QKNA 5ABFB 1QLBA 4IE4A 2QGSA 3B5MA 3N9PA 3C4WA 2KINB 2WB5A 2WDVA 4MBQA 2DHRA 5LHIB 2D0TA 2W2UA 3CX8B 5HCJA 4EGWA 5JDGA 3CQGB 5BMVE 2P9BA 2YKSA 3RYIE 3AE6A 5J0ZA 4WNKA 4DR7T 2H88A 2JQKA 3C4XA 1XZYA 2SPCA 1MNEA 4BA9A 3O1HA 3ZLIA 3C50A 1MNDA 2ZLYA 4KBMB 5KMGP 3TLWA 3CX6B 4UF0B 1FMWA 2LKGA 4F6RC 2JQQA 2F4VT 3RIFA 3H3AA 4DO0A 3DP7A 3SFEA 3R84B 1WR6A 1GQEA 5JH7E 2W66A 5L3GB 2D5UA 1VCTA 2X9XA 2MAWA 2UXDT 5AQSB 3MJXA 4TNWA 1E7PA 1O3XA 3NZPA 4H9OC 3SFDA 3N5LA 3ZCJA 3ZT6A 5CB4E 3Q5EA 3LDQB 2AXDS 4JI6T 3P8CD 2B1EA 4V1Av 1L0VA 1WFDA 2K9AA 4DR2T 3CVRA 3ESLA 1HF8A 4IE7A 1MMNA 3EDVA 1XMQT 3FZFB 1N32T 5HXRA 3ANWB 3VKHA 3RYCE 1MMAA 4ZI7E 2J4GA 5L3FB 5HWXA 4LMKA 2IC6A 1N34T 4ISTA 4ZS3A 3AECA 2CCQA 3QK6A 4NUUA 2XM1A 3AA1B 2UXCT 3VR8A 3AEAA 3AE9A 2FUPA 2A2FX 3AE2A 3DTOA 2NW7A 4ZI2C 3K3OA 2YU2A 2UXNB 4HWFA 2XQAA 4ZZBA 4YTMA 5L3DB 2UXXB 1NWMX 2KSRA 4IREA 5HXHA 4LMJA 4JBWF 3UUNA 1HNZT 4JYAT 1JNZA 3KBTA 5HXSA 3OTOT
chains in the Genus database with same CATH topology
2VWAA 3CKDA 5FNVE 4EIWA 4TN7B 2VK9A 1HG2A 2C5KT 5AFUL 5L2LA 4IGUA 2KT9A 5JDFA 2LHRA 4YJ2E 3E0ZA 2HPJA 1IZNB 3FXDB 1HS7A 2LSIA 5JR9C 4AKLA 4AI6A 2EHOB 2CLYB 5LGTB 2X9WA 2LE8A 5IHYA 4P0AA 2NTXA 2XAGB 3OYXA 3CPZA 4TX5A 3I0QA 2ES0A 2CE7A 4ISSA 5JDMA 3HL6A 5C8YE 1WYCA 3O1IA 1ZKEA 4P0BA 1HTJF 2XAHB 3BQKA 4GK5E 4CQIA 3EUHA 3I1AA 4PW8A 4H63V 3PUGA 4QXHB 3N2OA 1KK7A 2V7JA 3ZC1A 4PFPA 5L3BB 5ETWA 3RH3A 2D0UA 3CWZB 2Q9QA 3ZMUB 4WW0A 4HTEA 3C4ZA 5LOVE 3MZKB 3JC6D 2ZM0A 1HG5A 3D0TA 5H6RB 2I59A 4IIJE 3V5SA 2LHNA 4GOUA 4UV9B 1YKHB 3ZEFB 2VKOA 1YD8G 3FXEB 4QX8B 5DJQC 3IBPA 2XUEA 4UEMA 4X1KE 3SOLA 5HXCA 1KNZA 3BQIA 3O4XE 4AKGA 3MXZA 4YLHA 3V5UA 4AXPA 3I9WA 4H63H 4C90A 2ZMAA 4YHJA 3J7Yq 4MLKA 4GYRA 5JR9B 5FXWA 3ZMZB 3KVAA 4DMVA 4GYSA 2DI4A 3ZCIA 3GN5B 3UUXB 2EHOA 1IJ5A 2LSYA 4XZCA 5L3CB 5LGUB 4CXYA 4AKIA 3UT5E 2WSSV 5FY7A 5FXZA 4BAYB 4XBFB 4JEUB 2LSGA 4PJLA 4Z8XA 2ODUA 4ASKA 3KV9A 5J1GA 5JQGE 2PJQA 3F57A 3PUSA 2V1DB 2CXFA 3HA4A 3IF8B 1WLXA 4U74A 3ZMSB 2XAJB 5EK2A 3CMLA 1YW0A 1S94A 1QSDA 3Q5WA 3R6NA 1LVKA 3FBLA 4H9PC 1ZHCA 5TAOA 2H3RA 2V7KA 4EZHA 3GWHA 1S35A 5KDMC 1D0ZA 4G2AA 3KV5A 3LK2B 2CXLA 4IE0A 4WBOA 5HWYA 2X9YA 4DVDA 3CX7B 4KP3C 4QXCB 2Z6EA 2W0GA 4CXXA 5HYAA 3AVSA 2X51A 4TUYE 3NZQA 2XQYA 2C5JA 5EZYE 5EK4A 2BDEA 2KZ7B 2KXPB 1BR0A 3FHNA 2LSKA 3SRZA 5LP6E 2KLQA 3LK42 4TV8E 2XASB 4X20E 2DCFA 5JREA 3ONXA 1U4QA 1WRDA 4XAXB 2XAQB 3N2GE 4P09A 3VU7H 5EK3A 2LOPA 5JDNA 5E0OA 5FY1A 4CI1B 2K5BB 3ETUA 3AB3B 2JMHA 1G8XA 1NAFA 3PUQA 5JR9A 5F8PA 3UUMA 5LYJE 2VL8A 3BK9A 4OK0A 4PFOA 4E7ZA 3WI3A 1LVFA 3GN5A 1BR4A 3HKBE 1QUUA 2L3LA 3AAAB 4UELA 2WAUA 3CQXC 3HKEE 4CXWA 2KWHA 2JRKA 2BVLA 3E08A 3Q9DA 1YKEB 4DBQA 1MMDA 2BZBA 2WWUA 1FIOA 2DLRA 2E9XC 3JC6C 1X79A 2ODVA 3AAIA 3MACA 4UVCB 1MIWA 4X1YE 5IYZE 4EZ4A 2KNDA 4ILUA 2PBIA 2IW5B 2OA5A 3DJBA 1D1BA 1Y64B 3AA6B 2EHOD 3K3QC 2L9QA 3ETVA 3IEEA 3OBVE 3PUAA 3AVRA 5HAXA 5LBMA 1OWAA 4GIWA 4O4HE 1H7CA 3C64A 3AA7B 3RC3A 2Y8DA 2JMKA 5FXVA 3K3NA 4NUVA 3T8OA 2NP9A 4ZI3C 2VKHA 2HH7A 4PNIA 3OJAA 4UVBB 4HGAA 3QUJA 4ZI2D 4H9QC 2CMRA 2C5IT 3C98B 5LHHB 4DMWA 2XTLA 3KFWX 4J2CA 5FMNA 4WBNE 2IC9A 2DWGA 3ZYKA 1BR1A 3N9NA 3RRCA 5CA1E 3RC8A 4UXNB 2LJLA 2VASA 3GA8A 3L3PA 2MTQA 3B13A 4ZS2A 1D1AA 4OYKA 3ZPOA 5JVDE 2V26A 4HFVA 4HKAA 4AQFC 4EOZB 3ZMTB 1OXZA 5LNKA 2KWIB 2L8KA 5FY0A 3RPUA 4ZOLE 1LRZA 4EYYR 2XHEB 2CM0A 2V7MA 2E9XB 2N2NA 2M67A 1BR2A 2VB6A 2N9DA 1V9DA 2LEHA 5F3JA 3F31A 4PK5A 5LHGB 4BJMA 2ACXA 3FB2A 5LXTE 1D0YA 2QA7A 4O2BE 5JDQA 2X9HA 4I50E 4HEAA 2LSJA 3N9QA 2MYSA 2W62A 3O9XA 2W61A 3UFEA 4I4TE 3GMIA 2YINA 4PJJA 5GONE 4DNDA 5LA6E 2MBGA 5LJMA 1IAPA 3LJCA 4OHFA 5ADXL 1MMGA 1SHZC 3KINB 4U72A 1G73A 3PU3A 2MOZA 2HPLA 4IHJE 5DQVA 3CQCB 1Z0PA 1WYBA 4QKNA 2NWBA 3PTRB 4PJNA 1VRBA 4IE4A 2QGSA 3N9PA 4CI2B 3C4WA 2J1DG 2KINB 1E1HB 3QC9A 3H37A 1FEWA 3I9YA 3P7IA 4MBQA 5LHIB 1CUNA 2DHRA 4K0UA 2D0TA 4JLEA 3CX8B 2DNXA 3N9LA 4O4JE 1AJ3A 1D0XA 3U3IA 2EHOC 2CLYC 4BJNA 5LJNA 5JDGA 2YEVC 3WAKA 1HX8A 2X0LB 3CQGB 2E9XA 3N2KE 5BMVE 2LOSA 2Q9QD 1FMVA 1VOMA 2NOXA 2P9BA 2WBLA 3ZYMA 3RYHE 2WMOA 3RYIE 2CWYA 1MIVA 2CEAA 5HXEA 3IHRA 4MFRA 3RRWA 4WNKA 4ZHQE 3J9X1 2NW8A 4AQGA 5L3EB 2YU1A 4IDZA 1IJ6A 3HKCE 4EAHA 3BQLA 3W15B 3C4XA 1ZEEA 3KVBA 4ADZA 2SPCA 2VKDA 2JPFA 2PFVA 1MNEA 3N9OA 2D2SA 3ZYLA 4BA9A 3O1HA 3ZLIA 4X1IE 3C50A 1D1CA 4JEHB 3KBUA 1MNDA 4CI3B 2ZLYA 4KBMB 5KMGP 1MIYA 4EXTA 2K24A 3CX6B 4UF0B 2W00A 2XAFB 4YJ3E 4AKRB 2CA5A 1FMWA 4QXBB 4EB6E 4F6RC 2JQQA 4KUMB 4L5GA 1EZ3A 3H3AA 3FBZA 3U78A 3B57A 4HN9A 4PAGA 4DO0A 3DP7A 2H7OA 5DQWA 3VKGA 5DABA 3LBXB 3R84B 1WR6A 4UIGA 4AQFA 3HR0A 3MKDA 5JH7E 3Q5XA 4I55E 5L3GB 3PDYA 2D5UA 5H6QB 2N1GA 5M4YA 2E8IA 4IE5A 2A72A 4N78D 2X9XA 3OYZA 3MJXA 1SA0E 5FXXA 2BVMA 4H9NC 2G0UA 2GK9A 3F2EA 4HE8A 1O3XA 3NZPA 2CWOA 3SS1A 5LBQB 4H9OC 2V7LA 1HFAA 3N5LA 4JUYA 3ZCJA 2WM9A 3OKQA 4PJMA 3E22E 3A5XA 3ZC0A 5JRCB 4O4LE 4OYJA 5CB4E 4EYUA 3TKLB 2X66A 4GK0E 4PK6A 2E9XD 3I0OA 4L0RA 1UX4A 4FI5A 2ZM2A 3K8PC 4O2AE 4UVAB 3P8CD 3AA0B 2B1EA 3ZJ1A 4DBRA 3AAEB 3EDUA 3L09A 3RYFE 3VHLA 5LGNB 4V1Av 5FP3A 3NRXA 4UF0A 2IAKA 2PG8A 2RP4A 1ZV4X 2K9AA 4H9SE 2NW9A 1UX5A 4G63A 5JDLA 3CVRA 1HCIA 4FJOA 3ESLA 3NBXX 1HF8A 4IE7A 1MMNA 3EDVA 2Q9QC 4IE6A 5LCYA 4B6XA 3MA9A 3KV4A 3LBXA 4ZI3D 2A3DA 4AKHA 3SWHA 2H7VC 2YK0A 2Y6XA 5HXRA 3ANWB 1UCUA 3HKDE 4C91A 3VKHA 3PURA 1MMAA 3NRYA 3RYCE 3KDSE 3S4UA 3RX6A 2LT3A 5A1LA 2LM9A 2RA1A 4ZI7E 2Y48B 4A56A 3C51A 2VKJA 2V7IA 5L3FB 3UULA 2C0SA 3LG7A 5KX5E 2X68A 5HWXA 5J2UE 3HI2A 5LG4A 3RKOA 3WAJA 3N9MA 1U5PA 5FYMA 3UTKA 2IC6A 3O1JA 4ISTA 4ZS3A 3ZMVB 2CCQA 1LKXA 4E7SA 2ZM8A 3QK6A 4MHCA 4YFSA 4NUUA 5JRCA 3PE0A 3AA1B 3PU8A 4MALA 2JJ9A 1US7B 2KMFA 3ZJ2A 4CZZB 4KMCA 4ERRA 4ANJA 2A2FX 5J2TE 1T98A 2CXDA 2X67A 4QWNB 3EVYA 1B7TA 4O8SA 3DTOA 2NW7A 4QX7B 4TZ4C 3ZN1B 4ZI2C 3K3OA 3Q2MA 4OFZA 2YU2A 2UXNB 3KV6A 2DWKA 5CA0E 3LK3B 4M1PA 4H9RC 2W63A 2Q9QB 5L3DB 2UXXB 4I43B 1NWMX 2WMNA 2NTYA 4QHOA 3LFMA 5JDHA 5HXHA 3M65A 3MK7C 3ZN0B 4PK4A 3UUNA 3ANWA 4L9IA 3KBTA 4TV9E 4UV8B 5HXSA 4O4IE 2K48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTQ A;  2A3D A; 
#chains in the Genus database with same CATH topology
 5FNV E;  4TN7 B;  2VK9 A;  2C5K T;  2KT9 A;  3CK6 A;  2HPJ A;  4NXN T;  4OX9 T;  4YHH T;  2V5C A;  4UR9 A;  1KEY A;  3TLS A;  1XWM A;  4P0A A;  2NTX A;  2NR4 A;  5AQM B;  3HL6 A;  1WYC A;  3O1I A;  1ZKE A;  3PV0 F;  3ZST A;  4QXH B;  3N2O A;  3ZC1 A;  3ZMU B;  5L4H A;  1W09 A;  4HTE A;  3MZK B;  3JC6 D;  1HG5 A;  3D0T A;  3V5S A;  1Z8U A;  3ZEF B;  2VKO A;  3BQI A;  3P50 A;  4AKG A;  5F5W A;  1I94 T;  4C90 A;  5HEO A;  3J7Y q;  4MLK A;  5FXW A;  3ZMZ B;  2DI4 A;  3UUX B;  4AKI A;  4JI2 T;  2MPK A;  3RIA A;  5FY7 A;  2LSG A;  3KV9 A;  5J1G A;  2V1D B;  3HA4 A;  3ZMS B;  5EK2 A;  1YW0 A;  1S94 A;  3FBL A;  5FL0 A;  4COF A;  3GWH A;  1S35 A;  1D0Z A;  4G2A A;  4WBO A;  2M6I A;  4QXC B;  3AVS A;  4JI1 T;  4TUY E;  5EK4 A;  5KXJ A;  2KZ7 B;  2LSK A;  1SE7 A;  2XAS B;  3PUZ F;  3ONX A;  1U4Q A;  2XQ9 A;  5JDN A;  4F8H A;  5E0O A;  3FZM B;  3AB3 B;  1XNQ T;  1I6Z A;  5ABG A;  4E7Z A;  4OK0 A;  3QNU A;  2UUA T;  2FJD A;  3GN5 A;  3HKB E;  5HCM A;  2WAU A;  3CQX C;  1OED B;  3E08 A;  5AQV B;  3AXJ A;  1YKE B;  4DBQ A;  1MMD A;  2WWU A;  1FIO A;  3MAC A;  4X1Y E;  3DJB A;  1Y64 B;  2L9Q A;  3IEE A;  4KI0 F;  1HNW T;  4U33 A;  1OWA A;  5FXV A;  2VKH A;  5L47 A;  4HGA A;  1KNR A;  4H9Q C;  3RLF F;  3KFW X;  4WBN E;  2IC9 A;  3RRC A;  3PJA A;  4JI7 T;  4LML A;  2R6G F;  2VAS A;  3L3P A;  3UU5 A;  2V26 A;  4HFV A;  4AQF C;  2UXB T;  2L8K A;  5FY0 A;  2M67 A;  1BR2 A;  2VB6 A;  3FZL B;  1D0Y A;  4O2B E;  5JDQ A;  2FJB A;  4JV5 T;  2W61 A;  2WP9 A;  2H89 A;  4HWI B;  2MBG A;  4YY3 T;  5ABH A;  5FVK A;  5ADX L;  2WZI A;  3KIN B;  3PU3 A;  2HPL A;  5AQH B;  4I0U A;  3QC9 A;  1FEW A;  5IUX A;  4K0U A;  4ILC A;  2BG9 A;  3ONJ A;  4O4J E;  1AJ3 A;  5LJN A;  4YT0 A;  2YEV C;  2X0L B;  3N2K E;  2E9X A;  1FMV A;  1VOM A;  3AE5 A;  3ZYM A;  2WBL A;  3RYH E;  2CEA A;  3RRW A;  5JTG A;  4ZHQ E;  2NW8 A;  3JAE A;  3HKC E;  2CPT A;  2VKD A;  2PFV A;  3N9O A;  2X0H A;  1D1C A;  2HN1 A;  4CI3 B;  1MIY A;  4EEB A;  4EXT A;  3QOF A;  4X62 T;  4YJ3 E;  3U78 A;  3B57 A;  3UU3 A;  3VKG A;  3RHW A;  4UIG A;  3HR0 A;  4I55 E;  1JNR A;  1J1J A;  5AQG B;  3PUV F;  1SA0 E;  4HE8 A;  2VL0 A;  5LBQ B;  1HFA A;  3UQ7 A;  2WM9 A;  4TWD A;  4OYJ A;  3A7M A;  1J5E T;  2X66 A;  3P4Q A;  1M7K A;  4GK0 E;  4HFB A;  4YXD A;  3I0O A;  4L0R A;  2FJA A;  3ZJ1 A;  3AAE B;  2WDQ A;  2LRK A;  2NW9 A;  1XMO T;  4G63 A;  5JDL A;  4FJO A;  3NBX X;  4B6X A;  3MA9 A;  3KV4 A;  3LBX A;  4AKH A;  4B3R T;  2YK0 A;  2Y6X A;  2WU5 A;  3NRY A;  2LT3 A;  2LM9 A;  2VKJ A;  2V7I A;  3UUL A;  2V6X A;  2X68 A;  3WAJ A;  3RKO A;  1U5P A;  3UTK A;  4YTN A;  4LF9 T;  2ZM8 A;  2E5V A;  5JRC A;  3PE0 A;  4MAL A;  1US7 B;  4ANJ A;  5J2T E;  2CXD A;  4O8S A;  4QX7 B;  3ZN1 B;  4OFZ A;  3Q2M A;  4LFB T;  1E2A A;  2DWK A;  3LK3 B;  4WYV A;  3UU8 A;  2W63 A;  2Q9Q B;  2FBW A;  2J62 A;  4QHO A;  2FJE A;  4DV7 T;  4DV1 T;  4NXM T;  4HFC A;  4IL9 A;  2BS4 A;  2VWA A;  3CKD A;  4EIW A;  5AQU B;  5JDF A;  2LHR A;  3FXD B;  1IZN B;  1HS7 A;  2LSI A;  2CBI A;  4AI6 A;  5LGT B;  2LE8 A;  1FJG T;  2YDR A;  1W0B A;  5AQJ B;  3OYX A;  2CE7 A;  4ISS A;  5C8Y E;  3EHZ A;  2XAH B;  3BQK A;  4U7I A;  4GK5 E;  4H63 V;  3UU4 A;  4IDQ A;  3AE1 A;  5L3B B;  4QH1 A;  3C4Z A;  5H6R B;  4IIJ E;  2BKO A;  2LHN A;  4GOU A;  4TWF A;  1UGO A;  2CHO A;  3FXE B;  2XUE A;  4X1K E;  1KNZ A;  5LB7 B;  2JQ9 A;  3MXZ A;  2XZE A;  1KF6 A;  2HN2 A;  2YDS A;  3PJA J;  4H63 H;  4YHJ A;  4GYR A;  5JR9 B;  2UUB T;  2EHO A;  5L3C B;  3UT5 E;  4XBF B;  3EAB A;  5FL1 A;  3AEB A;  3AEE A;  2PJQ A;  3F57 A;  3PUS A;  2OLT A;  1OED C;  4U74 A;  3ONL C;  1LVK A;  2V5D A;  1ZHC A;  5TAO A;  2H3R A;  2V7K A;  4IDO A;  5HWY A;  3KV5 A;  4ILB A;  4B3S T;  4KP3 C;  2XQ4 A;  4GKK T;  3UUB A;  2XM2 A;  1BR0 A;  3FHN A;  5LP6 E;  2KLQ A;  3LK4 2;  5JRE A;  1WRD A;  2OV9 A;  2WU2 A;  4P09 A;  2V6Y A;  1YQ3 A;  2JMH A;  3PUQ A;  4LF6 T;  3AAA B;  4CXW A;  2BVL A;  3Q9D A;  2YDQ A;  2I0M A;  5IYZ E;  1X79 A;  4UVC B;  1YXR A;  2KND A;  4ILU A;  2OA5 A;  3P4R A;  1D1B A;  3AA6 B;  3ETV A;  4ZEY A;  4LF5 T;  1H7C A;  3K3N A;  4NUV A;  2CMR A;  4J2C A;  2WY2 A;  2BG9 E;  2DWG A;  3ZYK A;  2I6H A;  2XQ3 A;  4DID B;  2LJL A;  3GA8 A;  2MTQ A;  4X5T A;  4OYK A;  1UK5 A;  5JVD E;  4LF7 T;  5FKY A;  5LMU T;  2BS3 A;  2XHE B;  4YSY A;  2N9D A;  2LEH A;  4EED A;  4YSZ A;  4BJM A;  2ACX A;  3VR9 A;  4HEA A;  3N9Q A;  2MYS A;  2W62 A;  3UFE A;  3GMI A;  2YIN A;  5LJM A;  4A98 A;  1IAP A;  4U2Y A;  1SHZ C;  3ZT7 A;  5DQV A;  3CQC B;  1WYB A;  1KNP A;  2HHH T;  4PJN A;  2J1D G;  1W0A A;  3H37 A;  3I9Y A;  1CUN A;  4JLE A;  3EAM A;  3CIR A;  2DNX A;  3N9L A;  5BR8 T;  1D0X A;  4BJN A;  2CLY C;  4LFA T;  2NOX A;  5AQK B;  4U7Y A;  5HXE A;  4MFR A;  3TLV A;  5FVL A;  3RIU C;  2XQ5 A;  2YU1 A;  4IDZ A;  1IJ6 A;  4EAH A;  3BQL A;  3W15 B;  1ZEE A;  4ADZ A;  4DV3 T;  4DV4 T;  4JEH B;  2BBJ A;  2K24 A;  1XDP A;  2W00 A;  4AKR B;  5ABF A;  2CA5 A;  4EB6 E;  4QXB B;  4L5G A;  1EZ3 A;  3FBZ A;  4PAG A;  5DAB A;  2X0Y A;  1HX1 B;  4AQF A;  3MKD A;  2YN6 A;  5H6Q B;  1KFY A;  2N1G A;  5M4Y A;  2E8I A;  3NVO A;  4N78 D;  2QRX A;  3IA3 A;  3AED A;  5LMN T;  4DR6 T;  5FXX A;  2G0U A;  4TWH A;  1IBM T;  3SS1 A;  1X9B A;  4JUY A;  4TNV A;  2WQY A;  3ZC0 A;  4O4L E;  3K1S A;  5C3J A;  4EYU A;  3TKL B;  2LLY A;  3AE8 A;  2DL1 A;  4FI5 A;  3K8P C;  4O2A E;  4UVA B;  4QH4 A;  3L09 A;  3VHL A;  3NRX A;  4UF0 A;  2IAK A;  2RP4 A;  4H9S E;  5IWA T;  1UX5 A;  1W9R A;  2Q9Q C;  4IE6 A;  5LCY A;  4DV0 T;  2QVA A;  4ZI3 D;  2A3D A;  4LFC T;  4C91 A;  3PUR A;  3KDS E;  3RKG A;  2Y48 B;  3C51 A;  2C0S A;  3LG7 A;  1T8B A;  5LG4 A;  3N9M A;  5FYM A;  3ZMV B;  1LKX A;  4E7S A;  1CHU A;  4YFS A;  4U2Z A;  5ABE A;  3PU8 A;  3OPC A;  2WZH A;  2KMF A;  4CZZ B;  1T98 A;  2X67 A;  2WS3 A;  4M1P A;  2UUC T;  2BKN A;  4I43 B;  2WMN A;  4IL4 A;  3P4W A;  3LFM A;  3ANW A;  4DR5 T;  4O4I E;  2BS2 A;  2WCA A;  1HG2 A;  5HEU A;  3E0Z A;  4YSX A;  5JR9 C;  2CLY B;  2X9W A;  2UU9 T;  5IHY A;  2XAG B;  1HR0 T;  5AQO B;  5JDM A;  3ZT5 A;  4HWC A;  1XNR T;  2XQ6 A;  4PW8 A;  5AQR B;  5L4E A;  5ETW A;  3FZK B;  4WW0 A;  1Y01 A;  2LM2 A;  5LOV E;  4CN1 A;  3X1D A;  1WCR A;  3NWI A;  1YKH B;  4JI3 T;  4QX8 B;  5DJQ C;  3IBP A;  3O4X E;  2IUB A;  3V5U A;  1J5W A;  2XPK A;  2ZMA A;  4HFD A;  4DMV A;  4GYS A;  3GN5 B;  4CXY A;  3PUW F;  5FXZ A;  4JEU B;  4PJL A;  2ODU A;  2LKH A;  1VCS A;  3AXJ B;  3IF8 B;  1WLX A;  2XAJ B;  3CML A;  1HNX T;  3VRA A;  4QH5 A;  2CBJ A;  2D9D A;  4DVD A;  2CXL A;  3CX7 B;  2VVN A;  4CXX A;  2XQY A;  2C5J A;  4A97 A;  5EZY E;  2BDE A;  2KXP B;  4TV8 E;  4JI5 T;  5AQQ B;  4XAX B;  2XAQ B;  2E5L T;  2LOP A;  1G8X A;  3UUM A;  5LYJ E;  2VL8 A;  3BK9 A;  3WI3 A;  1LVF A;  3RI5 A;  1BR4 A;  4IDN A;  2L3L A;  3HKE E;  2KWH A;  2A9U A;  2JRK A;  3RQW A;  2V8S V;  2B76 A;  4EZ4 A;  1MIW A;  2PBI A;  3RF1 A;  3K3Q C;  4KHP T;  3AVR A;  4JI4 T;  5LBM A;  5CJ5 A;  4GIW A;  3TLT A;  2CHN A;  3C64 A;  3AA7 B;  3RC3 A;  2JMK A;  4ZI3 C;  3ZSS A;  4PNI A;  4Z90 A;  3OJA A;  4U3C A;  4UVB B;  5AQL B;  2C5I T;  3C98 B;  4DMW A;  1UUR A;  3N9N A;  4Z91 A;  5CA1 E;  3RC8 A;  5HEG A;  4UXN B;  3B13 A;  1D1A A;  2BG9 B;  3ZMT B;  1OXZ A;  5LNK A;  2KWI B;  3RPU A;  4ZOL E;  4EYY R;  5AQF B;  1OED A;  2V7M A;  2E9X B;  1V9D A;  5F3J A;  4PK5 A;  5CFB A;  3RQU A;  3FB2 A;  4GKJ T;  3L39 A;  3JAF A;  2K3W A;  4I50 E;  2JIW A;  1NEK A;  4I4T E;  4PJJ A;  2RPA A;  4OHF A;  1MMG A;  1ZP0 A;  4U72 A;  1G73 A;  3NKZ A;  4IDP A;  1Z0P A;  2NWB A;  3PTR B;  4A5X A;  2XJ7 A;  1VRB A;  4CI2 B;  2JQH A;  1E1H B;  2QYW A;  4CN6 A;  3P7I A;  4HWD A;  4ZZC A;  3H3M A;  3U3I A;  2EHO C;  1YQ4 A;  3WAK A;  1HX8 A;  2LOS A;  2Q9Q D;  2WMO A;  2CWY A;  1MIV A;  4LF8 T;  2YOE A;  3IHR A;  5LG3 A;  3EI0 A;  5AQT B;  3J9X 1;  5L3E B;  4AQG A;  3AEF A;  4NIQ A;  3AEG A;  4B3M T;  3KVB A;  3G06 A;  2JPF A;  1DU2 A;  1XDO A;  4X64 T;  2D2S A;  5HEH A;  3ZYL A;  4X1I E;  3KBU A;  2XQ7 A;  2XAF B;  4IT4 A;  4KUM B;  4HN9 A;  2H7O A;  5DQW A;  3LBX B;  2XY8 B;  3FZH B;  3Q5X A;  3AE3 A;  3UQ4 A;  3PDY A;  4IE5 A;  2A72 A;  3OYZ A;  2BVM A;  4H9N C;  4ZXL A;  2GK9 A;  3F2E A;  2CWO A;  4DV6 T;  2V7L A;  3OKQ A;  4PJM A;  3E22 E;  3A5X A;  5JRC B;  1T7S A;  3L8R A;  4PK6 A;  2E9X D;  1UX4 A;  2WDR A;  2ZM2 A;  3AA0 B;  4DBR A;  2BBH A;  2M6B A;  3EDU A;  3RYF E;  5LGN B;  5FP3 A;  2PG8 A;  3OVU A;  1SUM B;  1ZV4 X;  2PTF A;  1HCI A;  3TLU A;  2XQ8 A;  3SWH A;  2H7V C;  2ZM6 T;  1UCU A;  3HKD E;  4HWH A;  3S4U A;  3RX6 A;  5A1L A;  2RA1 A;  3PUX F;  4A56 A;  4U31 A;  5KX5 E;  5J2U E;  3HI2 A;  3RIU A;  3O1J A;  4WZX A;  4MHC A;  2J47 A;  4KX6 A;  2JJ9 A;  1UUS A;  3ZJ2 A;  2XSB A;  4KMC A;  4ERR A;  1IBL T;  4QWN B;  3EVY A;  3LSV A;  1B7T A;  4JI0 T;  4TZ4 C;  1T72 A;  2CRB A;  3KV6 A;  2IHR 1;  5CA0 E;  3P4P A;  4H9R C;  5HEJ A;  4DR1 T;  2NTY A;  2ACZ A;  5JDH A;  3M65 A;  3MK7 C;  3UFG A;  3ZN0 B;  4EV6 A;  4PK4 A;  5AQI B;  4L9I A;  4TV9 E;  4UV8 B;  2K48 A;  2BKP A;  2VUR A;  2WWV A;  5AFU L;  5L2L A;  4IGU A;  4YJ2 E;  4AKL A;  2EHO B;  1IBK T;  4K0K T;  4DUZ T;  1WR0 A;  3CPZ A;  4TX5 A;  3I0Q A;  2ES0 A;  4KHZ F;  4P0B A;  1HTJ F;  1N36 T;  4X65 T;  1ZOY A;  4CQI A;  3EUH A;  3I1A A;  3PUG A;  3AE4 A;  1KK7 A;  2V7J A;  4PFP A;  2W4X A;  3RH3 A;  2D0U A;  3CWZ B;  2Q9Q A;  4DR3 T;  2ZM0 A;  2VQF T;  4AIU A;  2I59 A;  4UV9 B;  3M3Z B;  1YD8 G;  3SOL A;  4UEM A;  5HXC A;  4YLH A;  4AXP A;  2V6Y B;  3ZKR A;  3I9W A;  4X66 T;  3PUY F;  4LF4 T;  3KVA A;  3ZCI A;  2LSY A;  1IJ5 A;  4XZC A;  5LGU B;  2WSS V;  4BAY B;  2VQE T;  4Z8X A;  4ASK A;  3QB5 A;  5JQG E;  5C2T A;  4NPP A;  2CXF A;  4DV5 T;  3R6N A;  1QSD A;  3Q5W A;  4H9P C;  4EZH A;  5KDM C;  2AE9 A;  3LK2 B;  4IE0 A;  1NEN A;  4Q25 A;  2X9Y A;  2IDO B;  5CGM A;  2Z6E A;  2W0G A;  5HYA A;  4YTP A;  4AIS A;  2X51 A;  3NZQ A;  4ILA A;  3ABV A;  3SRZ A;  4X20 E;  2DCF A;  2IIU A;  4HFE A;  3N2G E;  3VU7 H;  5EK3 A;  1OED E;  5FY1 A;  4CI1 B;  4DUY T;  2K5B B;  3ETU A;  2LRL A;  1NAF A;  5JR9 A;  5F8P A;  4PFO A;  3JCF A;  1QUU A;  4UEL A;  2BG9 C;  3T1H T;  1R8I A;  3AE7 A;  2IML A;  2BZB A;  2E9X C;  2DLR A;  3JC6 C;  2ODV A;  3AAI A;  4P1N A;  2IW5 B;  2VVS A;  2EHO D;  2E2A A;  3OBV E;  3PUA A;  3QB5 K;  5HAX A;  4O4H E;  2Y8D A;  4B3T T;  3JAD A;  3T8O A;  2NP9 A;  2HH7 A;  4ZI2 D;  3QUJ A;  5LHH B;  2XSA A;  2XTL A;  5FMN A;  3UU6 A;  1BR1 A;  4AQY T;  3P4S A;  3T1Y T;  4ZS2 A;  3ZPO A;  3A8Y C;  4HKA A;  4EOZ B;  4HFH A;  1LRZ A;  4CN4 A;  2CM0 A;  2N2N A;  1N33 T;  3F31 A;  5LHG B;  5LXT E;  2W67 A;  2QA7 A;  2X9H A;  2LSJ A;  5AQP B;  3O9X A;  4DR4 T;  4JI8 T;  4HFI A;  5GON E;  4DND A;  3RGL A;  5LA6 E;  4DV2 T;  1M62 A;  3LJC A;  5AQN B;  3Q5D A;  3VRB A;  2MOZ A;  4IHJ E;  4QKN A;  5ABF B;  1QLB A;  4IE4 A;  2QGS A;  3B5M A;  3N9P A;  3C4W A;  2KIN B;  2WB5 A;  2WDV A;  4MBQ A;  2DHR A;  5LHI B;  2D0T A;  2W2U A;  3CX8 B;  5HCJ A;  4EGW A;  5JDG A;  3CQG B;  5BMV E;  2P9B A;  2YKS A;  3RYI E;  3AE6 A;  5J0Z A;  4WNK A;  4DR7 T;  2H88 A;  2JQK A;  3C4X A;  1XZY A;  2SPC A;  1MNE A;  4BA9 A;  3O1H A;  3ZLI A;  3C50 A;  1MND A;  2ZLY A;  4KBM B;  5KMG P;  3TLW A;  3CX6 B;  4UF0 B;  1FMW A;  2LKG A;  4F6R C;  2JQQ A;  2F4V T;  3RIF A;  3H3A A;  4DO0 A;  3DP7 A;  3SFE A;  3R84 B;  1WR6 A;  1GQE A;  5JH7 E;  2W66 A;  5L3G B;  2D5U A;  1VCT A;  2X9X A;  2MAW A;  2UXD T;  5AQS B;  3MJX A;  4TNW A;  1E7P A;  1O3X A;  3NZP A;  4H9O C;  3SFD A;  3N5L A;  3ZCJ A;  3ZT6 A;  5CB4 E;  3Q5E A;  3LDQ B;  2AXD S;  4JI6 T;  3P8C D;  2B1E A;  4V1A v;  1L0V A;  1WFD A;  2K9A A;  4DR2 T;  3CVR A;  3ESL A;  1HF8 A;  4IE7 A;  1MMN A;  3EDV A;  1XMQ T;  3FZF B;  1N32 T;  5HXR A;  3ANW B;  3VKH A;  3RYC E;  1MMA A;  4ZI7 E;  2J4G A;  5L3F B;  5HWX A;  4LMK A;  2IC6 A;  1N34 T;  4IST A;  4ZS3 A;  3AEC A;  2CCQ A;  3QK6 A;  4NUU A;  2XM1 A;  3AA1 B;  2UXC T;  3VR8 A;  3AEA A;  3AE9 A;  2FUP A;  2A2F X;  3AE2 A;  3DTO A;  2NW7 A;  4ZI2 C;  3K3O A;  2YU2 A;  2UXN B;  4HWF A;  2XQA A;  4ZZB A;  4YTM A;  5L3D B;  2UXX B;  1NWM X;  2KSR A;  4IRE A;  5HXH A;  4LMJ A;  4JBW F;  3UUN A;  1HNZ T;  4JYA T;  1JNZ A;  3KBT A;  5HXS A;  3OTO T; 
#chains in the Genus database with same CATH homology
 2VWA A;  3CKD A;  5FNV E;  4EIW A;  4TN7 B;  2VK9 A;  1HG2 A;  2C5K T;  5AFU L;  5L2L A;  4IGU A;  2KT9 A;  5JDF A;  2LHR A;  4YJ2 E;  3E0Z A;  2HPJ A;  1IZN B;  3FXD B;  1HS7 A;  2LSI A;  5JR9 C;  4AKL A;  4AI6 A;  2EHO B;  2CLY B;  5LGT B;  2X9W A;  2LE8 A;  5IHY A;  4P0A A;  2NTX A;  2XAG B;  3OYX A;  3CPZ A;  4TX5 A;  3I0Q A;  2ES0 A;  2CE7 A;  4ISS A;  5JDM A;  3HL6 A;  5C8Y E;  1WYC A;  3O1I A;  1ZKE A;  4P0B A;  1HTJ F;  2XAH B;  3BQK A;  4GK5 E;  4CQI A;  3EUH A;  3I1A A;  4PW8 A;  4H63 V;  3PUG A;  4QXH B;  3N2O A;  1KK7 A;  2V7J A;  3ZC1 A;  4PFP A;  5L3B B;  5ETW A;  3RH3 A;  2D0U A;  3CWZ B;  2Q9Q A;  3ZMU B;  4WW0 A;  4HTE A;  3C4Z A;  5LOV E;  3MZK B;  3JC6 D;  2ZM0 A;  1HG5 A;  3D0T A;  5H6R B;  2I59 A;  4IIJ E;  3V5S A;  2LHN A;  4GOU A;  4UV9 B;  1YKH B;  3ZEF B;  2VKO A;  1YD8 G;  3FXE B;  4QX8 B;  5DJQ C;  3IBP A;  2XUE A;  4UEM A;  4X1K E;  3SOL A;  5HXC A;  1KNZ A;  3BQI A;  3O4X E;  4AKG A;  3MXZ A;  4YLH A;  3V5U A;  4AXP A;  3I9W A;  4H63 H;  4C90 A;  2ZMA A;  4YHJ A;  3J7Y q;  4MLK A;  4GYR A;  5JR9 B;  5FXW A;  3ZMZ B;  3KVA A;  4DMV A;  4GYS A;  2DI4 A;  3ZCI A;  3GN5 B;  3UUX B;  2EHO A;  1IJ5 A;  2LSY A;  4XZC A;  5L3C B;  5LGU B;  4CXY A;  4AKI A;  3UT5 E;  2WSS V;  5FY7 A;  5FXZ A;  4BAY B;  4XBF B;  4JEU B;  2LSG A;  4PJL A;  4Z8X A;  2ODU A;  4ASK A;  3KV9 A;  5J1G A;  5JQG E;  2PJQ A;  3F57 A;  3PUS A;  2V1D B;  2CXF A;  3HA4 A;  3IF8 B;  1WLX A;  4U74 A;  3ZMS B;  2XAJ B;  5EK2 A;  3CML A;  1YW0 A;  1S94 A;  1QSD A;  3Q5W A;  3R6N A;  1LVK A;  3FBL A;  4H9P C;  1ZHC A;  5TAO A;  2H3R A;  2V7K A;  4EZH A;  3GWH A;  1S35 A;  5KDM C;  1D0Z A;  4G2A A;  3KV5 A;  3LK2 B;  2CXL A;  4IE0 A;  4WBO A;  5HWY A;  2X9Y A;  4DVD A;  3CX7 B;  4KP3 C;  4QXC B;  2Z6E A;  2W0G A;  4CXX A;  5HYA A;  3AVS A;  2X51 A;  4TUY E;  3NZQ A;  2XQY A;  2C5J A;  5EZY E;  5EK4 A;  2BDE A;  2KZ7 B;  2KXP B;  1BR0 A;  3FHN A;  2LSK A;  3SRZ A;  5LP6 E;  2KLQ A;  3LK4 2;  4TV8 E;  2XAS B;  4X20 E;  2DCF A;  5JRE A;  3ONX A;  1U4Q A;  1WRD A;  4XAX B;  2XAQ B;  3N2G E;  4P09 A;  3VU7 H;  5EK3 A;  2LOP A;  5JDN A;  5E0O A;  5FY1 A;  4CI1 B;  2K5B B;  3ETU A;  3AB3 B;  2JMH A;  1G8X A;  1NAF A;  3PUQ A;  5JR9 A;  5F8P A;  3UUM A;  5LYJ E;  2VL8 A;  3BK9 A;  4OK0 A;  4PFO A;  4E7Z A;  3WI3 A;  1LVF A;  3GN5 A;  1BR4 A;  3HKB E;  1QUU A;  2L3L A;  3AAA B;  4UEL A;  2WAU A;  3CQX C;  3HKE E;  4CXW A;  2KWH A;  2JRK A;  2BVL A;  3E08 A;  3Q9D A;  1YKE B;  4DBQ A;  1MMD A;  2BZB A;  2WWU A;  1FIO A;  2DLR A;  2E9X C;  3JC6 C;  1X79 A;  2ODV A;  3AAI A;  3MAC A;  4UVC B;  1MIW A;  4X1Y E;  5IYZ E;  4EZ4 A;  2KND A;  4ILU A;  2PBI A;  2IW5 B;  2OA5 A;  3DJB A;  1D1B A;  1Y64 B;  3AA6 B;  2EHO D;  3K3Q C;  2L9Q A;  3ETV A;  3IEE A;  3OBV E;  3PUA A;  3AVR A;  5HAX A;  5LBM A;  1OWA A;  4GIW A;  4O4H E;  1H7C A;  3C64 A;  3AA7 B;  3RC3 A;  2Y8D A;  2JMK A;  5FXV A;  3K3N A;  4NUV A;  3T8O A;  2NP9 A;  4ZI3 C;  2VKH A;  2HH7 A;  4PNI A;  3OJA A;  4UVB B;  4HGA A;  3QUJ A;  4ZI2 D;  4H9Q C;  2CMR A;  2C5I T;  3C98 B;  5LHH B;  4DMW A;  2XTL A;  3KFW X;  4J2C A;  5FMN A;  4WBN E;  2IC9 A;  2DWG A;  3ZYK A;  1BR1 A;  3N9N A;  3RRC A;  5CA1 E;  3RC8 A;  4UXN B;  2LJL A;  2VAS A;  3GA8 A;  3L3P A;  2MTQ A;  3B13 A;  4ZS2 A;  1D1A A;  4OYK A;  3ZPO A;  5JVD E;  2V26 A;  4HFV A;  4HKA A;  4AQF C;  4EOZ B;  3ZMT B;  1OXZ A;  5LNK A;  2KWI B;  2L8K A;  5FY0 A;  3RPU A;  4ZOL E;  1LRZ A;  4EYY R;  2XHE B;  2CM0 A;  2V7M A;  2E9X B;  2N2N A;  2M67 A;  1BR2 A;  2VB6 A;  2N9D A;  1V9D A;  2LEH A;  5F3J A;  3F31 A;  4PK5 A;  5LHG B;  4BJM A;  2ACX A;  3FB2 A;  5LXT E;  1D0Y A;  2QA7 A;  4O2B E;  5JDQ A;  2X9H A;  4I50 E;  4HEA A;  2LSJ A;  3N9Q A;  2MYS A;  2W62 A;  3O9X A;  2W61 A;  3UFE A;  4I4T E;  3GMI A;  2YIN A;  4PJJ A;  5GON E;  4DND A;  5LA6 E;  2MBG A;  5LJM A;  1IAP A;  3LJC A;  4OHF A;  5ADX L;  1MMG A;  1SHZ C;  3KIN B;  4U72 A;  1G73 A;  3PU3 A;  2MOZ A;  2HPL A;  4IHJ E;  5DQV A;  3CQC B;  1Z0P A;  1WYB A;  4QKN A;  2NWB A;  3PTR B;  4PJN A;  1VRB A;  4IE4 A;  2QGS A;  3N9P A;  4CI2 B;  3C4W A;  2J1D G;  2KIN B;  1E1H B;  3QC9 A;  3H37 A;  1FEW A;  3I9Y A;  3P7I A;  4MBQ A;  5LHI B;  1CUN A;  2DHR A;  4K0U A;  2D0T A;  4JLE A;  3CX8 B;  2DNX A;  3N9L A;  4O4J E;  1AJ3 A;  1D0X A;  3U3I A;  2EHO C;  2CLY C;  4BJN A;  5LJN A;  5JDG A;  2YEV C;  3WAK A;  1HX8 A;  2X0L B;  3CQG B;  2E9X A;  3N2K E;  5BMV E;  2LOS A;  2Q9Q D;  1FMV A;  1VOM A;  2NOX A;  2P9B A;  2WBL A;  3ZYM A;  3RYH E;  2WMO A;  3RYI E;  2CWY A;  1MIV A;  2CEA A;  5HXE A;  3IHR A;  4MFR A;  3RRW A;  4WNK A;  4ZHQ E;  3J9X 1;  2NW8 A;  4AQG A;  5L3E B;  2YU1 A;  4IDZ A;  1IJ6 A;  3HKC E;  4EAH A;  3BQL A;  3W15 B;  3C4X A;  1ZEE A;  3KVB A;  4ADZ A;  2SPC A;  2VKD A;  2JPF A;  2PFV A;  1MNE A;  3N9O A;  2D2S A;  3ZYL A;  4BA9 A;  3O1H A;  3ZLI A;  4X1I E;  3C50 A;  1D1C A;  4JEH B;  3KBU A;  1MND A;  4CI3 B;  2ZLY A;  4KBM B;  5KMG P;  1MIY A;  4EXT A;  2K24 A;  3CX6 B;  4UF0 B;  2W00 A;  2XAF B;  4YJ3 E;  4AKR B;  2CA5 A;  1FMW A;  4QXB B;  4EB6 E;  4F6R C;  2JQQ A;  4KUM B;  4L5G A;  1EZ3 A;  3H3A A;  3FBZ A;  3U78 A;  3B57 A;  4HN9 A;  4PAG A;  4DO0 A;  3DP7 A;  2H7O A;  5DQW A;  3VKG A;  5DAB A;  3LBX B;  3R84 B;  1WR6 A;  4UIG A;  4AQF A;  3HR0 A;  3MKD A;  5JH7 E;  3Q5X A;  4I55 E;  5L3G B;  3PDY A;  2D5U A;  5H6Q B;  2N1G A;  5M4Y A;  2E8I A;  4IE5 A;  2A72 A;  4N78 D;  2X9X A;  3OYZ A;  3MJX A;  1SA0 E;  5FXX A;  2BVM A;  4H9N C;  2G0U A;  2GK9 A;  3F2E A;  4HE8 A;  1O3X A;  3NZP A;  2CWO A;  3SS1 A;  5LBQ B;  4H9O C;  2V7L A;  1HFA A;  3N5L A;  4JUY A;  3ZCJ A;  2WM9 A;  3OKQ A;  4PJM A;  3E22 E;  3A5X A;  3ZC0 A;  5JRC B;  4O4L E;  4OYJ A;  5CB4 E;  4EYU A;  3TKL B;  2X66 A;  4GK0 E;  4PK6 A;  2E9X D;  3I0O A;  4L0R A;  1UX4 A;  4FI5 A;  2ZM2 A;  3K8P C;  4O2A E;  4UVA B;  3P8C D;  3AA0 B;  2B1E A;  3ZJ1 A;  4DBR A;  3AAE B;  3EDU A;  3L09 A;  3RYF E;  3VHL A;  5LGN B;  4V1A v;  5FP3 A;  3NRX A;  4UF0 A;  2IAK A;  2PG8 A;  2RP4 A;  1ZV4 X;  2K9A A;  4H9S E;  2NW9 A;  1UX5 A;  4G63 A;  5JDL A;  3CVR A;  1HCI A;  4FJO A;  3ESL A;  3NBX X;  1HF8 A;  4IE7 A;  1MMN A;  3EDV A;  2Q9Q C;  4IE6 A;  5LCY A;  4B6X A;  3MA9 A;  3KV4 A;  3LBX A;  4ZI3 D;  2A3D A;  4AKH A;  3SWH A;  2H7V C;  2YK0 A;  2Y6X A;  5HXR A;  3ANW B;  1UCU A;  3HKD E;  4C91 A;  3VKH A;  3PUR A;  1MMA A;  3NRY A;  3RYC E;  3KDS E;  3S4U A;  3RX6 A;  2LT3 A;  5A1L A;  2LM9 A;  2RA1 A;  4ZI7 E;  2Y48 B;  4A56 A;  3C51 A;  2VKJ A;  2V7I A;  5L3F B;  3UUL A;  2C0S A;  3LG7 A;  5KX5 E;  2X68 A;  5HWX A;  5J2U E;  3HI2 A;  5LG4 A;  3RKO A;  3WAJ A;  3N9M A;  1U5P A;  5FYM A;  3UTK A;  2IC6 A;  3O1J A;  4IST A;  4ZS3 A;  3ZMV B;  2CCQ A;  1LKX A;  4E7S A;  2ZM8 A;  3QK6 A;  4MHC A;  4YFS A;  4NUU A;  5JRC A;  3PE0 A;  3AA1 B;  3PU8 A;  4MAL A;  2JJ9 A;  1US7 B;  2KMF A;  3ZJ2 A;  4CZZ B;  4KMC A;  4ERR A;  4ANJ A;  2A2F X;  5J2T E;  1T98 A;  2CXD A;  2X67 A;  4QWN B;  3EVY A;  1B7T A;  4O8S A;  3DTO A;  2NW7 A;  4QX7 B;  4TZ4 C;  3ZN1 B;  4ZI2 C;  3K3O A;  3Q2M A;  4OFZ A;  2YU2 A;  2UXN B;  3KV6 A;  2DWK A;  5CA0 E;  3LK3 B;  4M1P A;  4H9R C;  2W63 A;  2Q9Q B;  5L3D B;  2UXX B;  4I43 B;  1NWM X;  2WMN A;  2NTY A;  4QHO A;  3LFM A;  5JDH A;  5HXH A;  3M65 A;  3MK7 C;  3ZN0 B;  4PK4 A;  3UUN A;  3ANW A;  4L9I A;  3KBT A;  4TV9 E;  4UV8 B;  5HXS A;  4O4I E;  2K48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...