2MTQA

Solution structure of a de novo designed peptide that sequesters toxic heavy metals
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
MGSWAEFKQRLAAIKTRCQALGGSEAECAAFEKEIAAFESELQAYKGKGNPEVEALRKEAAAIRDECQAYRHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apoprotein Structure and Metal Binding Characterization of a de Novo Designed Peptide, alpha 3DIV, that Sequesters Toxic Heavy Metals.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords Designed Peptide
total genus 23
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2014-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2mtqA00
2A3DA 2MTQA
chains in the Genus database with same CATH superfamily
4P1NA 4GKJT 3AA1B 3PUWF 3PU3A 5L3CB 1YQ3A 4QXHB 3ZEFB 4DR2T 1HG5A 4TUYE 1DU2A 4KI0F 3CPZA 5BMVE 2K3WA 4IIJE 2V26A 3NBXX 2XQ8A 4HFIA 2BVLA 4IL4A 3RKGA 5IUXA 5J0ZA 4AKGA 2MYSA 1KK7A 4UVCB 1NEKA 2EHOA 5JR9B 4CI3B 5FKYA 2HPLA 1MNDA 3RH3A 3ZT5A 4HWIB 3ABVA 4ADZA 3KVBA 2W61A 4TV8E 4EOZB 1HNWT 3KV4A 1IJ6A 4F8HA 2UU9T 5AQOB 2XAJB 5J2TE 4MFRA 3RIUC 3L8RA 1W0BA 2DWKA 5LJMA 1OEDC 4A98A 2NW8A 3DTOA 5CGMA 2IIUA 4ANJA 2H3RA 4ILCA 2CHNA 4NPPA 4NUVA 2IMLA 1EZ3A 2YINA 3RGLA 3ETVA 3H3AA 2N1GA 2KT9A 5CB4E 4ZI7E 3N9MA 4AKLA 4LFBT 4WYVA 2CEAA 4QXCB 3HKCE 3PUQA 2WCAA 3CX8B 3AE2A 4AQGA 4CN4A 3Q2MA 4G63A 1MMDA 4HFDA 5ABFA 5JDFA 4H9OC 2WDVA 2CHOA 4ZOLE 2VKOA 5HXEA 2BS4A 1KNRA 5FMNA 3ANWB 4U7IA 3LBXB 1WFDA 1H7CA 2N9DA 2XPKA 4EAHA 3RYIE 2H88A 4DR3T 4U72A 4TX5A 1WCRA 2BG9A 3UUMA 1Z8UA 4JI4T 2F4VT 4DV3T 1KEYA 1D1AA 4GYSA 1T98A 4KBMB 1AJ3A 4CN6A 1E2AA 2WU5A 4QKNA 2QYWA 3BK9A 4NIQA 5KDMC 5KX5E 3B57A 3ZYLA 5AQJB 2K9AA 4CQIA 1UURA 4HFCA 2RP4A 3LJCA 5F5WA 3PUGA 2GK9A 2HH7A 2V5CA 2A72A 3P4WA 3N2GE 1E7PA 5LMNT 2LEHA 3PJAA 4JYAT 3BQLA 4AQFC 2V7MA 3P4PA 4P0AA 4DR6T 1D0ZA 3HA4A 3U78A 4DIDB 4A56A 5AFUL 5KMGP 4HWFA 2JPFA 3ZCJA 5CJ5A 1OEDA 5LJNA 3F57A 3ONJA 4EV6A 5CA0E 5DJQC 3FZHB 5FY0A 3SFEA 4GK5E 5H6QB 4CI2B 5L4EA 2W00A 1XMQT 2LRKA 4YTNA 4DNDA 4TZ4C 3QK6A 4Z91A 4UIGA 4UR9A 2X0YA 3VU7H 4IE0A 5JH7E 3NWIA 1CUNA 4PFPA 5LBMA 1NWMX 2PFVA 3JCFA 4JV5T 1WYBA 2ACZA 4TWHA 1YKHB 4PJMA 4KX6A 3RC8A 4U31A 5H6RB 1LVKA 1MMGA 1VCSA 3JAFA 2W66A 1D1CA 3EHZA 4HFVA 3W15B 1JNZA 3AEDA 4U2YA 5AQNB 4LF8T 5FY1A 2VB6A 1UCUA 2CWOA 2JQQA 3SRZA 5JDHA 3T1HT 2BG9C 3AAAB 5JVDE 3AEEA 3AE6A 2WQYA 2MBGA 4UV8B 3ZMZB 4O8SA 4PW8A 2D2SA 4WNKA 3WI3A 2ODUA 1WR0A 2XQ3A 3N9OA 2BS3A 1BR2A 3O1IA 5HXRA 1KF6A 2M6IA 2X9YA 3ONXA 2D5UA 2Y8DA 3Q5EA 5C2TA 2DWGA 2IUBA 2XQ4A 3AVRA 3NZPA 4EYYR 5HEUA 1I94T 4CN1A 1I6ZA 4DUZT 2XY8B 3RQUA 2UXBT 2XSAA 2KSRA 2LLYA 3PJAJ 2MOZA 4IDZA 5AQMB 3WAKA 2VK9A 2LSKA 3KV6A 4EZHA 1QSDA 3N2KE 4J2CA 3TLSA 3ZT6A 3AE9A 4HWHA 3H3MA 4HFBA 4JEUB 3RRCA 1IAPA 3TKLB 4EEBA 2V8SV 5LGTB 2UUCT 2YU2A 3AVSA 2XQYA 4ISTA 1CHUA 4PK4A 1VRBA 1U5PA 1UX4A 2CXDA 1MIYA 2I59A 5AQQB 4COFA 4ZHQE 2PBIA 4KUMB 1M7KA 2VL8A 2X51A 3CX7B 2QGSA 4AISA 5AQUB 4E7ZA 3FZLB 3FZKB 2CBIA 4DV2T 1J5ET 2UUAT 4KHPT 1ZHCA 1WYCA 4AIUA 3E08A 1IBLT 1LVFA 3AE5A 3C64A 2V7IA 4DBRA 3KVAA 4X1IE 3NRXA 4GOUA 2XAHB 2FJDA 3RHWA 3ZLIA 1IBKT 3HI2A 3K1SA 2BZBA 2LSGA 5AQIB 5L4HA 1X79A 2LSJA 3OPCA 4O2BE 3ANWA 2WWVA 2QRXA 4PJNA 2LE8A 4EEDA 4WBNE 1N34T 4UEMA 2BG9B 3KBUA 2FUPA 4TN7B 3Q5DA 3AA6B 3UU4A 4IE7A 2VVSA 3C98B 4EYUA 5LG3A 4O4HE 4TNVA 5DABA 5DQVA 1L0VA 5L47A 3VRBA 3J7Yq 2C0SA 1OEDE 2J1DG 4C91A 5FXVA 2X9WA 3UUNA 1OEDB 1M62A 5LYJE 4L5GA 3IEEA 5CFBA 5GONE 1S35A 5JDGA 3MZKB 2WMNA 4YHJA 2VKJA 5EK2A 3MKDA 4DVDA 3FZMB 2R6GF 1UK5A 2IAKA 2DNXA 2WAUA 2CXLA 2Y48B 3PE0A 2P9BA 4HEAA 4YJ2E 4YTMA 4JI7T 2L8KA 3N2OA 2E9XD 4O4IE 3X1DA 4GKKT 3FBLA 2LHRA 3PUXF 4QX8B 4MBQA 2YDSA 4EB6E 4YTPA 1FJGT 1T7SA 2X68A 3C4XA 4ISSA 4I4TE 4TWDA 3UFEA 4V1Av 1J5WA 4JI5T 2DLRA 5F8PA 4YT0A 5JR9C 4JI2T 2WBLA 2LT3A 1O3XA 4DV0T 1VCTA 4PFOA 2WMOA 4AKRB 5ADXL 2IHR1 3HKDE 1MMNA 4GK0E 2D0UA 1G8XA 4XZCA 5L3EB 5JDNA 4DV1T 4YLHA 3VKHA 2W63A 2JJ9A 2W2UA 2UXXB 3I0OA 2X9XA 3MACA 3WAJA 2M6BA 2HPJA 2PTFA 2X0HA 3A7MA 3UUXB 4AQYT 2LJLA 4LF7T 4IDNA 1XNQT 2Q9QC 2JQHA 4QX7B 5CA1E 4XAXB 3EUHA 1SHZC 1HNXT 4Q25A 2E9XB 3O9XA 3P7IA 3C50A 2W0GA 4UV9B 2CA5A 3RF1A 4OK0A 3SWHA 3LFMA 2MPKA 2V1DB 3FZFB 3AEBA 5L3DB 5KXJA 4ZS2A 3UUBA 4YY3T 2L3LA 3RC3A 5JTGA 1OXZA 3C4ZA 2BKOA 3CQCB 4O4JE 2X0LB 4ILBA 4QH4A 5ABFB 3OTOT 4X1KE 5ABGA 3P4QA 2CXFA 4IE5A 2ES0A 2C5IT 4IGUA 3TLVA 2D0TA 4A97A 2ZM6T 4DR1T 1W0AA 3RRWA 2LOSA 1XMOT 1YQ4A 1HX8A 4I50E 3ZMUB 4DV7T 3AXJB 3N9NA 3AAIA 5EZYE 1MNEA 2DCFA 3AA7B 4K0UA 2A3DA 2VKDA 3IBPA 4JLEA 3SFDA 5AQFB 2VURA 1LRZA 1BR1A 1WR6A 5LGUB 3CIRA 4QWNB 2SPCA 3PUZF 3GA8A 2LM2A 1ZV4X 2WY2A 3ZSTA 3FBZA 3AE7A 4E7SA 1WLXA 1NENA 2V7LA 5ABEA 5LP6E 2DL1A 2ZMAA 3KBTA 4DV5T 1HS7A 3IHRA 2XHEB 3UU8A 3N9PA 2XQ7A 3K3QC 1MIVA 1ZKEA 3NVOA 3U3IA 2RPAA 3RIUA 1NAFA 2YOEA 1OWAA 4KHZF 5EK3A 4O2AE 3RYFE 4DMVA 2DI4A 3JAEA 3V5UA 1XWMA 2VQET 2ZM8A 2JIWA 2CM0A 3A8YC 1WRDA 3EDUA 3OBVE 5LA6E 1Z0PA 2KWIB 2E9XC 2BKNA 3PUSA 5AQSB 4DR4T 3QC9A 1ZP0A 4KP3C 2XQAA 4CXYA 4JI8T 3GMIA 5L3FB 3P50A 5L3GB 4CZZB 5ABHA 4QH5A 3O4XE 3BQKA 3FHNA 2E5VA 3NKZA 4OX9T 2WWUA 4H63H 3EI0A 5HYAA 2KLQA 4HFHA 2BDEA 3NRYA 4HWCA 1J1JA 5M4YA 4JI0T 3A5XA 1HG2A 3Q9DA 2V6YA 2PG8A 2XTLA 2V7KA 4P09A 2CMRA 2IDOB 5AQLB 5HAXA 3I9WA 2NP9A 4IL9A 3RX6A 2JMKA 1XDOA 3ZMSB 2NW7A 2Q9QD 2ZM0A 1FEWA 3KFWX 3AEFA 3PURA 4EZ4A 5LGNB 3P4RA 5HXHA 2E9XA 2W62A 2VVNA 2OA5A 3ZJ1A 2ACXA 2XUEA 3CVRA 3LG7A 5FXZA 3RQWA 4JI3T 5HCJA 5L3BB 3L09A 5JRCB 1HTJF 3PUYF 1R8IA 2AE9A 1SUMB 2B1EA 2D9DA 3C51A 3HKEE 2X67A 3JADA 3MXZA 3NZQA 3PTRB 4YFSA 1W9RA 3JC6D 2J4GA 1US7B 4UVAB 4OYJA 3B5MA 5FXWA 5IWAT 4X5TA 4H9SE 1HCIA 1YKEB 3ESLA 3GN5B 5JQGE 5AQRB 3UULA 3BQIA 2BS2A 2A9UA 1XZYA 3QB5K 4U74A 4UVBB 3AXJA 4WBOA 1MMAA 2AXDS 5FXXA 2NTXA 2BBHA 5LNKA 3UTKA 2Y6XA 4TV9E 2J62A 4PK6A 2H7VC 3RKOA 2NR4A 2BG9E 2VWAA 5LXTE 2JQ9A 2K48A 2WZHA 2I0MA 1FMVA 1W09A 2XQ5A 5LHIB 3PV0F 4HKAA 4QHOA 2VL0A 3MJXA 2YDQA 4BJMA 4WW0A 4IDOA 1SE7A 4OFZA 4OYKA 4O4LE 3Q5XA 1E1HB 2X66A 4ZS3A 1YW0A 3PDYA 4G2AA 1IZNB 3QUJA 3RYHE 4YSZA 4X64T 3HKBE 4GYRA 3AEAA 4I0UA 3CWZB 2ZM2A 4JI1T 5TAOA 4TWFA 1QLBA 2KZ7B 2FJBA 2ODVA 3AB3B 3F2EA 5HWYA 3LK2B 5JDMA 2VASA 3RIAA 5LHHB 2C5KT 3ZYMA 3N9QA 1V9DA 4X20E 3ZN1B 5EK4A 3UU3A 3ONLC 3TLTA 4X1YE 1D0YA 2CCQA 5FVKA 4U2ZA 2XASB 2V7JA 4UXNB 4AQFA 5HWXA 4CXXA 3I1AA 2RA1A 3QOFA 3AE8A 2HN2A 3L39A 4PAGA 2WSSV 3ZYKA 5HXSA 4GIWA 3C4WA 3UU6A 2OV9A 4X65T 3OKQA 4A5XA 2E8IA 3RIFA 4ZI2C 1QUUA 3LSVA 2J47A 2XJ7A 5HXCA 3ZKRA 4LMKA 4LFCT 4ZZBA 4IE6A 2IW5B 2LRLA 5LHGB 5FNVE 3QNUA 4PJLA 4AXPA 2XSBA 4HFEA 4ZI2D 4NXMT 4WZXA 1XNRT 3EAMA 3GWHA 4AKHA 3HR0A 3I0QA 1HFAA 1KNPA 3EABA 2JQKA 1HX1B 2XQ6A 3GN5A 4ZXLA 3CMLA 4UELA 4YSXA 2UXCT 3D0TA 4H9QC 2YKSA 5IHYA 3T8OA 5DQWA 4EIWA 1D0XA 3B13A 4UF0A 2KXPB 5AQPB 5A1LA 5HEGA 2M67A 4PNIA 4YJ3E 2YEVC 3AE1A 4TNWA 4ZEYA 4LFAT 3AEGA 3R6NA 5LBQB 5J2UE 3DP7A 5AQKB 4LF6T 2BBJA 1N33T 2BKPA 2LSYA 4Z90A 4DV4T 3F31A 5F3JA 5HCMA 3L3PA 3LK3B 4CI1B 3ETUA 2CPTA 1FMWA 2CLYC 4X66T 2WB5A 4KMCA 2HHHT 2CBJA 1KFYA 2V6YB 1ZEEA 2OLTA 2V5DA 1JNRA 2PJQA 3ZSSA 3EDVA 5FVLA 4YXDA 3VHLA 1BR4A 3LDQB 4LF4T 2A2FX 3FXEB 4EXTA 2UXNB 2X9HA 3FXDB 4AI6A 1HF8A 2G0UA 2XZEA 3N9LA 3RPUA 4B3ST 2NTYA 2LKHA 4CXWA 4AKIA 2KMFA 3FB2A 3K3NA 3O1HA 4H9RC 2VKHA 2XAQB 3E22E 1UGOA 4QXBB 4P0BA 5AQVB 1LKXA 2MTQA 2Q9QB 2H7OA 2ZLYA 1T72A 3HL6A 3S4UA 3OJAA 4HWDA 1UX5A 2LOPA 4M1PA 4F6RC 3PUAA 4NXNT 4B3MT 3KINB 5JREA 5FY7A 3VR9A 3IA3A 4U7YA 3MK7C 4PK5A 2YDRA 2W4XA 3AE4A 1Y64B 4MHCA 3AA0B 5AQGB 4ASKA 2E5LT 4I55E 2YK0A 3LBXA 3ZC0A 4IHJE 4FJOA 3CKDA 1G73A 2LM9A 1HNZT 4B3TT 4IREA 4ZZCA 2XQ9A 2C5JA 3IF8B 4XBFB 4JBWF 2KINB 4C90A 1Y01A 3ZMVB 2XAGB 4BA9A 2XM1A 4DBQA 5FYMA 1HR0T 4UF0B 2LKGA 3Q5WA 2FJAA 2LSIA 2QA7A 3O1JA 2IC6A 3CQXC 4PJJA 1XDPA 2WU2A 5C3JA 5LCYA 4IE4A 1T8BA 3N5LA 5LMUT 1KNZA 4N78D 5HEOA 3VRAA 4DR5T 2LHNA 2XM2A 2VQFT 3LK42 2NW9A 2YN6A 1MIWA 1ZOYA 2QVAA 4HTEA 4JUYA 4BJNA 4H9PC 4DMWA 4DUYT 3RLFF 5JRCA 3VKGA 3CQGB 5C8YE 5JDQA 3ZC1A 3UT5E 2KNDA 3KV5A 3ZCIA 1GQEA 5LG4A 3AE3A 1IJ5A 3MA9A 4HE8A 2NWBA 3KDSE 4QH1A 5E0OA 3UQ4A 3VR8A 3PUVF 3G06A 4JEHB 1X9BA 3EVYA 4DV6T 2NOXA 4LF5T 3R84B 3T1YT 4LMLA 2JMHA 4I43B 5J1GA 3RI5A 3ZT7A 1SA0E 2FBWA 1VOMA 1YD8G 5LOVE 3ZMTB 3OVUA 5FP3A 1BR0A 5HEHA 1S94A 3KV9A 4ILAA 2WM9A 3P4SA 3AECA 5ETWA 3RYCE 5BR8T 4L9IA 4DO0A 5FL0A 2DHRA 5AQTB 5LB7B 3SOLA 2EHOD 2H89A 2I6HA 4IDQA 4ZI3D 3ZJ2A 1B7TA 2CLYB 2YU1A 2EHOB 3QB5A 4HGAA 1D1BA 4HN9A 5JR9A 2B76A 4H9NC 3AAEB 2EHOC 4ZI3C 4ERRA 1UUSA 3K8PC 2CWYA 2IC9A 4H63V 2WDRA 4LMJA 4DR7T 2W67A 1N32T 4IT4A 4EGWA 2WP9A 3TLWA 3J9X1 3ZN0B 2FJEA 2L9QA 3ZPOA 5JDLA 3CX6B 4NUUA 2UUBT 2K5BB 3CK6A 3P8CD 3DJBA 3UFGA 4U33A 2KWHA 2WZIA 3UQ7A 3PU8A 4ILUA 4YHHT 4L0RA 2WDQA 4K0KT 3I9YA 4B6XA 4MALA 2WS3A 4B3RT 4U3CA 2UXDT 3K3OA 4OHFA 2E2AA 3H37A 4MLKA 3JC6C 3V5SA 2XAFB 4JI6T 2Z6EA 2BVMA 5L2LA 4BAYB 3SS1A 3UU5A 4X62T 1N36T 4YSYA 2JRKA 3OYXA 3E0ZA 2N2NA 4FI5A 1U4QA 2MAWA 4Z8XA 5AQHB 3M3ZB 1YXRA 2CRBA 5HEJA 3TLUA 1IBMT 2CE7A 4LF9T 3M65A 5IYZE 5FL1A 4IDPA 2Q9QA 2V6XA 2K24A 2HN1A 3OYZA 1FIOA
chains in the Genus database with same CATH topology
3AA1B 3PU3A 5L3CB 4QXHB 3ZEFB 1HG5A 4TUYE 3CPZA 5BMVE 4IIJE 2V26A 3NBXX 2BVLA 4AKGA 2MYSA 1KK7A 4UVCB 2EHOA 5JR9B 4CI3B 2HPLA 1MNDA 3RH3A 4ADZA 3KVBA 2W61A 4TV8E 4EOZB 3KV4A 1IJ6A 2XAJB 5J2TE 4MFRA 2DWKA 5LJMA 2NW8A 3DTOA 4ANJA 2H3RA 4NUVA 1EZ3A 2YINA 3ETVA 3H3AA 2N1GA 2KT9A 5CB4E 4ZI7E 3N9MA 4AKLA 2CEAA 4QXCB 3HKCE 3PUQA 3CX8B 4AQGA 3Q2MA 4G63A 1MMDA 5JDFA 4H9OC 4ZOLE 2VKOA 5HXEA 5FMNA 3ANWB 3LBXB 1H7CA 2N9DA 4EAHA 3RYIE 4U72A 4TX5A 3UUMA 1D1AA 4GYSA 1T98A 4KBMB 1AJ3A 4QKNA 3BK9A 5KDMC 5KX5E 3B57A 3ZYLA 2K9AA 4CQIA 2RP4A 3LJCA 3PUGA 2GK9A 2HH7A 2A72A 3N2GE 2LEHA 3BQLA 4AQFC 2V7MA 4P0AA 1D0ZA 3HA4A 3U78A 4A56A 5AFUL 5KMGP 2JPFA 3ZCJA 3F57A 5CA0E 5DJQC 5FY0A 4GK5E 5H6QB 4CI2B 2W00A 4DNDA 4TZ4C 3QK6A 4UIGA 3VU7H 4IE0A 5JH7E 1CUNA 4PFPA 5LBMA 1NWMX 2PFVA 1WYBA 1YKHB 4PJMA 3RC8A 5H6RB 1LVKA 1MMGA 1D1CA 4HFVA 3W15B 5FY1A 2VB6A 1UCUA 2CWOA 2JQQA 3SRZA 5JDHA 3AAAB 5JVDE 2MBGA 5JDQA 4UV8B 3ZMZB 4O8SA 4PW8A 2D2SA 4WNKA 3WI3A 2ODUA 3N9OA 3O1IA 1BR2A 5HXRA 2X9YA 3ONXA 2D5UA 2Y8DA 2DWGA 3AVRA 3NZPA 4EYYR 3WAKA 2MOZA 4IDZA 2VK9A 2LSKA 3KV6A 4EZHA 1QSDA 3N2KE 4J2CA 3RRCA 4JEUB 3TKLB 1IAPA 5LGTB 2YU2A 3AVSA 2XQYA 4ISTA 4PK4A 1VRBA 1U5PA 1UX4A 2CXDA 1MIYA 2I59A 4ZHQE 2PBIA 4KUMB 2VL8A 2X51A 3CX7B 2QGSA 4E7ZA 1ZHCA 1WYCA 3E08A 1LVFA 3C64A 2V7IA 5LXTE 3KVAA 4X1IE 3NRXA 4GOUA 2XAHB 3ZLIA 3HI2A 2BZBA 2LSGA 1X79A 2LSJA 4O2BE 3ANWA 4PJNA 2LE8A 4WBNE 4UEMA 3KBUA 4TN7B 3AA6B 4EYUA 4IE7A 3C98B 4O4HE 5DABA 5DQVA 3J7Yq 2C0SA 4C91A 2J1DG 5FXVA 2X9WA 3UUNA 5LYJE 4L5GA 3IEEA 5GONE 1S35A 5JDGA 3MZKB 2WMNA 4YHJA 2VKJA 5EK2A 3MKDA 4DVDA 2IAKA 2DNXA 2WAUA 2CXLA 2Y48B 3PE0A 2P9BA 4HEAA 4YJ2E 4XBFB 2L8KA 3N2OA 2E9XD 4O4IE 3FBLA 2LHRA 4QX8B 4EB6E 4MBQA 2X68A 3C4XA 4ISSA 4I4TE 3UFEA 4V1Av 2DLRA 5F8PA 5JR9C 2WBLA 2LT3A 1O3XA 4PFOA 2WMOA 4AKRB 3HKDE 1MMNA 4GK0E 2D0UA 1G8XA 4XZCA 5L3EB 5JDNA 3VKHA 4YLHA 2W63A 2JJ9A 2UXXB 3I0OA 2X9XA 3MACA 3WAJA 2HPJA 3UUXB 2LJLA 2Q9QC 4QX7B 5CA1E 4XAXB 3EUHA 1SHZC 2E9XB 3O9XA 3P7IA 3C50A 2W0GA 4UV9B 2CA5A 4OK0A 3SWHA 3LFMA 2V1DB 5L3DB 4ZS2A 2L3LA 3RC3A 1OXZA 3C4ZA 3CQCB 4O4JE 2X0LB 4X1KE 2CXFA 4IE5A 2ES0A 2C5IT 4IGUA 2D0TA 3RRWA 2LOSA 1HX8A 4I50E 3ZMUB 3N9NA 3AAIA 5EZYE 1MNEA 2DCFA 3AA7B 4K0UA 2A3DA 2VKDA 3IBPA 4JLEA 1LRZA 1BR1A 1WR6A 5LGUB 4QWNB 2SPCA 3GA8A 1ZV4X 3FBZA 4E7SA 1WLXA 2V7LA 5LP6E 2ZMAA 3KBTA 1HS7A 3IHRA 2XHEB 3N9PA 3K3QC 1MIVA 1ZKEA 3U3IA 1NAFA 1OWAA 5EK3A 4DMVA 4O2AE 3RYFE 2DI4A 3V5UA 2ZM8A 2CM0A 1WRDA 3EDUA 3OBVE 5LA6E 1Z0PA 2KWIB 2E9XC 3PUSA 3QC9A 4KP3C 4CXYA 3GMIA 5L3FB 5L3GB 4CZZB 3O4XE 3BQKA 3FHNA 2WWUA 4H63H 5HYAA 2KLQA 2BDEA 3NRYA 5M4YA 3A5XA 1HG2A 3Q9DA 2PG8A 2XTLA 2V7KA 4P09A 2CMRA 5HAXA 3ZMSB 5ADXL 3I9WA 2NP9A 3RX6A 2JMKA 2NW7A 2Q9QD 2ZM0A 1FEWA 3KFWX 3PURA 5LGNB 4EZ4A 5HXHA 2E9XA 2W62A 2OA5A 3ZJ1A 2ACXA 2XUEA 3CVRA 3LG7A 5FXZA 5JRCB 5L3BB 1HTJF 3ZMTB 3C51A 3HKEE 3MXZA 2B1EA 3PTRB 4AQFA 2X67A 3NZQA 4YFSA 3JC6D 4UVAB 1US7B 4OYJA 5FXWA 4H9SE 1HCIA 1YKEB 3ESLA 3GN5B 5JQGE 3UULA 3BQIA 4U74A 4UVBB 4WBOA 1MMAA 5FXXA 2NTXA 5LNKA 3UTKA 2Y6XA 4TV9E 4PK6A 2H7VC 3RKOA 2VWAA 2K48A 5LHIB 1FMVA 4QHOA 4HKAA 3MJXA 4BJMA 4WW0A 4OFZA 4OYKA 4O4LE 3Q5XA 1E1HB 2X66A 4ZS3A 1YW0A 3PDYA 4G2AA 1IZNB 3QUJA 3RYHE 3HKBE 4GYRA 3CWZB 2ZM2A 5TAOA 2KZ7B 2ODVA 3AB3B 3F2EA 5HWYA 3LK2B 5JDMA 2VASA 5LHHB 2C5KT 3ZYMA 3N9QA 1V9DA 4X20E 3ZN1B 5EK4A 4DBRA 4X1YE 1D0YA 2CCQA 4UXNB 2XASB 2V7JA 5HWXA 4CXXA 3I1AA 2RA1A 4PAGA 2WSSV 3ZYKA 5HXSA 4GIWA 3C4WA 3OKQA 2E8IA 4ZI2C 1QUUA 5HXCA 4IE6A 2IW5B 5LHGB 5FNVE 4PJLA 4AXPA 4ZI2D 4AKHA 3GWHA 3HR0A 3I0QA 1HFAA 3GN5A 3CMLA 4UELA 3D0TA 4H9QC 5IHYA 3T8OA 5DQWA 4EIWA 1D0XA 3B13A 4UF0A 2KXPB 5A1LA 2M67A 4PNIA 4YJ3E 2YEVC 3R6NA 5LBQB 5J2UE 3DP7A 2LSYA 3F31A 5F3JA 3L3PA 3LK3B 4CI1B 3ETUA 1FMWA 2CLYC 4KMCA 1ZEEA 2PJQA 3EDVA 3VHLA 1BR4A 2A2FX 3FXEB 4EXTA 2UXNB 2X9HA 3FXDB 4AI6A 1HF8A 2G0UA 3N9LA 3RPUA 2NTYA 4CXWA 4AKIA 2KMFA 3FB2A 3K3NA 3O1HA 4H9RC 2VKHA 2XAQB 3E22E 4QXBB 4P0BA 5FP3A 1LKXA 2MTQA 2Q9QB 2H7OA 2ZLYA 3HL6A 3S4UA 5LJNA 3OJAA 1UX5A 2LOPA 4M1PA 4F6RC 3PUAA 3KINB 5JREA 5FY7A 3MK7C 4PK5A 4ASKA 1Y64B 4MHCA 3AA0B 3ZC0A 4I55E 2YK0A 3LBXA 4IHJE 4FJOA 3CKDA 1G73A 2LM9A 3IF8B 2C5JA 2KINB 4C90A 4BA9A 3ZMVB 2XAGB 4DBQA 5FYMA 4UF0B 3Q5WA 2LSIA 2QA7A 3O1JA 4PJJA 2IC6A 3CQXC 5LCYA 4IE4A 3N5LA 1KNZA 4N78D 2LHNA 3LK42 2NW9A 1MIWA 4HTEA 4JUYA 4DMWA 4BJNA 4H9PC 5JRCA 3VKGA 3CQGB 5C8YE 3ZC1A 3UT5E 2KNDA 3KV5A 3ZCIA 5LG4A 5E0OA 1IJ5A 3MA9A 4HE8A 2NWBA 3KDSE 4JEHB 3EVYA 2NOXA 3R84B 2JMHA 4I43B 5J1GA 1SA0E 1VOMA 1YD8G 5LOVE 1BR0A 1S94A 3KV9A 2WM9A 5ETWA 3RYCE 4L9IA 4DO0A 2DHRA 3SOLA 2EHOD 4ZI3D 3ZJ2A 1B7TA 2CLYB 2YU1A 2EHOB 4HGAA 4HN9A 1D1BA 5JR9A 4H9NC 3AAEB 2EHOC 4ZI3C 4ERRA 3K8PC 4H63V 2CWYA 2IC9A 5JDLA 3ZPOA 3J9X1 3ZN0B 2L9QA 3CX6B 4NUUA 2K5BB 3P8CD 3DJBA 2KWHA 3PU8A 4ILUA 4L0RA 3I9YA 4B6XA 4MALA 3K3OA 4OHFA 3H37A 4MLKA 3JC6C 3V5SA 2XAFB 2Z6EA 2BVMA 5L2LA 4BAYB 3SS1A 2JRKA 3OYXA 3E0ZA 2N2NA 4FI5A 1U4QA 4Z8XA 2CE7A 3M65A 5IYZE 2Q9QA 2K24A 3L09A 3OYZA 1FIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3D A;  2MTQ A; 
#chains in the Genus database with same CATH topology
 4P1N A;  4GKJ T;  3AA1 B;  3PUW F;  3PU3 A;  5L3C B;  1YQ3 A;  4QXH B;  3ZEF B;  4DR2 T;  1HG5 A;  4TUY E;  1DU2 A;  4KI0 F;  3CPZ A;  5BMV E;  2K3W A;  4IIJ E;  2V26 A;  3NBX X;  2XQ8 A;  4HFI A;  2BVL A;  4IL4 A;  3RKG A;  5IUX A;  5J0Z A;  4AKG A;  2MYS A;  1KK7 A;  4UVC B;  1NEK A;  2EHO A;  5JR9 B;  4CI3 B;  5FKY A;  2HPL A;  1MND A;  3RH3 A;  3ZT5 A;  4HWI B;  3ABV A;  4ADZ A;  3KVB A;  2W61 A;  4TV8 E;  4EOZ B;  1HNW T;  3KV4 A;  1IJ6 A;  4F8H A;  2UU9 T;  5AQO B;  2XAJ B;  5J2T E;  4MFR A;  3RIU C;  3L8R A;  1W0B A;  2DWK A;  5LJM A;  1OED C;  4A98 A;  2NW8 A;  3DTO A;  5CGM A;  2IIU A;  4ANJ A;  2H3R A;  4ILC A;  2CHN A;  4NPP A;  4NUV A;  2IML A;  1EZ3 A;  2YIN A;  3RGL A;  3ETV A;  3H3A A;  2N1G A;  2KT9 A;  5CB4 E;  4ZI7 E;  3N9M A;  4AKL A;  4LFB T;  4WYV A;  2CEA A;  4QXC B;  3HKC E;  3PUQ A;  2WCA A;  3CX8 B;  3AE2 A;  4AQG A;  4CN4 A;  3Q2M A;  4G63 A;  1MMD A;  4HFD A;  5ABF A;  5JDF A;  4H9O C;  2WDV A;  2CHO A;  4ZOL E;  2VKO A;  5HXE A;  2BS4 A;  1KNR A;  5FMN A;  3ANW B;  4U7I A;  3LBX B;  1WFD A;  1H7C A;  2N9D A;  2XPK A;  4EAH A;  3RYI E;  2H88 A;  4DR3 T;  4U72 A;  4TX5 A;  1WCR A;  2BG9 A;  3UUM A;  1Z8U A;  4JI4 T;  2F4V T;  4DV3 T;  1KEY A;  1D1A A;  4GYS A;  1T98 A;  4KBM B;  1AJ3 A;  4CN6 A;  1E2A A;  2WU5 A;  4QKN A;  2QYW A;  3BK9 A;  4NIQ A;  5KDM C;  5KX5 E;  3B57 A;  3ZYL A;  5AQJ B;  2K9A A;  4CQI A;  1UUR A;  4HFC A;  2RP4 A;  3LJC A;  5F5W A;  3PUG A;  2GK9 A;  2HH7 A;  2V5C A;  2A72 A;  3P4W A;  3N2G E;  1E7P A;  5LMN T;  2LEH A;  3PJA A;  4JYA T;  3BQL A;  4AQF C;  2V7M A;  3P4P A;  4P0A A;  4DR6 T;  1D0Z A;  3HA4 A;  3U78 A;  4DID B;  4A56 A;  5AFU L;  5KMG P;  4HWF A;  2JPF A;  3ZCJ A;  5CJ5 A;  1OED A;  5LJN A;  3F57 A;  3ONJ A;  4EV6 A;  5CA0 E;  5DJQ C;  3FZH B;  5FY0 A;  3SFE A;  4GK5 E;  5H6Q B;  4CI2 B;  5L4E A;  2W00 A;  1XMQ T;  2LRK A;  4YTN A;  4DND A;  4TZ4 C;  3QK6 A;  4Z91 A;  4UIG A;  4UR9 A;  2X0Y A;  3VU7 H;  4IE0 A;  5JH7 E;  3NWI A;  1CUN A;  4PFP A;  5LBM A;  1NWM X;  2PFV A;  3JCF A;  4JV5 T;  1WYB A;  2ACZ A;  4TWH A;  1YKH B;  4PJM A;  4KX6 A;  3RC8 A;  4U31 A;  5H6R B;  1LVK A;  1MMG A;  1VCS A;  3JAF A;  2W66 A;  1D1C A;  3EHZ A;  4HFV A;  3W15 B;  1JNZ A;  3AED A;  4U2Y A;  5AQN B;  4LF8 T;  5FY1 A;  2VB6 A;  1UCU A;  2CWO A;  2JQQ A;  3SRZ A;  5JDH A;  3T1H T;  2BG9 C;  3AAA B;  5JVD E;  3AEE A;  3AE6 A;  2WQY A;  2MBG A;  4UV8 B;  3ZMZ B;  4O8S A;  4PW8 A;  2D2S A;  4WNK A;  3WI3 A;  2ODU A;  1WR0 A;  2XQ3 A;  3N9O A;  2BS3 A;  1BR2 A;  3O1I A;  5HXR A;  1KF6 A;  2M6I A;  2X9Y A;  3ONX A;  2D5U A;  2Y8D A;  3Q5E A;  5C2T A;  2DWG A;  2IUB A;  2XQ4 A;  3AVR A;  3NZP A;  4EYY R;  5HEU A;  1I94 T;  4CN1 A;  1I6Z A;  4DUZ T;  2XY8 B;  3RQU A;  2UXB T;  2XSA A;  2KSR A;  2LLY A;  3PJA J;  2MOZ A;  4IDZ A;  5AQM B;  3WAK A;  2VK9 A;  2LSK A;  3KV6 A;  4EZH A;  1QSD A;  3N2K E;  4J2C A;  3TLS A;  3ZT6 A;  3AE9 A;  4HWH A;  3H3M A;  4HFB A;  4JEU B;  3RRC A;  1IAP A;  3TKL B;  4EEB A;  2V8S V;  5LGT B;  2UUC T;  2YU2 A;  3AVS A;  2XQY A;  4IST A;  1CHU A;  4PK4 A;  1VRB A;  1U5P A;  1UX4 A;  2CXD A;  1MIY A;  2I59 A;  5AQQ B;  4COF A;  4ZHQ E;  2PBI A;  4KUM B;  1M7K A;  2VL8 A;  2X51 A;  3CX7 B;  2QGS A;  4AIS A;  5AQU B;  4E7Z A;  3FZL B;  3FZK B;  2CBI A;  4DV2 T;  1J5E T;  2UUA T;  4KHP T;  1ZHC A;  1WYC A;  4AIU A;  3E08 A;  1IBL T;  1LVF A;  3AE5 A;  3C64 A;  2V7I A;  4DBR A;  3KVA A;  4X1I E;  3NRX A;  4GOU A;  2XAH B;  2FJD A;  3RHW A;  3ZLI A;  1IBK T;  3HI2 A;  3K1S A;  2BZB A;  2LSG A;  5AQI B;  5L4H A;  1X79 A;  2LSJ A;  3OPC A;  4O2B E;  3ANW A;  2WWV A;  2QRX A;  4PJN A;  2LE8 A;  4EED A;  4WBN E;  1N34 T;  4UEM A;  2BG9 B;  3KBU A;  2FUP A;  4TN7 B;  3Q5D A;  3AA6 B;  3UU4 A;  4IE7 A;  2VVS A;  3C98 B;  4EYU A;  5LG3 A;  4O4H E;  4TNV A;  5DAB A;  5DQV A;  1L0V A;  5L47 A;  3VRB A;  3J7Y q;  2C0S A;  1OED E;  2J1D G;  4C91 A;  5FXV A;  2X9W A;  3UUN A;  1OED B;  1M62 A;  5LYJ E;  4L5G A;  3IEE A;  5CFB A;  5GON E;  1S35 A;  5JDG A;  3MZK B;  2WMN A;  4YHJ A;  2VKJ A;  5EK2 A;  3MKD A;  4DVD A;  3FZM B;  2R6G F;  1UK5 A;  2IAK A;  2DNX A;  2WAU A;  2CXL A;  2Y48 B;  3PE0 A;  2P9B A;  4HEA A;  4YJ2 E;  4YTM A;  4JI7 T;  2L8K A;  3N2O A;  2E9X D;  4O4I E;  3X1D A;  4GKK T;  3FBL A;  2LHR A;  3PUX F;  4QX8 B;  4MBQ A;  2YDS A;  4EB6 E;  4YTP A;  1FJG T;  1T7S A;  2X68 A;  3C4X A;  4ISS A;  4I4T E;  4TWD A;  3UFE A;  4V1A v;  1J5W A;  4JI5 T;  2DLR A;  5F8P A;  4YT0 A;  5JR9 C;  4JI2 T;  2WBL A;  2LT3 A;  1O3X A;  4DV0 T;  1VCT A;  4PFO A;  2WMO A;  4AKR B;  5ADX L;  2IHR 1;  3HKD E;  1MMN A;  4GK0 E;  2D0U A;  1G8X A;  4XZC A;  5L3E B;  5JDN A;  4DV1 T;  4YLH A;  3VKH A;  2W63 A;  2JJ9 A;  2W2U A;  2UXX B;  3I0O A;  2X9X A;  3MAC A;  3WAJ A;  2M6B A;  2HPJ A;  2PTF A;  2X0H A;  3A7M A;  3UUX B;  4AQY T;  2LJL A;  4LF7 T;  4IDN A;  1XNQ T;  2Q9Q C;  2JQH A;  4QX7 B;  5CA1 E;  4XAX B;  3EUH A;  1SHZ C;  1HNX T;  4Q25 A;  2E9X B;  3O9X A;  3P7I A;  3C50 A;  2W0G A;  4UV9 B;  2CA5 A;  3RF1 A;  4OK0 A;  3SWH A;  3LFM A;  2MPK A;  2V1D B;  3FZF B;  3AEB A;  5L3D B;  5KXJ A;  4ZS2 A;  3UUB A;  4YY3 T;  2L3L A;  3RC3 A;  5JTG A;  1OXZ A;  3C4Z A;  2BKO A;  3CQC B;  4O4J E;  2X0L B;  4ILB A;  4QH4 A;  5ABF B;  3OTO T;  4X1K E;  5ABG A;  3P4Q A;  2CXF A;  4IE5 A;  2ES0 A;  2C5I T;  4IGU A;  3TLV A;  2D0T A;  4A97 A;  2ZM6 T;  4DR1 T;  1W0A A;  3RRW A;  2LOS A;  1XMO T;  1YQ4 A;  1HX8 A;  4I50 E;  3ZMU B;  4DV7 T;  3AXJ B;  3N9N A;  3AAI A;  5EZY E;  1MNE A;  2DCF A;  3AA7 B;  4K0U A;  2A3D A;  2VKD A;  3IBP A;  4JLE A;  3SFD A;  5AQF B;  2VUR A;  1LRZ A;  1BR1 A;  1WR6 A;  5LGU B;  3CIR A;  4QWN B;  2SPC A;  3PUZ F;  3GA8 A;  2LM2 A;  1ZV4 X;  2WY2 A;  3ZST A;  3FBZ A;  3AE7 A;  4E7S A;  1WLX A;  1NEN A;  2V7L A;  5ABE A;  5LP6 E;  2DL1 A;  2ZMA A;  3KBT A;  4DV5 T;  1HS7 A;  3IHR A;  2XHE B;  3UU8 A;  3N9P A;  2XQ7 A;  3K3Q C;  1MIV A;  1ZKE A;  3NVO A;  3U3I A;  2RPA A;  3RIU A;  1NAF A;  2YOE A;  1OWA A;  4KHZ F;  5EK3 A;  4O2A E;  3RYF E;  4DMV A;  2DI4 A;  3JAE A;  3V5U A;  1XWM A;  2VQE T;  2ZM8 A;  2JIW A;  2CM0 A;  3A8Y C;  1WRD A;  3EDU A;  3OBV E;  5LA6 E;  1Z0P A;  2KWI B;  2E9X C;  2BKN A;  3PUS A;  5AQS B;  4DR4 T;  3QC9 A;  1ZP0 A;  4KP3 C;  2XQA A;  4CXY A;  4JI8 T;  3GMI A;  5L3F B;  3P50 A;  5L3G B;  4CZZ B;  5ABH A;  4QH5 A;  3O4X E;  3BQK A;  3FHN A;  2E5V A;  3NKZ A;  4OX9 T;  2WWU A;  4H63 H;  3EI0 A;  5HYA A;  2KLQ A;  4HFH A;  2BDE A;  3NRY A;  4HWC A;  1J1J A;  5M4Y A;  4JI0 T;  3A5X A;  1HG2 A;  3Q9D A;  2V6Y A;  2PG8 A;  2XTL A;  2V7K A;  4P09 A;  2CMR A;  2IDO B;  5AQL B;  5HAX A;  3I9W A;  2NP9 A;  4IL9 A;  3RX6 A;  2JMK A;  1XDO A;  3ZMS B;  2NW7 A;  2Q9Q D;  2ZM0 A;  1FEW A;  3KFW X;  3AEF A;  3PUR A;  4EZ4 A;  5LGN B;  3P4R A;  5HXH A;  2E9X A;  2W62 A;  2VVN A;  2OA5 A;  3ZJ1 A;  2ACX A;  2XUE A;  3CVR A;  3LG7 A;  5FXZ A;  3RQW A;  4JI3 T;  5HCJ A;  5L3B B;  3L09 A;  5JRC B;  1HTJ F;  3PUY F;  1R8I A;  2AE9 A;  1SUM B;  2B1E A;  2D9D A;  3C51 A;  3HKE E;  2X67 A;  3JAD A;  3MXZ A;  3NZQ A;  3PTR B;  4YFS A;  1W9R A;  3JC6 D;  2J4G A;  1US7 B;  4UVA B;  4OYJ A;  3B5M A;  5FXW A;  5IWA T;  4X5T A;  4H9S E;  1HCI A;  1YKE B;  3ESL A;  3GN5 B;  5JQG E;  5AQR B;  3UUL A;  3BQI A;  2BS2 A;  2A9U A;  1XZY A;  3QB5 K;  4U74 A;  4UVB B;  3AXJ A;  4WBO A;  1MMA A;  2AXD S;  5FXX A;  2NTX A;  2BBH A;  5LNK A;  3UTK A;  2Y6X A;  4TV9 E;  2J62 A;  4PK6 A;  2H7V C;  3RKO A;  2NR4 A;  2BG9 E;  2VWA A;  5LXT E;  2JQ9 A;  2K48 A;  2WZH A;  2I0M A;  1FMV A;  1W09 A;  2XQ5 A;  5LHI B;  3PV0 F;  4HKA A;  4QHO A;  2VL0 A;  3MJX A;  2YDQ A;  4BJM A;  4WW0 A;  4IDO A;  1SE7 A;  4OFZ A;  4OYK A;  4O4L E;  3Q5X A;  1E1H B;  2X66 A;  4ZS3 A;  1YW0 A;  3PDY A;  4G2A A;  1IZN B;  3QUJ A;  3RYH E;  4YSZ A;  4X64 T;  3HKB E;  4GYR A;  3AEA A;  4I0U A;  3CWZ B;  2ZM2 A;  4JI1 T;  5TAO A;  4TWF A;  1QLB A;  2KZ7 B;  2FJB A;  2ODV A;  3AB3 B;  3F2E A;  5HWY A;  3LK2 B;  5JDM A;  2VAS A;  3RIA A;  5LHH B;  2C5K T;  3ZYM A;  3N9Q A;  1V9D A;  4X20 E;  3ZN1 B;  5EK4 A;  3UU3 A;  3ONL C;  3TLT A;  4X1Y E;  1D0Y A;  2CCQ A;  5FVK A;  4U2Z A;  2XAS B;  2V7J A;  4UXN B;  4AQF A;  5HWX A;  4CXX A;  3I1A A;  2RA1 A;  3QOF A;  3AE8 A;  2HN2 A;  3L39 A;  4PAG A;  2WSS V;  3ZYK A;  5HXS A;  4GIW A;  3C4W A;  3UU6 A;  2OV9 A;  4X65 T;  3OKQ A;  4A5X A;  2E8I A;  3RIF A;  4ZI2 C;  1QUU A;  3LSV A;  2J47 A;  2XJ7 A;  5HXC A;  3ZKR A;  4LMK A;  4LFC T;  4ZZB A;  4IE6 A;  2IW5 B;  2LRL A;  5LHG B;  5FNV E;  3QNU A;  4PJL A;  4AXP A;  2XSB A;  4HFE A;  4ZI2 D;  4NXM T;  4WZX A;  1XNR T;  3EAM A;  3GWH A;  4AKH A;  3HR0 A;  3I0Q A;  1HFA A;  1KNP A;  3EAB A;  2JQK A;  1HX1 B;  2XQ6 A;  3GN5 A;  4ZXL A;  3CML A;  4UEL A;  4YSX A;  2UXC T;  3D0T A;  4H9Q C;  2YKS A;  5IHY A;  3T8O A;  5DQW A;  4EIW A;  1D0X A;  3B13 A;  4UF0 A;  2KXP B;  5AQP B;  5A1L A;  5HEG A;  2M67 A;  4PNI A;  4YJ3 E;  2YEV C;  3AE1 A;  4TNW A;  4ZEY A;  4LFA T;  3AEG A;  3R6N A;  5LBQ B;  5J2U E;  3DP7 A;  5AQK B;  4LF6 T;  2BBJ A;  1N33 T;  2BKP A;  2LSY A;  4Z90 A;  4DV4 T;  3F31 A;  5F3J A;  5HCM A;  3L3P A;  3LK3 B;  4CI1 B;  3ETU A;  2CPT A;  1FMW A;  2CLY C;  4X66 T;  2WB5 A;  4KMC A;  2HHH T;  2CBJ A;  1KFY A;  2V6Y B;  1ZEE A;  2OLT A;  2V5D A;  1JNR A;  2PJQ A;  3ZSS A;  3EDV A;  5FVL A;  4YXD A;  3VHL A;  1BR4 A;  3LDQ B;  4LF4 T;  2A2F X;  3FXE B;  4EXT A;  2UXN B;  2X9H A;  3FXD B;  4AI6 A;  1HF8 A;  2G0U A;  2XZE A;  3N9L A;  3RPU A;  4B3S T;  2NTY A;  2LKH A;  4CXW A;  4AKI A;  2KMF A;  3FB2 A;  3K3N A;  3O1H A;  4H9R C;  2VKH A;  2XAQ B;  3E22 E;  1UGO A;  4QXB B;  4P0B A;  5AQV B;  1LKX A;  2MTQ A;  2Q9Q B;  2H7O A;  2ZLY A;  1T72 A;  3HL6 A;  3S4U A;  3OJA A;  4HWD A;  1UX5 A;  2LOP A;  4M1P A;  4F6R C;  3PUA A;  4NXN T;  4B3M T;  3KIN B;  5JRE A;  5FY7 A;  3VR9 A;  3IA3 A;  4U7Y A;  3MK7 C;  4PK5 A;  2YDR A;  2W4X A;  3AE4 A;  1Y64 B;  4MHC A;  3AA0 B;  5AQG B;  4ASK A;  2E5L T;  4I55 E;  2YK0 A;  3LBX A;  3ZC0 A;  4IHJ E;  4FJO A;  3CKD A;  1G73 A;  2LM9 A;  1HNZ T;  4B3T T;  4IRE A;  4ZZC A;  2XQ9 A;  2C5J A;  3IF8 B;  4XBF B;  4JBW F;  2KIN B;  4C90 A;  1Y01 A;  3ZMV B;  2XAG B;  4BA9 A;  2XM1 A;  4DBQ A;  5FYM A;  1HR0 T;  4UF0 B;  2LKG A;  3Q5W A;  2FJA A;  2LSI A;  2QA7 A;  3O1J A;  2IC6 A;  3CQX C;  4PJJ A;  1XDP A;  2WU2 A;  5C3J A;  5LCY A;  4IE4 A;  1T8B A;  3N5L A;  5LMU T;  1KNZ A;  4N78 D;  5HEO A;  3VRA A;  4DR5 T;  2LHN A;  2XM2 A;  2VQF T;  3LK4 2;  2NW9 A;  2YN6 A;  1MIW A;  1ZOY A;  2QVA A;  4HTE A;  4JUY A;  4BJN A;  4H9P C;  4DMW A;  4DUY T;  3RLF F;  5JRC A;  3VKG A;  3CQG B;  5C8Y E;  5JDQ A;  3ZC1 A;  3UT5 E;  2KND A;  3KV5 A;  3ZCI A;  1GQE A;  5LG4 A;  3AE3 A;  1IJ5 A;  3MA9 A;  4HE8 A;  2NWB A;  3KDS E;  4QH1 A;  5E0O A;  3UQ4 A;  3VR8 A;  3PUV F;  3G06 A;  4JEH B;  1X9B A;  3EVY A;  4DV6 T;  2NOX A;  4LF5 T;  3R84 B;  3T1Y T;  4LML A;  2JMH A;  4I43 B;  5J1G A;  3RI5 A;  3ZT7 A;  1SA0 E;  2FBW A;  1VOM A;  1YD8 G;  5LOV E;  3ZMT B;  3OVU A;  5FP3 A;  1BR0 A;  5HEH A;  1S94 A;  3KV9 A;  4ILA A;  2WM9 A;  3P4S A;  3AEC A;  5ETW A;  3RYC E;  5BR8 T;  4L9I A;  4DO0 A;  5FL0 A;  2DHR A;  5AQT B;  5LB7 B;  3SOL A;  2EHO D;  2H89 A;  2I6H A;  4IDQ A;  4ZI3 D;  3ZJ2 A;  1B7T A;  2CLY B;  2YU1 A;  2EHO B;  3QB5 A;  4HGA A;  1D1B A;  4HN9 A;  5JR9 A;  2B76 A;  4H9N C;  3AAE B;  2EHO C;  4ZI3 C;  4ERR A;  1UUS A;  3K8P C;  2CWY A;  2IC9 A;  4H63 V;  2WDR A;  4LMJ A;  4DR7 T;  2W67 A;  1N32 T;  4IT4 A;  4EGW A;  2WP9 A;  3TLW A;  3J9X 1;  3ZN0 B;  2FJE A;  2L9Q A;  3ZPO A;  5JDL A;  3CX6 B;  4NUU A;  2UUB T;  2K5B B;  3CK6 A;  3P8C D;  3DJB A;  3UFG A;  4U33 A;  2KWH A;  2WZI A;  3UQ7 A;  3PU8 A;  4ILU A;  4YHH T;  4L0R A;  2WDQ A;  4K0K T;  3I9Y A;  4B6X A;  4MAL A;  2WS3 A;  4B3R T;  4U3C A;  2UXD T;  3K3O A;  4OHF A;  2E2A A;  3H37 A;  4MLK A;  3JC6 C;  3V5S A;  2XAF B;  4JI6 T;  2Z6E A;  2BVM A;  5L2L A;  4BAY B;  3SS1 A;  3UU5 A;  4X62 T;  1N36 T;  4YSY A;  2JRK A;  3OYX A;  3E0Z A;  2N2N A;  4FI5 A;  1U4Q A;  2MAW A;  4Z8X A;  5AQH B;  3M3Z B;  1YXR A;  2CRB A;  5HEJ A;  3TLU A;  1IBM T;  2CE7 A;  4LF9 T;  3M65 A;  5IYZ E;  5FL1 A;  4IDP A;  2Q9Q A;  2V6X A;  2K24 A;  2HN1 A;  3OYZ A;  1FIO A; 
#chains in the Genus database with same CATH homology
 3AA1 B;  3PU3 A;  5L3C B;  4QXH B;  3ZEF B;  1HG5 A;  4TUY E;  3CPZ A;  5BMV E;  4IIJ E;  2V26 A;  3NBX X;  2BVL A;  4AKG A;  2MYS A;  1KK7 A;  4UVC B;  2EHO A;  5JR9 B;  4CI3 B;  2HPL A;  1MND A;  3RH3 A;  4ADZ A;  3KVB A;  2W61 A;  4TV8 E;  4EOZ B;  3KV4 A;  1IJ6 A;  2XAJ B;  5J2T E;  4MFR A;  2DWK A;  5LJM A;  2NW8 A;  3DTO A;  4ANJ A;  2H3R A;  4NUV A;  1EZ3 A;  2YIN A;  3ETV A;  3H3A A;  2N1G A;  2KT9 A;  5CB4 E;  4ZI7 E;  3N9M A;  4AKL A;  2CEA A;  4QXC B;  3HKC E;  3PUQ A;  3CX8 B;  4AQG A;  3Q2M A;  4G63 A;  1MMD A;  5JDF A;  4H9O C;  4ZOL E;  2VKO A;  5HXE A;  5FMN A;  3ANW B;  3LBX B;  1H7C A;  2N9D A;  4EAH A;  3RYI E;  4U72 A;  4TX5 A;  3UUM A;  1D1A A;  4GYS A;  1T98 A;  4KBM B;  1AJ3 A;  4QKN A;  3BK9 A;  5KDM C;  5KX5 E;  3B57 A;  3ZYL A;  2K9A A;  4CQI A;  2RP4 A;  3LJC A;  3PUG A;  2GK9 A;  2HH7 A;  2A72 A;  3N2G E;  2LEH A;  3BQL A;  4AQF C;  2V7M A;  4P0A A;  1D0Z A;  3HA4 A;  3U78 A;  4A56 A;  5AFU L;  5KMG P;  2JPF A;  3ZCJ A;  3F57 A;  5CA0 E;  5DJQ C;  5FY0 A;  4GK5 E;  5H6Q B;  4CI2 B;  2W00 A;  4DND A;  4TZ4 C;  3QK6 A;  4UIG A;  3VU7 H;  4IE0 A;  5JH7 E;  1CUN A;  4PFP A;  5LBM A;  1NWM X;  2PFV A;  1WYB A;  1YKH B;  4PJM A;  3RC8 A;  5H6R B;  1LVK A;  1MMG A;  1D1C A;  4HFV A;  3W15 B;  5FY1 A;  2VB6 A;  1UCU A;  2CWO A;  2JQQ A;  3SRZ A;  5JDH A;  3AAA B;  5JVD E;  2MBG A;  5JDQ A;  4UV8 B;  3ZMZ B;  4O8S A;  4PW8 A;  2D2S A;  4WNK A;  3WI3 A;  2ODU A;  3N9O A;  3O1I A;  1BR2 A;  5HXR A;  2X9Y A;  3ONX A;  2D5U A;  2Y8D A;  2DWG A;  3AVR A;  3NZP A;  4EYY R;  3WAK A;  2MOZ A;  4IDZ A;  2VK9 A;  2LSK A;  3KV6 A;  4EZH A;  1QSD A;  3N2K E;  4J2C A;  3RRC A;  4JEU B;  3TKL B;  1IAP A;  5LGT B;  2YU2 A;  3AVS A;  2XQY A;  4IST A;  4PK4 A;  1VRB A;  1U5P A;  1UX4 A;  2CXD A;  1MIY A;  2I59 A;  4ZHQ E;  2PBI A;  4KUM B;  2VL8 A;  2X51 A;  3CX7 B;  2QGS A;  4E7Z A;  1ZHC A;  1WYC A;  3E08 A;  1LVF A;  3C64 A;  2V7I A;  5LXT E;  3KVA A;  4X1I E;  3NRX A;  4GOU A;  2XAH B;  3ZLI A;  3HI2 A;  2BZB A;  2LSG A;  1X79 A;  2LSJ A;  4O2B E;  3ANW A;  4PJN A;  2LE8 A;  4WBN E;  4UEM A;  3KBU A;  4TN7 B;  3AA6 B;  4EYU A;  4IE7 A;  3C98 B;  4O4H E;  5DAB A;  5DQV A;  3J7Y q;  2C0S A;  4C91 A;  2J1D G;  5FXV A;  2X9W A;  3UUN A;  5LYJ E;  4L5G A;  3IEE A;  5GON E;  1S35 A;  5JDG A;  3MZK B;  2WMN A;  4YHJ A;  2VKJ A;  5EK2 A;  3MKD A;  4DVD A;  2IAK A;  2DNX A;  2WAU A;  2CXL A;  2Y48 B;  3PE0 A;  2P9B A;  4HEA A;  4YJ2 E;  4XBF B;  2L8K A;  3N2O A;  2E9X D;  4O4I E;  3FBL A;  2LHR A;  4QX8 B;  4EB6 E;  4MBQ A;  2X68 A;  3C4X A;  4ISS A;  4I4T E;  3UFE A;  4V1A v;  2DLR A;  5F8P A;  5JR9 C;  2WBL A;  2LT3 A;  1O3X A;  4PFO A;  2WMO A;  4AKR B;  3HKD E;  1MMN A;  4GK0 E;  2D0U A;  1G8X A;  4XZC A;  5L3E B;  5JDN A;  3VKH A;  4YLH A;  2W63 A;  2JJ9 A;  2UXX B;  3I0O A;  2X9X A;  3MAC A;  3WAJ A;  2HPJ A;  3UUX B;  2LJL A;  2Q9Q C;  4QX7 B;  5CA1 E;  4XAX B;  3EUH A;  1SHZ C;  2E9X B;  3O9X A;  3P7I A;  3C50 A;  2W0G A;  4UV9 B;  2CA5 A;  4OK0 A;  3SWH A;  3LFM A;  2V1D B;  5L3D B;  4ZS2 A;  2L3L A;  3RC3 A;  1OXZ A;  3C4Z A;  3CQC B;  4O4J E;  2X0L B;  4X1K E;  2CXF A;  4IE5 A;  2ES0 A;  2C5I T;  4IGU A;  2D0T A;  3RRW A;  2LOS A;  1HX8 A;  4I50 E;  3ZMU B;  3N9N A;  3AAI A;  5EZY E;  1MNE A;  2DCF A;  3AA7 B;  4K0U A;  2A3D A;  2VKD A;  3IBP A;  4JLE A;  1LRZ A;  1BR1 A;  1WR6 A;  5LGU B;  4QWN B;  2SPC A;  3GA8 A;  1ZV4 X;  3FBZ A;  4E7S A;  1WLX A;  2V7L A;  5LP6 E;  2ZMA A;  3KBT A;  1HS7 A;  3IHR A;  2XHE B;  3N9P A;  3K3Q C;  1MIV A;  1ZKE A;  3U3I A;  1NAF A;  1OWA A;  5EK3 A;  4DMV A;  4O2A E;  3RYF E;  2DI4 A;  3V5U A;  2ZM8 A;  2CM0 A;  1WRD A;  3EDU A;  3OBV E;  5LA6 E;  1Z0P A;  2KWI B;  2E9X C;  3PUS A;  3QC9 A;  4KP3 C;  4CXY A;  3GMI A;  5L3F B;  5L3G B;  4CZZ B;  3O4X E;  3BQK A;  3FHN A;  2WWU A;  4H63 H;  5HYA A;  2KLQ A;  2BDE A;  3NRY A;  5M4Y A;  3A5X A;  1HG2 A;  3Q9D A;  2PG8 A;  2XTL A;  2V7K A;  4P09 A;  2CMR A;  5HAX A;  3ZMS B;  5ADX L;  3I9W A;  2NP9 A;  3RX6 A;  2JMK A;  2NW7 A;  2Q9Q D;  2ZM0 A;  1FEW A;  3KFW X;  3PUR A;  5LGN B;  4EZ4 A;  5HXH A;  2E9X A;  2W62 A;  2OA5 A;  3ZJ1 A;  2ACX A;  2XUE A;  3CVR A;  3LG7 A;  5FXZ A;  5JRC B;  5L3B B;  1HTJ F;  3ZMT B;  3C51 A;  3HKE E;  3MXZ A;  2B1E A;  3PTR B;  4AQF A;  2X67 A;  3NZQ A;  4YFS A;  3JC6 D;  4UVA B;  1US7 B;  4OYJ A;  5FXW A;  4H9S E;  1HCI A;  1YKE B;  3ESL A;  3GN5 B;  5JQG E;  3UUL A;  3BQI A;  4U74 A;  4UVB B;  4WBO A;  1MMA A;  5FXX A;  2NTX A;  5LNK A;  3UTK A;  2Y6X A;  4TV9 E;  4PK6 A;  2H7V C;  3RKO A;  2VWA A;  2K48 A;  5LHI B;  1FMV A;  4QHO A;  4HKA A;  3MJX A;  4BJM A;  4WW0 A;  4OFZ A;  4OYK A;  4O4L E;  3Q5X A;  1E1H B;  2X66 A;  4ZS3 A;  1YW0 A;  3PDY A;  4G2A A;  1IZN B;  3QUJ A;  3RYH E;  3HKB E;  4GYR A;  3CWZ B;  2ZM2 A;  5TAO A;  2KZ7 B;  2ODV A;  3AB3 B;  3F2E A;  5HWY A;  3LK2 B;  5JDM A;  2VAS A;  5LHH B;  2C5K T;  3ZYM A;  3N9Q A;  1V9D A;  4X20 E;  3ZN1 B;  5EK4 A;  4DBR A;  4X1Y E;  1D0Y A;  2CCQ A;  4UXN B;  2XAS B;  2V7J A;  5HWX A;  4CXX A;  3I1A A;  2RA1 A;  4PAG A;  2WSS V;  3ZYK A;  5HXS A;  4GIW A;  3C4W A;  3OKQ A;  2E8I A;  4ZI2 C;  1QUU A;  5HXC A;  4IE6 A;  2IW5 B;  5LHG B;  5FNV E;  4PJL A;  4AXP A;  4ZI2 D;  4AKH A;  3GWH A;  3HR0 A;  3I0Q A;  1HFA A;  3GN5 A;  3CML A;  4UEL A;  3D0T A;  4H9Q C;  5IHY A;  3T8O A;  5DQW A;  4EIW A;  1D0X A;  3B13 A;  4UF0 A;  2KXP B;  5A1L A;  2M67 A;  4PNI A;  4YJ3 E;  2YEV C;  3R6N A;  5LBQ B;  5J2U E;  3DP7 A;  2LSY A;  3F31 A;  5F3J A;  3L3P A;  3LK3 B;  4CI1 B;  3ETU A;  1FMW A;  2CLY C;  4KMC A;  1ZEE A;  2PJQ A;  3EDV A;  3VHL A;  1BR4 A;  2A2F X;  3FXE B;  4EXT A;  2UXN B;  2X9H A;  3FXD B;  4AI6 A;  1HF8 A;  2G0U A;  3N9L A;  3RPU A;  2NTY A;  4CXW A;  4AKI A;  2KMF A;  3FB2 A;  3K3N A;  3O1H A;  4H9R C;  2VKH A;  2XAQ B;  3E22 E;  4QXB B;  4P0B A;  5FP3 A;  1LKX A;  2MTQ A;  2Q9Q B;  2H7O A;  2ZLY A;  3HL6 A;  3S4U A;  5LJN A;  3OJA A;  1UX5 A;  2LOP A;  4M1P A;  4F6R C;  3PUA A;  3KIN B;  5JRE A;  5FY7 A;  3MK7 C;  4PK5 A;  4ASK A;  1Y64 B;  4MHC A;  3AA0 B;  3ZC0 A;  4I55 E;  2YK0 A;  3LBX A;  4IHJ E;  4FJO A;  3CKD A;  1G73 A;  2LM9 A;  3IF8 B;  2C5J A;  2KIN B;  4C90 A;  4BA9 A;  3ZMV B;  2XAG B;  4DBQ A;  5FYM A;  4UF0 B;  3Q5W A;  2LSI A;  2QA7 A;  3O1J A;  4PJJ A;  2IC6 A;  3CQX C;  5LCY A;  4IE4 A;  3N5L A;  1KNZ A;  4N78 D;  2LHN A;  3LK4 2;  2NW9 A;  1MIW A;  4HTE A;  4JUY A;  4DMW A;  4BJN A;  4H9P C;  5JRC A;  3VKG A;  3CQG B;  5C8Y E;  3ZC1 A;  3UT5 E;  2KND A;  3KV5 A;  3ZCI A;  5LG4 A;  5E0O A;  1IJ5 A;  3MA9 A;  4HE8 A;  2NWB A;  3KDS E;  4JEH B;  3EVY A;  2NOX A;  3R84 B;  2JMH A;  4I43 B;  5J1G A;  1SA0 E;  1VOM A;  1YD8 G;  5LOV E;  1BR0 A;  1S94 A;  3KV9 A;  2WM9 A;  5ETW A;  3RYC E;  4L9I A;  4DO0 A;  2DHR A;  3SOL A;  2EHO D;  4ZI3 D;  3ZJ2 A;  1B7T A;  2CLY B;  2YU1 A;  2EHO B;  4HGA A;  4HN9 A;  1D1B A;  5JR9 A;  4H9N C;  3AAE B;  2EHO C;  4ZI3 C;  4ERR A;  3K8P C;  4H63 V;  2CWY A;  2IC9 A;  5JDL A;  3ZPO A;  3J9X 1;  3ZN0 B;  2L9Q A;  3CX6 B;  4NUU A;  2K5B B;  3P8C D;  3DJB A;  2KWH A;  3PU8 A;  4ILU A;  4L0R A;  3I9Y A;  4B6X A;  4MAL A;  3K3O A;  4OHF A;  3H37 A;  4MLK A;  3JC6 C;  3V5S A;  2XAF B;  2Z6E A;  2BVM A;  5L2L A;  4BAY B;  3SS1 A;  2JRK A;  3OYX A;  3E0Z A;  2N2N A;  4FI5 A;  1U4Q A;  4Z8X A;  2CE7 A;  3M65 A;  5IYZ E;  2Q9Q A;  2K24 A;  3L09 A;  3OYZ A;  1FIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...