The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
42
|
structure length |
42
|
Chain Sequence |
GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Toxin
|
| molecule keywords |
Toxin APETx2
|
| publication title |
Understanding the Molecular Basis of Toxin Promiscuity: The Analgesic Sea Anemone Peptide APETx2 Interacts with Acid-Sensing Ion Channel 3 and hERG Channels via Overlapping Pharmacophores.
pubmed doi rcsb |
| total genus |
2
|
| structure length |
42
|
| sequence length |
42
|
| ec nomenclature | |
| pdb deposition date | 2014-09-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07936 | Defensin_4 | Potassium-channel blocking toxin |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Anthopleurin-A | Anthopleurin-A |
#chains in the Genus database with same CATH superfamily 1Z99 A; 2SH1 A; 1ZUF A; 1BDS A; 1WQK A; 1WXN A; 3LMS B; 2MUB A; 1APF A; 1ATX A; 4GV5 A; 1ZUE A; 1AHL A; 2H9X A; 1B8W A; 2RNG A; 2K2X A; 3D4U B; 1ZLH B; 1H5O A; 2MN3 A; 1SH1 A; 1SHI A; 2JTO A; 2BDS A; 1ZLI B; 1D6B A; #chains in the Genus database with same CATH topology 1Z99 A; 1ZHH B; 2SH1 A; 1ZUF A; 1BDS A; 1WQK A; 2QSG A; 1WXN A; 2QSH A; 2HJ9 C; 1GL9 B; 3LMS B; 2MUB A; 1APF A; 2XXL A; 1ATX A; 2IKE A; 1EL6 A; 1GKU B; 4GV5 A; 3KEZ A; 1ZUE A; 3C30 A; 1AHL A; 2H9X A; 3IF4 A; 2RNG A; 1B8W A; 2JR3 A; 4YIR A; 2HJE A; 2DLA A; 2K2X A; 1ZLH B; 3D4U B; 2QSF A; 2MN3 A; 2B9K A; 3MCX A; 1H5O A; 3MYV A; 3C38 A; 1SH1 A; 1SHI A; 2JTO A; 2BDS A; 1ZLI B; 2IKD A; 1D6B A; #chains in the Genus database with same CATH homology 1Z99 A; 1ZHH B; 2SH1 A; 1ZUF A; 1BDS A; 1WQK A; 2QSG A; 1WXN A; 2QSH A; 2HJ9 C; 3LMS B; 2MUB A; 1APF A; 2XXL A; 1ATX A; 2IKE A; 4GV5 A; 3KEZ A; 1ZUE A; 3C30 A; 1AHL A; 2H9X A; 1B8W A; 2RNG A; 2JR3 A; 4YIR A; 2HJE A; 2DLA A; 2K2X A; 1ZLH B; 3D4U B; 2QSF A; 2MN3 A; 2B9K A; 3MCX A; 1H5O A; 3MYV A; 3C38 A; 1SH1 A; 1SHI A; 2JTO A; 2BDS A; 1ZLI B; 2IKD A; 1D6B A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
