2MUNA

Solution structure of mu-slptx3-ssm6a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
ADNKCENSLRREIACGQCRDKVKTDGYFYECCTSDSTFKKCQDLLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mu-scoloptoxin-Ssm6a
publication title Weaponization of a Hormone: Convergent Recruitment of Hyperglycemic Hormone into the Venom of Arthropod Predators.
pubmed doi rcsb
source organism Scolopendra mutilans
molecule tags Toxin
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2014-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.50 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Diphtheria Toxin Repressor; domain 2 2munA00
2MZ4A 2M35A 2MVTA 2MUNA
chains in the Genus database with same CATH superfamily
3J7AW 3R60A 2DTRA 2QQAA 1BI0A 2H09A 2HYFA 3J80R 1P92A 1FWZA 1BI1A 3A52A 1DPRA 1G3WA 3GLXA 1RQ6A 2F5EA 4HV5A 4HV6A 2M35A 1C0WA 1ON1A 2QQBA 2ISZA 3R61A 1G3SA 4HX7A 2MZ4A 2F5DA 4HX8A 1G3YA 2EV6A 5IT9R 4HX4A 2F5CA 2X98A 1U8RA 2F5FA 1DDNA 2EV0A 2P0TA 1BI3A 1B1BA 3JAMR 1F5TA 1FX7A 1XCVA 1BI2A 4O5VA 1ON2A 2MUNA 5A2QR 2TDXA 2MVTA 2HYGD 2QQ9A 5FLXR 3J81R 4O6JA 1G3TA 2EV5A
chains in the Genus database with same CATH topology
2M35A 2X98A 2MUNA 2MZ4A 3A52A 2MVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MZ4 A;  2M35 A;  2MVT A;  2MUN A; 
#chains in the Genus database with same CATH topology
 3J7A W;  3R60 A;  2DTR A;  2QQA A;  1BI0 A;  2H09 A;  2HYF A;  3J80 R;  1P92 A;  1FWZ A;  1BI1 A;  3A52 A;  1DPR A;  1G3W A;  3GLX A;  1RQ6 A;  2F5E A;  4HV5 A;  4HV6 A;  2M35 A;  1C0W A;  1ON1 A;  2QQB A;  2ISZ A;  3R61 A;  1G3S A;  4HX7 A;  2MZ4 A;  2F5D A;  4HX8 A;  1G3Y A;  2EV6 A;  5IT9 R;  4HX4 A;  2F5C A;  2X98 A;  1U8R A;  2F5F A;  1DDN A;  2EV0 A;  2P0T A;  1BI3 A;  1B1B A;  3JAM R;  1F5T A;  1FX7 A;  1XCV A;  1BI2 A;  4O5V A;  1ON2 A;  2MUN A;  5A2Q R;  2TDX A;  2MVT A;  2HYG D;  2QQ9 A;  5FLX R;  3J81 R;  4O6J A;  1G3T A;  2EV5 A; 
#chains in the Genus database with same CATH homology
 2M35 A;  2X98 A;  2MUN A;  2MZ4 A;  3A52 A;  2MVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...