2MVTA

Solution structure of scoloptoxin ssd609 from scolopendra mutilans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
47
structure length
47
Chain Sequence
ADDKCEDSLRREIACTKCRDRVRTDDYFYECCTSESTFKKCQTMLHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Scoloptoxin SSD609
publication title A distinct three-helix centipede toxin SSD609 inhibits Iks channels by interacting with the KCNE1 auxiliary subunit.
pubmed doi rcsb
source organism Scolopendra mutilans
molecule tags Toxin
total genus 7
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2014-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.50 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Diphtheria Toxin Repressor; domain 2 2mvtA00
2MVTA 2MZ4A 2M35A 2MUNA
chains in the Genus database with same CATH superfamily
1F5TA 2F5FA 2H09A 2F5EA 2P0TA 4HV5A 3J7AW 3J81R 2ISZA 2QQAA 5A2QR 2F5CA 2MUNA 1B1BA 1G3SA 3J80R 1DDNA 1FX7A 2QQBA 4O5VA 2MVTA 2DTRA 2EV5A 2M35A 1XCVA 3GLXA 1ON1A 1DPRA 2F5DA 2QQ9A 3JAMR 5IT9R 2EV6A 1C0WA 4HV6A 2HYFA 3A52A 1BI1A 5FLXR 1G3TA 3R61A 2EV0A 4HX7A 1RQ6A 4HX4A 4O6JA 2X98A 1U8RA 1BI2A 2HYGD 3R60A 1ON2A 1P92A 2MZ4A 1G3YA 1G3WA 4HX8A 1BI0A 1FWZA 2TDXA 1BI3A
chains in the Genus database with same CATH topology
2X98A 3A52A 2MVTA 2MZ4A 2M35A 2MUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVT A;  2MZ4 A;  2M35 A;  2MUN A; 
#chains in the Genus database with same CATH topology
 1F5T A;  2F5F A;  2H09 A;  2F5E A;  2P0T A;  4HV5 A;  3J7A W;  3J81 R;  2ISZ A;  2QQA A;  5A2Q R;  2F5C A;  2MUN A;  1B1B A;  1G3S A;  3J80 R;  1DDN A;  1FX7 A;  2QQB A;  4O5V A;  2MVT A;  2DTR A;  2EV5 A;  2M35 A;  1XCV A;  3GLX A;  1ON1 A;  1DPR A;  2F5D A;  2QQ9 A;  3JAM R;  5IT9 R;  2EV6 A;  1C0W A;  4HV6 A;  2HYF A;  3A52 A;  1BI1 A;  5FLX R;  1G3T A;  3R61 A;  2EV0 A;  4HX7 A;  1RQ6 A;  4HX4 A;  4O6J A;  2X98 A;  1U8R A;  1BI2 A;  2HYG D;  3R60 A;  1ON2 A;  1P92 A;  2MZ4 A;  1G3Y A;  1G3W A;  4HX8 A;  1BI0 A;  1FWZ A;  2TDX A;  1BI3 A; 
#chains in the Genus database with same CATH homology
 2X98 A;  3A52 A;  2MVT A;  2MZ4 A;  2M35 A;  2MUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...