2MW5A

Backbone fold of human small ubiquitin like modifier protein-1 (sumo-1) based on prot3d-nmr approach.
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Prot3DNMR: A simple and swift NMR strategy for Three-Dimentional structutral determination of proteins.
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mw5A00
2L76A 4IM2A 3K9PB 4G11A 1LQBA 2J0JA 3AI5A 1OEYA 3KH0A 1E8WA 3H7PA 1WGYA 3SU8X 4FJYA 2ASQA 2EMSA 1UH6A 2KK8A 1WF9A 3DQVA 1IP9A 2N7EA 3AU4A 2A4ZA 2Z59B 2JRIB 1G6JA 1WJ6A 2FCNA 4W9KA 2IO2B 2KKCA 4YL8A 4AP4C 3V6CB 2M17A 3RYTA 4FADA 1SIFA 1E8YA 1WGRA 2FCQA 3ZNID 2DZJA 2C9WB 3MHSD 4EOYA 4URKA 4CHKA 1H4RA 2KFKB 2N9EB 3QJZA 1P1AA 2GBNA 3A9JA 4MSQB 1L7YA 3QARA 2KDEB 3UINB 4NJ6A 4PS8A 2GOWA 3UF8A 2G4DB 2Z0DB 3IVFA 5DPSA 2M1MA 2KTRA 5D6JB 3UIPB 4II3B 3CSTA 2KWCA 1A5RA 1E7UA 4NAWA 1KLVA 2LI5A 3NHEB 2CR5A 3ZDMC 3D32A 1WM3A 3DPDA 2KFJA 3WAOA 1V81A 3A9KB 3IG3A 4KSKC 2DX5B 5G2NA 5KHOA 2KXJA 3WANA 3L08A 3VH4B 3M63B 2EMTA 4ICUA 3N30A 2G4SA 2KWVB 2AWTA 4MEMA 4NNJB 5D94A 2KJHB 2NR2A 3C0RB 3EHVA 4JLCA 3PT2B 1WJNA 1SGHA 1WI0A 2LRWA 3RCZA 4FBJB 1GG3A 2KJRA 1C1YB 2D10A 2KHWB 4JQWC 4ZYNA 3ZUNA 2GBRA 2NBUA 4E71A 2XK5B 3QA8A 3VVWB 3PHXB 2DHZA 2LUEA 2MBBB 2NS5A 4W9FA 3NY5A 4PYUA 3ZRCA 2N9XA 1Q0WB 4W9DA 4NJ7A 3UQBA 2LD9A 3VAWA 3CSFA 3NZSA 2ZCBA 1UGMA 2KQSA 4B9KA 5C1ZA 2ZEQA 4GB9A 1E90A 3ENEA 1P0RA 4GDLA 1E5WA 4JGHB 2KO3A 2BF8B 1ISNA 2K8HA 3HK0A 3VUWA 2C60A 3RT3B 2UWQA 2N1VA 2DZKA 4F7ZA 1YX6B 3ALBA 4KIKA 5AZHA 5AEKB 4BBNF 1V5TA 2L00B 5TR5A 3HM6X 4ANWA 2DENB 2XEWA 4B95A 3ZW3A 2DYBA 2DYMA 4WWNA 3JSVA 1PQSA 4LDTD 4P7IA 3PS6A 1BT0A 2AYOB 2FIDA 3LDZE 1WJ4A 2K6DB 3BY4B 3JW0X 3ZNZB 3L13A 1WRDB 2CU1A 4W9JA 3V6EB 2K8CA 4ANVA 2DAFA 1XD3B 1WFYA 2PE9A 1QZEA 4HPMB 2LVQA 2BWES 1AARA 3PV1A 2C7MB 3M95A 3N32A 3SDLC 3UIOB 1NDDA 4DDGD 1Q5WB 2NBVB 3PVLA 1WXSA 2V1YA 4GOCA 2ZCCA 3M62B 4FHKA 4MGIE 1WIAA 4MGZE 4GDLB 1WYWB 2KD0A 2J0MA 3HIZA 3RZFA 2C7HA 1FXTB 2KFKA 3QIJA 4GIVA 2G45B 1I35A 1LFDA 2PE6B 4I6LB 2MW5A 3APDA 3AULA 1Q1OA 2JZ3B 1TGZB 2MLBA 5LXIB 2NVUI 5DPRA 2KWUB 4NQKE 1RFAA 2DAJA 3U7DA 2K1FA 4CYEA 2IO1B 1P98A 4ZRIA 2GBJA 5JHBA 4IW0A 2GMIC 3A9KA 1E8XA 3CF6E 4A3PA 1X1MA 3VDZA 3VUXA 5G55A 2MBOA 2L05A 3KVFB 4I6NB 3PRPB 3H7SA 1GC6A 1R4NI 3DBHI 3GOEA 3WALA 4DHZB 1WE6A 4HVBA 1VD2A 3IBEA 2IY0B 2NCNA 3TCAA 3ONSA 3ZKJC 4DHJD 1WMHB 3VTUA 3A1QB 4FN2A 2DYOA 2XK5A 3QQ8B 3LJ3A 5DPTA 4B6WA 1SE9A 1ZW7A 2AL3A 4IWQA 4GGQA 4IUMB 1XT9B 1WGGA 2KDFB 4MSMB 5E6PA 2FIFA 4MJSB 3ZRFA 3SHQA 3S2AA 1C3TA 2WX1A 1Z5SB 2PEAA 4BKGA 2O6VD 2V4LA 3VH3B 1S3SG 2KQ7A 2CHWA 3DBRI 3A4RA 3JVZX 3Q3JA 2W9NA 1GJZA 3EECA 2IY1B 1WXMA 5JH5C 3ML9A 2HE7A 1WGHA 2MP2B 1D3ZA 4KSLC 1WE7A 2OOBB 3A33B 1R4MI 1KM7A 1WGDA 3GZNI 2N1WA 2ZNVC 4W9EA 4DHJB 2Y5BB 1WR6E 4BBNC 1EO6A 1Y8RC 2ZPYA 1L2NA 1E8ZA 2R2OA 4KVGB 2IBIB 1V49A 3V60A 4M8NA 1IYFA 4A20A 3ZNHB 2V3SA 2FNJB 4WWOA 2C5LC 3K9OB 2K6QA 3QC8B 3VXWA 3EC8A 5E6OA 2NPTB 4WAAA 2I1JA 3APFA 4HPLB 1RLFA 4WJPA 2O6VB 4MELA 2VRRB 4MH0E 3VQIA 2KOXA 3RULA 1KOTA 4J6IA 1I42A 2LWPA 3U8ZA 2GBMA 2KC2A 4AJWA 3NZUA 3ML8A 4ZRKA 4WQOB 2MWSB 2B3AA 5C23A 1GUAB 4BOZB 4XC2A 2CHZA 2IZVB 4KZ0A 1MG8A 5EDSA 4KDIC 3A4SC 4NPNA 4ZRJA 2KVRA 3X23A 1TBEA 4CO7A 5J2RA 2MX2A 2L8JA 1VCBA 1U4AA 2OJRA 2LVPA 5D7GA 4FJZA 2JF5A 2M0XA 3M3JA 4RMAA 2M4NA 4GMVA 5KHQA 4PS3A 4DDID 1V6EA 5J18A 4PYZA 1OEYJ 3V62A 2K8BA 4TKNA 4ANUA 4LJOB 2MBEA 4MGKE 3PREA 5LXHA 1CMXB 4FJVB 2LGDA 2LGXA 2K25A 5L95C 4G50A 1NBFC 4HXDA 1WX9A 1F9JA 2JRHA 4W9LA 1T0YA 1TZ1A 4LCDE 3JYUA 1WMHA 4ANXA 1WZ0A 3A1QA 4FHJA 2KANA 2RR9A 3RZWC 4RM9A 3KYCD 1KJTA 3PLVA 1UZXB 2D07B 3VFKA 2MCNB 3P2BA 4X57B 4EZKA 2MQJA 4MJSA 4NY0A 3W1SC 2UYZB 4FLHA 1LXDA 3ZLZA 4GU2A 4TV3A 2KC1A 1V2YA 5BO4B 4DWFA 3T8MA 3DBLI 1Z2MA 2D2QA 5CTRC 3DVGY 1V9JA 4MGYE 4ICVA 4GDKB 1WX7A 1WXVA 3L16A 3Q3FA 3SD5A 5CX3A 1J19A 2KDBA 2IO3B 1WX8A 3OJ3A 2BYVE 2KMCA 2KTFA 4AUQC 2MP2A 3R3MA 3QK0A 3ZTCA 4TQ0A 5J17A 2Z0EB 3R66C 1ZGUB 1EF1A 4WJNA 5CHVC 2A5UA 5FR6A 1TTNA 2MBHA 3PRZA 4W9GA 3H9DA 1P3QU 1XQQA 4DHZE 2JY6A 5CHFA 4HDOA 3AU5A 4BVUC 4HLEA 2D11A 2AL6A 4DXAB 4E74A 2NPTA 3KW5B 4EUTA 3ZDTA 4BKSA 4WJOA 3X0WA 2O6VA 1YD8U 2CS4A 3QX1A 3EFUA 2L7RA 4XX5A 2LVOA 3OLMD 2N9PC 4LJPB 1RRBA 3H1UA 5HKHA 2RPQA 2J0KA 1EF5A 2ZNVB 3R7RA 5GMVA 2JZZA 4BKSD 2MA9B 3T9LA 4OVVA 4M0WB 1H8CA 3OAWA 2LZ6A 3QAQA 4BKTA 2FAZA 3KUCB 2O2VA 2MSED 3KUZA 3WAPA 2BPSA 2L0FA 5IA7A 2REXA 4KZCA 4HCPB 2KLGA 4AWJA 3I3TB 2BKFA 2JT4B 4FULA 1UBQA 4BOSC 2QHOA 1J8CA 3VHTC 5AZFA 1V86A 2KN5A 2LJ5A 2BWFA 1M94A 2JVCA 4G3XB 4HK2A 4KV2A 3B1LX 4RM8A 2L0TA 3VTWA 3W1SA 4I6PA 2N7DA 1OTRB 3B0AA 4EZJA 1WJUA 2RD0A 2FUHB 3RUIB 2LXCA 2YVCA 5IAAC 1NI2A 3APCA 3TJPA 2I1KA 2BYFA 1WR1A 4IC7B 2PPHA 3V61A 4EKUA 5DPWA 4M8MA 2K39A 2AEHA 2JUOA 2PJHA 2IO0B 3L54A 2MBQA 4DK5A 3PTFC 1WM2A 2WX0A 1YIWA 2FCMA 1K8RB 4G0NB 4XZ4A 2KX0A 2BYEA 4II2B 3ZO5B 4AOFA 2HJ8A 3IHPC 2CKHB 3MTNB 4W9HA 5JHAA 1UELA 2O2VB 4HWIB 1S1QB 3H7PB 2J7QB 2GBKA 4F1SA 1LM8B 2L3ZA 4GDKA 4GN1A 2WDTB 4BFRA 2WYQA 2ZVOA 2DZMA 4K81A 2RSUA 3BINA 2KMAA 3HM3A 2JPHA 4OVUA 4NQLB 2BGFA 4EEWA 2JXXA 1HE8A 3O65B 4MDKE 3UQAA 4GSWA 3HHMA 2EKEC 3PPAA 4N9F4 5CHWA 4AJYB 1WH3A 1IPGA 3ZTDA 1UD7A 3PZDA 5DCNA 3CMMB 2NBWB 2FCSA 3NS8A 3RD2A 3DDCB 1GC7A 2ZJDA 3DVNV 2HD5B 4FA6A 1EUVB 2M8SA 2RGFA 3A9JB 3QWZB 2D3GA 1OGWA 2KDIA 3L17A 3WIMA 4JIOU 3UGBB 3PHWB 4GXBA 1YX5B 2KTRB 1E7VA 1YJ1A 3L0WB 3ZIMA 1YQBA 3KUDB 3QHTA 3AXCA 3PLUA 4NAWB 2LXAA 3TBLD 3IFWB 2KNBA 2JWZA 1P9DU 1V80A 2HTHA 4IM3A 3N3KB 1RAXA 4HCNB 3WA0A 3TIXA 4ASWC 2R2QA 1WY8A 5AZGA 1JRUA 2KZRA 3KYDD 2YLMA 3NOBA 4IWOA 2LGYA 3H6NA 5JZEB 4IWPA 2CHXA 3VUYA 2KLCA 4TUUA 1UBIA 4DBGA 1V5OA 2ZPNA 1GNUA 3OJ4B 1WZ3A 3ZNGC 2MRPA 2G3QB 3DCGA 5L83A 3MJWA 3VTVA 2IYDB 4HJKA 4WWPA 4F8CB 3DVGX 2LRUA 3ECIA 1ZKHA 4IM0A 2ZVNA 5D2MB 3R7QA 2KX3A 4EFOA 3PGEA 3DVNU 4KDLB 3WAMA 4W9IA 4K7SA 2LASA 2DZIA 3QCAA 3DOWA 4K7WA 4E3CA 4TQ1A 4ZDVA 4A3OA 4IG7B 4EZLA 2ZZPB 2C7NB 3B08A 1OQYA 4HDQA 3DBSA 4W9CA 3TL5A 3L10B 4PS7A 3TMPB 4MM3A 3PRMB 4LDTB 3ZVVA 3PSEB 3W1YA 4KIKB 4K7UA 3U30A 5LLIA 2BKRB 4K1RB 2XBBC 1WXAA 2KJ6A 2WWZA 1J0GA 4JL9A 5E6NA 2N4FA 4WJQA 3JSVB
chains in the Genus database with same CATH superfamily
2B76B 3BIID 4IM2A 4G11A 2MEKA 1FRRA 2EMSA 1UH6A 3DQVA 2JRIB 4NAMA 4W9KA 2KKCA 3U4EG 3GE3C 2VH1A 2M17A 3RYTA 3Q8CA 4URKA 1H4RA 1CQVA 1P1AA 3A9JA 4MSQB 1UUPA 3UINB 4NJ6A 4PS8A 3FAHA 1N6ZA 1I4PA 1ET9A 1A5RA 2X8XX 3KQ4A 2KYWA 3AEBB 2KFJA 1V81A 2PLPA 4A55A 4LK0M 2EMTA 4GLSC 2NR2A 3PT2B 1WJNA 3TEZA 3RCZA 1C1YB 1FFUA 2BT6A 2KHWB 4ZYNA 4M00A 3QA8A 3V05A 3VVWB 2N7JA 2G1EA 2LUEA 3AE4B 1SF0A 4JWUC 2D5GA 3UQBA 5BYRA 2KQSA 1L0VB 4YSXB 2ZEQA 1C9FA 1E90A 2M19A 4GDLA 4JGHB 2KO3A 2AQ3B 1ISNA 3AEFB 2UWQA 4KIKA 5AZHA 5TR5A 3ZW3A 2DYBA 1R4MB 4WWNA 3JSVA 4LDTD 1BT0A 1WYGA 2K6DB 4YSYB 3ZNZB 1K51A 2LEKA 4ANVA 5FR3A 1XCQL 2AQ2B 2BWES 3L4PA 1T6BX 4PT5A 2WU2B 3BYYB 2BBCA 4WIPA 3PVLA 3P63A 4MGIE 3C19A 4MGZE 4GDLB 1WYWB 3HIZA 3HUIA 2PE6B 1XF5L 3GB1A 3AULA 3RNGC 2WQYB 2NVUI 2JX5A 4NQKE 1RFAA 1Y56A 4XWWA 2IO1B 5JXVA 3A9KA 1E8XA 2YEPB 3CF6E 2XNAC 3PZ8A 3VUXA 2L05A 3H7SA 1GC6A 3WALA 1WE6A 3TCAA 3Q8EA 3ZKJC 2J42A 3VTUA 3A1QB 3NVVA 2XK5A 1T5XD 4IWQA 1WGGA 2KDFB 2FIFA 3SHQA 2PEAA 4HPPA 4KGSA 4PK1A 5T8IA 4BKGA 1LO5D 1JW9D 1OFFA 2O6VD 3VH3B 1S3SG 3DHGC 3P4RB 3A4RA 1L6UA 2OOBB 4LNOA 1KM7A 3GZNI 4W9EA 4DHJB 3TUOA 1EO6A 1MJDA 1Y8RC 1QOBA 1K52A 2ZPYA 1V49A 1MI0A 4A20A 1TT5B 2PW9A 2FNJB 4WWOA 3K9OB 1ZUD2 1FNUA 1FCCC 1IGDA 3VXWA 3EC8A 5E6OA 3APFA 5C2TB 1RLFA 3IXSA 4MH0E 2KOXA 3RULA 2KC2A 4AJWA 3NZUA 2MWSB 1PFDA 2B3AA 4BOZB 4KDIC 3A4SC 2W54A 2QCZA 2KVRA 3X23A 3EFCA 5J2RA 1TYGB 1VCBA 4K3CA 2LVPA 5D7GA 4FJZA 2M0XA 4RMAA 5KHQA 2WXPA 1V6EA 4PYZA 4TKNA 2MBEA 2HTME 2BW2A 4FJVB 2JYTA 1WX9A 2JRHA 1IBXB 1L5PA 1TZ1A 1WMHA 3P4SB 2QC8A 1KJTA 3AB5A 1ZP0B 4YWGG 4EZKA 1N62A 1FM0D 1LXDA 2HJ1A 2R61A 3MJ5A 1A70A 1SB3C 2QJLA 2PMVA 1ZE3D 3B2FA 1JWUD 3L16A 1WGKA 5CX3A 2KDBA 3ZXRA 2IJ0A 4AQ7A 2PVOD 2KTFA 5J17A 2Z0EB 3R66C 1TTNA 3RNBC 2MBHA 3PRZA 3H9DA 1ET6A 4DHZE 4HDOA 1TS2A 2NPTA 3PO0A 2W55A 3ZDTA 1N60A 2O6VA 2CS4A 2L7RA 5HKHA 3OLMD 1RRBA 1NVID 2RPQA 4C4VB 4RFBA 3B2GA 3LB8C 3E56A 5GMVA 4BKSD 2VZKD 3OAWA 2CJNA 1F77A 1CJEA 3KUCB 2PIAA 3NUHB 2MJEA 2BPSA 3ETRA 3N20C 2JT4B 1J8CA 4DXFA 1GAQB 1JWSD 1M94A 4USAA 4G3XB 2L0TA 4I6PA 1OTRB 3I5JC 3EUB2 4C7YA 5IKCM 1WJUA 3U7ZA 2I1KA 4IC7B 3UI3A 5DPWA 4MM3B 4REZA 1TZOA 3GP7A 2G9HD 2IO0B 2MBQA 2DWQA 4LTUA 4XZ4A 2BYEA 1I4RA 2LGSA 4W9HA 3MTNB 5JHAA 4HWIB 4JPSA 2ONQA 1WRIA 4GN1A 2WYQA 1R4NB 3DBHB 4ZHPA 2RSUA 3IAM1 2KMAA 4HKQA 1EU3A 3PPAA 2YEPF 3ZTDA 3RD2A 2JXTA 1GC7A 5FK9C 4M01A 3DVNV 4YTMB 2RGFA 5E6JA 3QWZB 5H8YE 3ZJVA 3WIMA 3UGBB 4BZAA 3DWGC 1YQBA 3QHTA 2LJIA 2KNBA 2JWZA 1QOGA 3P42A 2HTHA 4RGTA 3TIXA 3AV8A 3ZJUA 2L1AA 2LGYA 3H6NA 2V4IB 4M0WA 3VUYA 2WGSA 3P1MA 2WXIA 3MJWA 3KLSX 1TIFA 4WWPA 3DVGX 2RPVA 3ECIA 4KX6B 4IM0A 5D2MB 2KX3A 3DVNU 4OVZA 1T0QC 2DZIA 3TL5A 2INCC 2LHDA 3AE8B 3ZVVA 1RM6C 3PSEB 5LLIA 2BKRB 4K1RB 1C78A 1JALA 4WJQA 1EU4A 4ZHOA 2W3SA 3H7PA 2ASQA 2KK8A 1IP9A 3AU4A 2Z59B 3SFDB 3I63C 1QT9A 2IO2B 4YL8A 2QIEB 1D5ZC 2WXGA 4UDUC 1E8YA 2BTEA 1YOVB 2KVZA 1TKEA 4HROA 2KFKB 3QJZA 2GBNA 2KDEB 4A9AA 3IVFA 2M1MA 2KTRA 5D6JB 1DOXA 3UIPB 2KWCA 1E7UA 4NAWA 3D32A 1WM3A 4KSKC 2QMTA 3P4PB 3VH4B 1FXAA 3N30A 2KWVB 2AWTA 5D94A 1JWMD 2D10A 2GBRA 4E71A 5AUKA 3PHXB 4CQNA 2KMMA 4HJGE 2NS5A 3RMKC 3ZRCA 1Q0WB 4OZCA 3VAWA 2W82A 5I4DA 1P0RA 5GXGB 3RT3B 2N1VA 2DZKA 4F7ZA 3T3OA 1RYJA 3HM6X 4P7IA 3GZNB 3N1ZC 3PS6A 2AYOB 2FIDA 3LDZE 2WS3B 3JW0X 1XXGA 2CU1A 4W9JA 2IGDA 1XD3B 2PE9A 1AARA 4AS1A 3PV1A 2C7MB 3AE2B 3M95A 3N32A 4XYCA 4FXCA 3IAS1 2NBVB 2K5PA 1WXSA 1HA5A 3ZGZA 2V1YA 1E10A 2H89B 3FILB 4M02A 1EWCA 3RN9C 3RZFA 2C7HA 3QIJA 4GIVA 2G45B 1I35A 4I6LB 3VRAB 1V8CA 2JZ3B 2N9LA 1TGZB 5DPRA 2LHEA 2K1FA 4CYEA 4OHJA 1C79A 2MJ3A 2K3UA 2GMIC 4A3PA 3R8BA 1X1MA 1UGJA 5G55A 2MBOA 4I6NB 1R4NI 3DBHI 3VR8B 2IY0B 2NCNA 3ONSA 4DHJD 2DYOA 1JWBD 4IUMB 5E6PA 2D3CA 3ZRFA 1E9MA 4MJSB 5EE9A 1KH0A 1SXTA 2WX1A 4P1CC 3Q8AA 2FUG1 3JVZX 2W9NA 2L83A 3EECA 1WXMA 2HE7A 2MP2B 4RF0A 2BVCA 1ZPSA 3NJTA 1YNTE 3RI7C 4IDIA 2Y5BB 1WR6E 4BBNC 4C56C 2BS4B 3PZ7A 3RFZB 2R2OA 1L2NA 3V60A 2IDYA 2V3SA 2WU5B 1HQRD 4HPLB 1FNWA 2VRRB 1KLUD 3AEEB 4XWTA 1GUAB 2ZW0A 2BB5A 4KZ0A 1MG8A 4YXDB 2LFIA 1L0XB 1U4AA 2OJRA 2WXNA 2JF5A 4Q2JA 5J18A 3HVDA 3V62A 3TEYA 5LXHA 1DGJA 2K25A 5L95C 4G50A 1STEA 4HXDA 2X38A 1XEEA 4ANXA 1WZ0A 3A1QA 2KANA 3RZWC 4RM9A 3PLVA 4X57B 2MQJA 1MG4A 4GU2A 5BO4B 3T8MA 4N6EB 5CTRC 1V9JA 4P16A 3SD5A 2SAKA 2WLBA 2BYVE 1ZDXA 2KMCA 4AUQC 4TQ0A 3QK0A 1ZGUB 2KDMA 2A5UA 2E6XA 3AE6B 2EELA 1SE3A 2N9KA 1XLQA 2JY6A 2IGGA 4BVUC 1ZOYB 2INNE 4WJOA 3QX1A 5HG2A 2N9PC 3AE3B 1GPXA 3AEDB 1EF5A 2Z8LA 1VLBA 4H2AA 1KF6B 2JZZA 5H92C 3T9LA 5EE1A 3LXFA 1F52A 4A6QA 1H8CA 1BXTA 2FAZA 1P7FA 3WAPA 5IA7A 4OZAA 4AWJA 4FULA 4YSZB 4BOSC 2QHOA 3VHTC 4NJCA 5AZFA 3BVGA 2KT7A 2KN5A 2LJ5A 2JVCA 4HK2A 3B1LX 1NENB 3B0AA 4LLGM 4EZJA 2RD0A 1NEKB 1ESFA 3RUIB 5IAAC 4DQOC 3APCA 2M0AA 4EKUA 4LNNA 1IBXA 2PJHA 1Q10A 1WWTA 3L54A 4WAFA 1WM2A 3N9YC 2KX0A 3V3XA 2HJ8A 3IHPC 2CKHB 1S1QB 3BYTB 4F1SA 4BFRA 4K81A 1KFYB 2DZMA 1ENFA 1PYWD 1C77A 4OVUA 5BMIA 1CZPA 1HE8A 3MC9A 4GSWA 1NYRA 4AJYB 3BK1A 1ROEA 3Q2AC 1DOYA 3PZDA 1HTOA 2NBWB 2BQQA 2V3NA 3DDCB 2HD5B 1FRDA 2KN4A 2Y5PA 2UU7A 1E7PB 1C76A 2KDIA 2QEJC 2W3RA 4GXBA 1YX5B 3L0WB 3ZIMA 3KUDB 2LXAA 1FFVA 1PGBA 1HZ5A 2V3PA 1YN3A 4IM3A 4C4VA 4ASWC 2R2QA 2GB1A 1JRUA 1HXYD 3RNEC 2LGIA 3AE9B 4IWPA 2GI9A 3ZQ4A 3OJ4B 1GNUA 1HTQA 3ZNGC 2G3QB 3DCGA 4KGRA 4HJKA 2WXOA 4F8CB 2LRUA 3DHIC 1NYQA 4NZLB 3Q69A 3R7QA 1KTKA 4US8A 4KDLB 3WAMA 3ZXVA 2L52A 3NS1A 4W9IA 3B9JA 4K7WA 3W2DA 5D3DA 4ZDVA 1VRAB 2C7NB 4WQMA 1OQYA 1BUIC 4PS7A 4MM3A 3TMPB 4LDTB 2Y5CA 3BVMA 3U30A 3AEGB 3RNFC 2XBBC 1WXAA 1J0GA 4JL9A 2N4FA 4RGOS 3K9PB 1OEYA 1E8WA 4KKJA 4B0EA 3SU8X 3W5VB 1G6JA 1M4VA 3RNAC 2PVGC 3V6CB 4XGAB 1LGRA 1SIFA 1WGRA 2FCQA 3C8YA 3NVWA 2K9XA 1L7YA 3QARA 2G4DB 2Z0DB 3VR9B 4II3B 1WXQA 3AH7A 2LI5A 2CR5A 3DPDA 3IG3A 2DX5B 5KHOA 5BYQA 3WANA 1ACCA 3L08A 4MEMA 2G4SA 4NNJB 3Q3OC 2KJHB 3C0RB 3EHVA 2ICIA 5HHDG 2WDVB 1SGHA 2LRWA 1FO4A 3EA6A 2KJRA 1YQ4B 3ZUNA 4JQWC 2NBUA 3MC0B 3HVZA 4ZRPA 4PYUA 2MH7A 2N9XA 1QLBB 4NJ7A 2WDRB 4ZOHC 3NZSA 2ZCBA 2V9HA 2VH2A 4GB9A 1XLOA 3ENEA 1D6EC 1MVKA 1E5WA 3IT4B 1I4XA 2C60A 2N0SB 3ALBA 5AEKB 4BBNF 2L00B 1ZXIA 4ANWA 1MFWA 2DENB 2XEWA 4B95A 1PGXA 3N1XC 3Q14C 2DYMA 1PQSA 2PKOA 1FD6A 1FCLA 3L13A 1J7CA 1WRDB 2I2YA 1OQRA 2K8CA 1FMAD 1WFYA 4RNAA 2J52A 4J3OD 2LVQA 3SDLC 3UIOB 5G5HA 1I4GA 1NDDA 2OJWA 2K22A 1KLVA 2KFKA 1JROA 1K53A 1LFDA 1Q1OA 2OEDA 3EGRA 2I38A 2WXFA 2KWUB 3U7DA 2DAJA 1P98A 2WDQB 4ZRIA 2GBJA 5JHBA 4IW0A 2KACA 3VDZA 1YQ3B 4DHZB 3GOEA 1VD2A 5BYSA 1VZ7A 1N61A 3QQ8B 1FXIA 3LJ3A 5DPTA 1MPEA 1SE9A 1ZW7A 2AL3A 3VQIA 1XT9B 4MSMB 1C3TA 3S2AA 2SEBD 1Z5SB 2WP9B 2V4LA 4ARCA 1FEHA 2DBYA 1GOZA 3DBRI 3Q3JA 3LYYA 2INDC 1GJZA 1T0RC 3ZJTA 3ML9A 4KSLC 3A33B 1BMLC 1WGDA 2PTLA 2N1WA 2ZNVC 4OW0A 2DLBA 4KVGB 4IKGA 2IBIB 4TSSA 3ZNHB 2C5LC 2EKIA 3QC8B 1HZ6A 4WAAA 4WJPA 2VZKB 4MELA 4WURA 1VZ8A 1J7BA 2WXRA 2HDEA 2LWPA 4ITKA 1TJEA 4ZRKA 3J9CA 2RDGA 3RNCC 4XC2A 2CHZA 1V1OA 2IZVB 4ZRQA 5IN7A 1QOFA 3FILA 1JWAD 1TY2A 4CO7A 3E9SA 2MX2A 2L8JA 4S17A 5AUIA 3M3JA 1VJKA 4GMVA 4PS3A 4DDID 1AYFA 1OEYJ 2GLSA 1QILA 4DXGA 1QF6A 2WHIA 4O1NA 3PREA 1CMXB 3T3NA 2LGXA 2AQ1B 4QAYA 1NBFC 4W9LA 1SE2A 3NZ3A 4FHJA 2RR9A 4HKZE 3KYCD 1UZXB 2D07B 4HEA1 4KGTA 2MCNB 3P2BA 4MJSA 4C00A 2UYZB 3ZLZA 4TV3A 2KC1A 4DWFA 3DBLI 1Z2MA 1L0YB 2KAJA 1XLPA 3DVGY 4ICVA 3AE5B 4GDKB 1QOAA 1WXVA 4MT5A 3Q3FA 1J19A 1DOIA 2IO3B 1WX8A 1C4PA 2MP2A 3R3MA 1C4AA 3ZTCA 4ACFA 1EF1A 5CHVC 1T0SC 2BS2B 3WCQA 1UNSA 5CHFA 4RF1A 5IO9A 1FPYA 2AL6A 4E74A 5BMGA 1MHHE 2LVOA 3W9CB 1VZ6A 2MJDA 1L4ZB 4L2YA 1N5WA 4LNKA 2ZNVB 2E3TA 3R7RA 2MA9B 1F2RI 4BKTA 4WWMA 3O13A 4JE3B 2O2VA 2MSED 3KUZA 2L0FA 4KZCA 2KLGA 1B1ZA 2JU6X 2BWFA 1XCTL 4KV2A 1MHXA 2N7DA 2LXCA 1FIQA 1FNVA 1WSPA 1NI2A 2LUMA 3TJPA 1SEBD 2BYFA 2PPHA 3MC8A 3V61A 5IOIA 2JSVX 2K39A 4A8XC 2AEHA 5EE0A 1JQ4A 4DK5A 3PTFC 3AE1B 2WX0A 4KKIA 2FCMA 1K8RB 1JRPA 1UF0A 2QSDA 1PDXA 2BS3B 1TS5A 1UELA 2O2VB 5HI1A 2J7QB 3URYA 3BINA 3DHHC 3HM3A 2JPHA 4EEWA 2JXXA 3O65B 2BB6A 3UQAA 2EKEC 1WH3A 1IPGA 3AECB 2NMQA 5DCNA 3CMMB 3NVZA 3NS8A 4L23A 3A9JB 1OGWA 3OWEB 1JCKB 1P7EA 3PHWB 5EE3A 1E7VA 3AM9A 4EE2A 1YJ1A 4XE0A 2V0GA 3AXCA 3TBLD 4C80A 3IFWB 2JZPA 3P4QB 1T3QA 4B0MA 2WXMA 3N3KB 1RAXA 4HCNB 5AZGA 1WY8A 4IOIE 3KYDD 2NTSA 2QILA 2YLMA 3NOBA 4IWOA 5JZEB 4TUUA 1UBIA 4DBGA 1V5OA 2L32A 1N5XA 1WZ3A 2MRPA 4L1BA 2JWUA 3N1YC 2ZVNA 4RGNA 4K7SA 2D3BA 1XO3A 3I57A 2RDBC 1L6VA 2LASA 3DOWA 3R2TA 3CIRB 4TQ1A 4A3OA 4IG7B 4EZLA 2IPKD 2TSSA 4R3DA 4W9CA 2XN9C 3L10B 1R7SA 1OQQA 3I9V1 4K7UA 4KIKB 2WWZA 3IBEA 3JSVB 2L76A 2WXJA 3VRBB 1LQBA 2J0JA 3AI5A 4K3BA 3U52E 1B9RA 3KH0A 1WGYA 4FJYA 3NRZA 2WXHA 3KWVA 1WF9A 4LNIA 2N7EA 2A4ZA 1WJ6A 4MH8A 2FCNA 3DWMA 4AP4C 1YMHE 4FADA 1YJJA 3ZNID 2ZW1A 2DZJA 2C9WB 3MHSD 4EOYA 4CHKA 2WNMA 2N9EB 2GOWA 3UF8A 5DPSA 2IGHA 1IUEA 3CSTA 2BYTA 1SIJA 3NHEB 3ZDMC 3WAOA 3A9KB 5G2NA 3FKYA 2KXJA 3M63B 4ICUA 3H8HA 1PGAA 4JLCA 5FKAC 1ZDVA 1WI0A 1F1HA 3Q8FA 4FBJB 1GG3A 2XK5B 2DHZA 2MBBB 4W9FA 3NY5A 4YTNB 4W9DA 3Q6BA 1V1PA 2LD9A 3CSFA 1UGMA 4B9KA 1V97A 5C1ZA 4ZYSA 3DBRB 2BF8B 3HK0A 2K8HA 3VUWA 1YJIA 1YX6B 1SBBB 1VR9A 1QQRA 1V5TA 1D5MC 2JQRB 5C3JB 1ZXHA 1QKZA 1TKYA 5MPOA 1WJ4A 3BY4B 4MACA 3U2SC 3TEXA 1TY0A 1F2RC 1RWSA 1RFKA 3V6EB 2DAFA 3W5UB 1QZEA 4HPMB 3SFEB 1VDVA 1V1PB 3AMZA 4WH4A 1I4HA 4DDGD 1Q5WB 4GOCA 2ZCCA 3M62B 4FHKA 4RCOA 1WIAA 2KD0A 3NG0A 2J0MA 1AN8A 2ON8A 1FXTB 3Q3NC 2MW5A 2WXQA 3APDA 2MLBA 5LXIB 1I7HA 5TSSA 2CJOA 3KVFB 3PRPB 4HVBA 4XDDA 1WMHB 4FN2A 1KRHA 2FBWB 3SEBA 1EWYC 4B6WA 4RH6A 4GGQA 4JX1C 3AEAB 1HEZE 1GB4A 1SSNA 3MP9A 2KQ7A 2CHWA 3BVZA 3DBLB 2IY1B 5JH5C 1WGHA 1D3ZA 1AWDA 1WE7A 1R4MI 4D2KA 4BAXA 1E8ZA 1IYFA 4M8NA 2K6QA 2NPTB 2I1JA 2NTTA 3FC4A 3IT6B 2O6VB 3CWIA 1KOTA 4J6IA 3TSSA 5BMHA 1I42A 3U8ZA 2GBMA 3ML8A 4WQOB 5C23A 3AE7B 1SE4A 1SJED 5EDSA 4NPNA 4ZRJA 1TBEA 4N59A 2M4NA 5HFYA 4TMAB 1EM7A 3MHZA 2K8BA 4ANUA 4LJOB 4MGKE 2LGDA 2K0PA 1J7AA 4ARIA 2QDFA 4XDCA 2ACZB 1F9JA 1PUTA 1T0YA 4LCDE 1K50A 3JYUA 4HRSA 3TEWA 4A90A 3MFGA 2J4XA 3NVYA 4N58A 3VFKA 4NY0A 2D3AA 3W1SC 1TKGA 4FLHA 1V2YA 2D2QA 5D3IB 4MGYE 1WX7A 2GRIA 3OJ3A 3AN1A 4P1BC 1I4QA 4WJNA 5FR6A 1YN5A 4W9GA 2OHFA 1P3QU 1XQQA 3AU5A 4HLEA 2D11A 4DXAB 3KW5B 4EUTA 1TS4A 4BKSA 4RGMA 3X0WA 1YD8U 3EFUA 4XX5A 4LJPB 2KWDA 3H1UA 2RMMA 2J0KA 1SJHD 4C7ZA 3RPFC 4OVVA 1D5XC 2AX5A 4M0WB 3QAQA 2LZ6A 4S0RA 2Q5WD 4LNFA 4YTPB 1C4CA 5G5GA 2DNFA 2REXA 2WXKA 4HCPB 2RDHA 3I3TB 2BKFA 1UBQA 1UWMA 3R2IA 1V86A 1UWXA 1XLNA 1IGCA 4RM8A 3VTWA 3W1SA 3BZDB 2FUHB 2YVCA 2LMCA 1WR1A 4M8MA 1NI3A 2JUOA 4US9A 1YIWA 4G0NB 1N63A 1D4BA 3KWLA 4II2B 4YT0B 3ZO5B 4AOFA 1JMLA 3H7PB 2GBKA 1LM8B 2L3ZA 4GDKA 2WDTB 3BWUD 2ZVOA 4NQLB 2BGFA 3BK2A 4MDKE 3HRDD 3HHMA 4N9F4 5CHWA 3Q3MC 3OG5A 1F0ZA 1UD7A 2Y3AA 2FCSA 2ZJDA 4FA6A 3Q8BA 1EUVB 2M8SA 2D3GA 3L17A 4JIOU 2KTRB 1DYQA 1E0ZA 3GE8C 2CU3A 4NAWB 3PLUA 2MHJA 1P9DU 1V80A 3WA0A 2KZRA 5LNK1 1AW7A 3GS2A 2CHXA 2KLCA 1L4DB 2ZPNA 5IP4D 5L83A 1TS3A 3VTVA 2IYDB 4OZBA 1ZKHA 4EFOA 2WXLA 3PGEA 2FE8A 4JWSC 4P6VF 2INPE 1CK1A 3QCAA 2JYEA 1YN4A 4E3CA 2KQ4X 1GB1A 2ZZPB 3B08A 4HDQA 3ZYYX 3DBSA 2J53A 3ABVB 2H88B 3PRMB 3SR6A 3W1YA 1E6EB 2M56B 2KJ6A 5E6NA 1KLGD
chains in the Genus database with same CATH topology
2L76A 4IM2A 3K9PB 4G11A 1LQBA 2J0JA 3AI5A 1OEYA 3KH0A 1E8WA 3H7PA 1WGYA 3SU8X 4FJYA 2ASQA 2EMSA 1UH6A 2KK8A 1WF9A 3DQVA 1IP9A 2N7EA 3AU4A 2A4ZA 2Z59B 2JRIB 1G6JA 1WJ6A 2FCNA 4W9KA 2IO2B 2KKCA 4YL8A 4AP4C 3V6CB 2M17A 3RYTA 4FADA 1SIFA 1E8YA 1WGRA 2FCQA 3ZNID 2DZJA 2C9WB 3MHSD 4EOYA 4URKA 4CHKA 1H4RA 2KFKB 2N9EB 3QJZA 1P1AA 2GBNA 3A9JA 4MSQB 1L7YA 3QARA 2KDEB 3UINB 4NJ6A 4PS8A 2GOWA 3UF8A 2G4DB 2Z0DB 3IVFA 5DPSA 2M1MA 2KTRA 5D6JB 3UIPB 4II3B 3CSTA 2KWCA 1A5RA 1E7UA 4NAWA 1KLVA 2LI5A 3NHEB 2CR5A 3ZDMC 3D32A 1WM3A 3DPDA 2KFJA 3WAOA 1V81A 3A9KB 3IG3A 4KSKC 2DX5B 5G2NA 5KHOA 2KXJA 3WANA 3L08A 3VH4B 3M63B 2EMTA 4ICUA 3N30A 2G4SA 2KWVB 2AWTA 4MEMA 4NNJB 5D94A 2KJHB 2NR2A 3C0RB 3EHVA 4JLCA 3PT2B 1WJNA 1SGHA 1WI0A 2LRWA 3RCZA 4FBJB 1GG3A 2KJRA 1C1YB 2D10A 2KHWB 4JQWC 4ZYNA 3ZUNA 2GBRA 2NBUA 4E71A 2XK5B 3QA8A 3VVWB 3PHXB 2DHZA 2LUEA 2MBBB 2NS5A 4W9FA 3NY5A 4PYUA 3ZRCA 2N9XA 1Q0WB 4W9DA 4NJ7A 3UQBA 2LD9A 3VAWA 3CSFA 3NZSA 2ZCBA 1UGMA 2KQSA 4B9KA 5C1ZA 2ZEQA 4GB9A 1E90A 3ENEA 1P0RA 4GDLA 1E5WA 4JGHB 2KO3A 2BF8B 1ISNA 2K8HA 3HK0A 3VUWA 2C60A 3RT3B 2UWQA 2N1VA 2DZKA 4F7ZA 1YX6B 3ALBA 4KIKA 5AZHA 5AEKB 4BBNF 1V5TA 2L00B 5TR5A 3HM6X 4ANWA 2DENB 2XEWA 4B95A 3ZW3A 2DYBA 2DYMA 4WWNA 3JSVA 1PQSA 4LDTD 4P7IA 3PS6A 1BT0A 2AYOB 2FIDA 3LDZE 1WJ4A 2K6DB 3BY4B 3JW0X 3ZNZB 3L13A 1WRDB 2CU1A 4W9JA 3V6EB 2K8CA 4ANVA 2DAFA 1XD3B 1WFYA 2PE9A 1QZEA 4HPMB 2LVQA 2BWES 1AARA 3PV1A 2C7MB 3M95A 3N32A 3SDLC 3UIOB 1NDDA 4DDGD 1Q5WB 2NBVB 3PVLA 1WXSA 2V1YA 4GOCA 2ZCCA 3M62B 4FHKA 4MGIE 1WIAA 4MGZE 4GDLB 1WYWB 2KD0A 2J0MA 3HIZA 3RZFA 2C7HA 1FXTB 2KFKA 3QIJA 4GIVA 2G45B 1I35A 1LFDA 2PE6B 4I6LB 2MW5A 3APDA 3AULA 1Q1OA 2JZ3B 1TGZB 2MLBA 5LXIB 2NVUI 5DPRA 2KWUB 4NQKE 1RFAA 2DAJA 3U7DA 2K1FA 4CYEA 2IO1B 1P98A 4ZRIA 2GBJA 5JHBA 4IW0A 2GMIC 3A9KA 1E8XA 3CF6E 4A3PA 1X1MA 3VDZA 3VUXA 5G55A 2MBOA 2L05A 3KVFB 4I6NB 3PRPB 3H7SA 1GC6A 1R4NI 3DBHI 3GOEA 3WALA 4DHZB 1WE6A 4HVBA 1VD2A 3IBEA 2IY0B 2NCNA 3TCAA 3ONSA 3ZKJC 4DHJD 1WMHB 3VTUA 3A1QB 4FN2A 2DYOA 2XK5A 3QQ8B 3LJ3A 5DPTA 4B6WA 1SE9A 1ZW7A 2AL3A 4IWQA 4GGQA 4IUMB 1XT9B 1WGGA 2KDFB 4MSMB 5E6PA 2FIFA 4MJSB 3ZRFA 3SHQA 3S2AA 1C3TA 2WX1A 1Z5SB 2PEAA 4BKGA 2O6VD 2V4LA 3VH3B 1S3SG 2KQ7A 2CHWA 3DBRI 3A4RA 3JVZX 3Q3JA 2W9NA 1GJZA 3EECA 2IY1B 1WXMA 5JH5C 3ML9A 2HE7A 1WGHA 2MP2B 1D3ZA 4KSLC 1WE7A 2OOBB 3A33B 1R4MI 1KM7A 1WGDA 3GZNI 2N1WA 2ZNVC 4W9EA 4DHJB 2Y5BB 1WR6E 4BBNC 1EO6A 1Y8RC 2ZPYA 1L2NA 1E8ZA 2R2OA 4KVGB 2IBIB 1V49A 3V60A 4M8NA 1IYFA 4A20A 3ZNHB 2V3SA 2FNJB 4WWOA 2C5LC 3K9OB 2K6QA 3QC8B 3VXWA 3EC8A 5E6OA 2NPTB 4WAAA 2I1JA 3APFA 4HPLB 1RLFA 4WJPA 2O6VB 4MELA 2VRRB 4MH0E 3VQIA 2KOXA 3RULA 1KOTA 4J6IA 1I42A 2LWPA 3U8ZA 2GBMA 2KC2A 4AJWA 3NZUA 3ML8A 4ZRKA 4WQOB 2MWSB 2B3AA 5C23A 1GUAB 4BOZB 4XC2A 2CHZA 2IZVB 4KZ0A 1MG8A 5EDSA 4KDIC 3A4SC 4NPNA 4ZRJA 2KVRA 3X23A 1TBEA 4CO7A 5J2RA 2MX2A 2L8JA 1VCBA 1U4AA 2OJRA 2LVPA 5D7GA 4FJZA 2JF5A 2M0XA 3M3JA 4RMAA 2M4NA 4GMVA 5KHQA 4PS3A 4DDID 1V6EA 5J18A 4PYZA 1OEYJ 3V62A 2K8BA 4TKNA 4ANUA 4LJOB 2MBEA 4MGKE 3PREA 5LXHA 1CMXB 4FJVB 2LGDA 2LGXA 2K25A 5L95C 4G50A 1NBFC 4HXDA 1WX9A 1F9JA 2JRHA 4W9LA 1T0YA 1TZ1A 4LCDE 3JYUA 1WMHA 4ANXA 1WZ0A 3A1QA 4FHJA 2KANA 2RR9A 3RZWC 4RM9A 3KYCD 1KJTA 3PLVA 1UZXB 2D07B 3VFKA 2MCNB 3P2BA 4X57B 4EZKA 2MQJA 4MJSA 4NY0A 3W1SC 2UYZB 4FLHA 1LXDA 3ZLZA 4GU2A 4TV3A 2KC1A 1V2YA 5BO4B 4DWFA 3T8MA 3DBLI 1Z2MA 2D2QA 5CTRC 3DVGY 1V9JA 4MGYE 4ICVA 4GDKB 1WX7A 1WXVA 3L16A 3Q3FA 3SD5A 5CX3A 1J19A 2KDBA 2IO3B 1WX8A 3OJ3A 2BYVE 2KMCA 2KTFA 4AUQC 2MP2A 3R3MA 3QK0A 3ZTCA 4TQ0A 5J17A 2Z0EB 3R66C 1ZGUB 1EF1A 4WJNA 5CHVC 2A5UA 5FR6A 1TTNA 2MBHA 3PRZA 4W9GA 3H9DA 1P3QU 1XQQA 4DHZE 2JY6A 5CHFA 4HDOA 3AU5A 4BVUC 4HLEA 2D11A 2AL6A 4DXAB 4E74A 2NPTA 3KW5B 4EUTA 3ZDTA 4BKSA 4WJOA 3X0WA 2O6VA 1YD8U 2CS4A 3QX1A 3EFUA 2L7RA 4XX5A 2LVOA 3OLMD 2N9PC 4LJPB 1RRBA 3H1UA 5HKHA 2RPQA 2J0KA 1EF5A 2ZNVB 3R7RA 5GMVA 2JZZA 4BKSD 2MA9B 3T9LA 4OVVA 4M0WB 1H8CA 3OAWA 2LZ6A 3QAQA 4BKTA 2FAZA 3KUCB 2O2VA 2MSED 3KUZA 3WAPA 2BPSA 2L0FA 5IA7A 2REXA 4KZCA 4HCPB 2KLGA 4AWJA 3I3TB 2BKFA 2JT4B 4FULA 1UBQA 4BOSC 2QHOA 1J8CA 3VHTC 5AZFA 1V86A 2KN5A 2LJ5A 2BWFA 1M94A 2JVCA 4G3XB 4HK2A 4KV2A 3B1LX 4RM8A 2L0TA 3VTWA 3W1SA 4I6PA 2N7DA 1OTRB 3B0AA 4EZJA 1WJUA 2RD0A 2FUHB 3RUIB 2LXCA 2YVCA 5IAAC 1NI2A 3APCA 3TJPA 2I1KA 2BYFA 1WR1A 4IC7B 2PPHA 3V61A 4EKUA 5DPWA 4M8MA 2K39A 2AEHA 2JUOA 2PJHA 2IO0B 3L54A 2MBQA 4DK5A 3PTFC 1WM2A 2WX0A 1YIWA 2FCMA 1K8RB 4G0NB 4XZ4A 2KX0A 2BYEA 4II2B 3ZO5B 4AOFA 2HJ8A 3IHPC 2CKHB 3MTNB 4W9HA 5JHAA 1UELA 2O2VB 4HWIB 1S1QB 3H7PB 2J7QB 2GBKA 4F1SA 1LM8B 2L3ZA 4GDKA 4GN1A 2WDTB 4BFRA 2WYQA 2ZVOA 2DZMA 4K81A 2RSUA 3BINA 2KMAA 3HM3A 2JPHA 4OVUA 4NQLB 2BGFA 4EEWA 2JXXA 1HE8A 3O65B 4MDKE 3UQAA 4GSWA 3HHMA 2EKEC 3PPAA 4N9F4 5CHWA 4AJYB 1WH3A 1IPGA 3ZTDA 1UD7A 3PZDA 5DCNA 3CMMB 2NBWB 2FCSA 3NS8A 3RD2A 3DDCB 1GC7A 2ZJDA 3DVNV 2HD5B 4FA6A 1EUVB 2M8SA 2RGFA 3A9JB 3QWZB 2D3GA 1OGWA 2KDIA 3L17A 3WIMA 4JIOU 3UGBB 3PHWB 4GXBA 1YX5B 2KTRB 1E7VA 1YJ1A 3L0WB 3ZIMA 1YQBA 3KUDB 3QHTA 3AXCA 3PLUA 4NAWB 2LXAA 3TBLD 3IFWB 2KNBA 2JWZA 1P9DU 1V80A 2HTHA 4IM3A 3N3KB 1RAXA 4HCNB 3WA0A 3TIXA 4ASWC 2R2QA 1WY8A 5AZGA 1JRUA 2KZRA 3KYDD 2YLMA 3NOBA 4IWOA 2LGYA 3H6NA 5JZEB 4IWPA 2CHXA 3VUYA 2KLCA 4TUUA 1UBIA 4DBGA 1V5OA 2ZPNA 1GNUA 3OJ4B 1WZ3A 3ZNGC 2MRPA 2G3QB 3DCGA 5L83A 3MJWA 3VTVA 2IYDB 4HJKA 4WWPA 4F8CB 3DVGX 2LRUA 3ECIA 1ZKHA 4IM0A 2ZVNA 5D2MB 3R7QA 2KX3A 4EFOA 3PGEA 3DVNU 4KDLB 3WAMA 4W9IA 4K7SA 2LASA 2DZIA 3QCAA 3DOWA 4K7WA 4E3CA 4TQ1A 4ZDVA 4A3OA 4IG7B 4EZLA 2ZZPB 2C7NB 3B08A 1OQYA 4HDQA 3DBSA 4W9CA 3TL5A 3L10B 4PS7A 3TMPB 4MM3A 3PRMB 4LDTB 3ZVVA 3PSEB 3W1YA 4KIKB 4K7UA 3U30A 5LLIA 2BKRB 4K1RB 2XBBC 1WXAA 2KJ6A 2WWZA 1J0GA 4JL9A 5E6NA 2N4FA 4WJQA 3JSVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L76 A;  4IM2 A;  3K9P B;  4G11 A;  1LQB A;  2J0J A;  3AI5 A;  1OEY A;  3KH0 A;  1E8W A;  3H7P A;  1WGY A;  3SU8 X;  4FJY A;  2ASQ A;  2EMS A;  1UH6 A;  2KK8 A;  1WF9 A;  3DQV A;  1IP9 A;  2N7E A;  3AU4 A;  2A4Z A;  2Z59 B;  2JRI B;  1G6J A;  1WJ6 A;  2FCN A;  4W9K A;  2IO2 B;  2KKC A;  4YL8 A;  4AP4 C;  3V6C B;  2M17 A;  3RYT A;  4FAD A;  1SIF A;  1E8Y A;  1WGR A;  2FCQ A;  3ZNI D;  2DZJ A;  2C9W B;  3MHS D;  4EOY A;  4URK A;  4CHK A;  1H4R A;  2KFK B;  2N9E B;  3QJZ A;  1P1A A;  2GBN A;  3A9J A;  4MSQ B;  1L7Y A;  3QAR A;  2KDE B;  3UIN B;  4NJ6 A;  4PS8 A;  2GOW A;  3UF8 A;  2G4D B;  2Z0D B;  3IVF A;  5DPS A;  2M1M A;  2KTR A;  5D6J B;  3UIP B;  4II3 B;  3CST A;  2KWC A;  1A5R A;  1E7U A;  4NAW A;  1KLV A;  2LI5 A;  3NHE B;  2CR5 A;  3ZDM C;  3D32 A;  1WM3 A;  3DPD A;  2KFJ A;  3WAO A;  1V81 A;  3A9K B;  3IG3 A;  4KSK C;  2DX5 B;  5G2N A;  5KHO A;  2KXJ A;  3WAN A;  3L08 A;  3VH4 B;  3M63 B;  2EMT A;  4ICU A;  3N30 A;  2G4S A;  2KWV B;  2AWT A;  4MEM A;  4NNJ B;  5D94 A;  2KJH B;  2NR2 A;  3C0R B;  3EHV A;  4JLC A;  3PT2 B;  1WJN A;  1SGH A;  1WI0 A;  2LRW A;  3RCZ A;  4FBJ B;  1GG3 A;  2KJR A;  1C1Y B;  2D10 A;  2KHW B;  4JQW C;  4ZYN A;  3ZUN A;  2GBR A;  2NBU A;  4E71 A;  2XK5 B;  3QA8 A;  3VVW B;  3PHX B;  2DHZ A;  2LUE A;  2MBB B;  2NS5 A;  4W9F A;  3NY5 A;  4PYU A;  3ZRC A;  2N9X A;  1Q0W B;  4W9D A;  4NJ7 A;  3UQB A;  2LD9 A;  3VAW A;  3CSF A;  3NZS A;  2ZCB A;  1UGM A;  2KQS A;  4B9K A;  5C1Z A;  2ZEQ A;  4GB9 A;  1E90 A;  3ENE A;  1P0R A;  4GDL A;  1E5W A;  4JGH B;  2KO3 A;  2BF8 B;  1ISN A;  2K8H A;  3HK0 A;  3VUW A;  2C60 A;  3RT3 B;  2UWQ A;  2N1V A;  2DZK A;  4F7Z A;  1YX6 B;  3ALB A;  4KIK A;  5AZH A;  5AEK B;  4BBN F;  1V5T A;  2L00 B;  5TR5 A;  3HM6 X;  4ANW A;  2DEN B;  2XEW A;  4B95 A;  3ZW3 A;  2DYB A;  2DYM A;  4WWN A;  3JSV A;  1PQS A;  4LDT D;  4P7I A;  3PS6 A;  1BT0 A;  2AYO B;  2FID A;  3LDZ E;  1WJ4 A;  2K6D B;  3BY4 B;  3JW0 X;  3ZNZ B;  3L13 A;  1WRD B;  2CU1 A;  4W9J A;  3V6E B;  2K8C A;  4ANV A;  2DAF A;  1XD3 B;  1WFY A;  2PE9 A;  1QZE A;  4HPM B;  2LVQ A;  2BWE S;  1AAR A;  3PV1 A;  2C7M B;  3M95 A;  3N32 A;  3SDL C;  3UIO B;  1NDD A;  4DDG D;  1Q5W B;  2NBV B;  3PVL A;  1WXS A;  2V1Y A;  4GOC A;  2ZCC A;  3M62 B;  4FHK A;  4MGI E;  1WIA A;  4MGZ E;  4GDL B;  1WYW B;  2KD0 A;  2J0M A;  3HIZ A;  3RZF A;  2C7H A;  1FXT B;  2KFK A;  3QIJ A;  4GIV A;  2G45 B;  1I35 A;  1LFD A;  2PE6 B;  4I6L B;  2MW5 A;  3APD A;  3AUL A;  1Q1O A;  2JZ3 B;  1TGZ B;  2MLB A;  5LXI B;  2NVU I;  5DPR A;  2KWU B;  4NQK E;  1RFA A;  2DAJ A;  3U7D A;  2K1F A;  4CYE A;  2IO1 B;  1P98 A;  4ZRI A;  2GBJ A;  5JHB A;  4IW0 A;  2GMI C;  3A9K A;  1E8X A;  3CF6 E;  4A3P A;  1X1M A;  3VDZ A;  3VUX A;  5G55 A;  2MBO A;  2L05 A;  3KVF B;  4I6N B;  3PRP B;  3H7S A;  1GC6 A;  1R4N I;  3DBH I;  3GOE A;  3WAL A;  4DHZ B;  1WE6 A;  4HVB A;  1VD2 A;  3IBE A;  2IY0 B;  2NCN A;  3TCA A;  3ONS A;  3ZKJ C;  4DHJ D;  1WMH B;  3VTU A;  3A1Q B;  4FN2 A;  2DYO A;  2XK5 A;  3QQ8 B;  3LJ3 A;  5DPT A;  4B6W A;  1SE9 A;  1ZW7 A;  2AL3 A;  4IWQ A;  4GGQ A;  4IUM B;  1XT9 B;  1WGG A;  2KDF B;  4MSM B;  5E6P A;  2FIF A;  4MJS B;  3ZRF A;  3SHQ A;  3S2A A;  1C3T A;  2WX1 A;  1Z5S B;  2PEA A;  4BKG A;  2O6V D;  2V4L A;  3VH3 B;  1S3S G;  2KQ7 A;  2CHW A;  3DBR I;  3A4R A;  3JVZ X;  3Q3J A;  2W9N A;  1GJZ A;  3EEC A;  2IY1 B;  1WXM A;  5JH5 C;  3ML9 A;  2HE7 A;  1WGH A;  2MP2 B;  1D3Z A;  4KSL C;  1WE7 A;  2OOB B;  3A33 B;  1R4M I;  1KM7 A;  1WGD A;  3GZN I;  2N1W A;  2ZNV C;  4W9E A;  4DHJ B;  2Y5B B;  1WR6 E;  4BBN C;  1EO6 A;  1Y8R C;  2ZPY A;  1L2N A;  1E8Z A;  2R2O A;  4KVG B;  2IBI B;  1V49 A;  3V60 A;  4M8N A;  1IYF A;  4A20 A;  3ZNH B;  2V3S A;  2FNJ B;  4WWO A;  2C5L C;  3K9O B;  2K6Q A;  3QC8 B;  3VXW A;  3EC8 A;  5E6O A;  2NPT B;  4WAA A;  2I1J A;  3APF A;  4HPL B;  1RLF A;  4WJP A;  2O6V B;  4MEL A;  2VRR B;  4MH0 E;  3VQI A;  2KOX A;  3RUL A;  1KOT A;  4J6I A;  1I42 A;  2LWP A;  3U8Z A;  2GBM A;  2KC2 A;  4AJW A;  3NZU A;  3ML8 A;  4ZRK A;  4WQO B;  2MWS B;  2B3A A;  5C23 A;  1GUA B;  4BOZ B;  4XC2 A;  2CHZ A;  2IZV B;  4KZ0 A;  1MG8 A;  5EDS A;  4KDI C;  3A4S C;  4NPN A;  4ZRJ A;  2KVR A;  3X23 A;  1TBE A;  4CO7 A;  5J2R A;  2MX2 A;  2L8J A;  1VCB A;  1U4A A;  2OJR A;  2LVP A;  5D7G A;  4FJZ A;  2JF5 A;  2M0X A;  3M3J A;  4RMA A;  2M4N A;  4GMV A;  5KHQ A;  4PS3 A;  4DDI D;  1V6E A;  5J18 A;  4PYZ A;  1OEY J;  3V62 A;  2K8B A;  4TKN A;  4ANU A;  4LJO B;  2MBE A;  4MGK E;  3PRE A;  5LXH A;  1CMX B;  4FJV B;  2LGD A;  2LGX A;  2K25 A;  5L95 C;  4G50 A;  1NBF C;  4HXD A;  1WX9 A;  1F9J A;  2JRH A;  4W9L A;  1T0Y A;  1TZ1 A;  4LCD E;  3JYU A;  1WMH A;  4ANX A;  1WZ0 A;  3A1Q A;  4FHJ A;  2KAN A;  2RR9 A;  3RZW C;  4RM9 A;  3KYC D;  1KJT A;  3PLV A;  1UZX B;  2D07 B;  3VFK A;  2MCN B;  3P2B A;  4X57 B;  4EZK A;  2MQJ A;  4MJS A;  4NY0 A;  3W1S C;  2UYZ B;  4FLH A;  1LXD A;  3ZLZ A;  4GU2 A;  4TV3 A;  2KC1 A;  1V2Y A;  5BO4 B;  4DWF A;  3T8M A;  3DBL I;  1Z2M A;  2D2Q A;  5CTR C;  3DVG Y;  1V9J A;  4MGY E;  4ICV A;  4GDK B;  1WX7 A;  1WXV A;  3L16 A;  3Q3F A;  3SD5 A;  5CX3 A;  1J19 A;  2KDB A;  2IO3 B;  1WX8 A;  3OJ3 A;  2BYV E;  2KMC A;  2KTF A;  4AUQ C;  2MP2 A;  3R3M A;  3QK0 A;  3ZTC A;  4TQ0 A;  5J17 A;  2Z0E B;  3R66 C;  1ZGU B;  1EF1 A;  4WJN A;  5CHV C;  2A5U A;  5FR6 A;  1TTN A;  2MBH A;  3PRZ A;  4W9G A;  3H9D A;  1P3Q U;  1XQQ A;  4DHZ E;  2JY6 A;  5CHF A;  4HDO A;  3AU5 A;  4BVU C;  4HLE A;  2D11 A;  2AL6 A;  4DXA B;  4E74 A;  2NPT A;  3KW5 B;  4EUT A;  3ZDT A;  4BKS A;  4WJO A;  3X0W A;  2O6V A;  1YD8 U;  2CS4 A;  3QX1 A;  3EFU A;  2L7R A;  4XX5 A;  2LVO A;  3OLM D;  2N9P C;  4LJP B;  1RRB A;  3H1U A;  5HKH A;  2RPQ A;  2J0K A;  1EF5 A;  2ZNV B;  3R7R A;  5GMV A;  2JZZ A;  4BKS D;  2MA9 B;  3T9L A;  4OVV A;  4M0W B;  1H8C A;  3OAW A;  2LZ6 A;  3QAQ A;  4BKT A;  2FAZ A;  3KUC B;  2O2V A;  2MSE D;  3KUZ A;  3WAP A;  2BPS A;  2L0F A;  5IA7 A;  2REX A;  4KZC A;  4HCP B;  2KLG A;  4AWJ A;  3I3T B;  2BKF A;  2JT4 B;  4FUL A;  1UBQ A;  4BOS C;  2QHO A;  1J8C A;  3VHT C;  5AZF A;  1V86 A;  2KN5 A;  2LJ5 A;  2BWF A;  1M94 A;  2JVC A;  4G3X B;  4HK2 A;  4KV2 A;  3B1L X;  4RM8 A;  2L0T A;  3VTW A;  3W1S A;  4I6P A;  2N7D A;  1OTR B;  3B0A A;  4EZJ A;  1WJU A;  2RD0 A;  2FUH B;  3RUI B;  2LXC A;  2YVC A;  5IAA C;  1NI2 A;  3APC A;  3TJP A;  2I1K A;  2BYF A;  1WR1 A;  4IC7 B;  2PPH A;  3V61 A;  4EKU A;  5DPW A;  4M8M A;  2K39 A;  2AEH A;  2JUO A;  2PJH A;  2IO0 B;  3L54 A;  2MBQ A;  4DK5 A;  3PTF C;  1WM2 A;  2WX0 A;  1YIW A;  2FCM A;  1K8R B;  4G0N B;  4XZ4 A;  2KX0 A;  2BYE A;  4II2 B;  3ZO5 B;  4AOF A;  2HJ8 A;  3IHP C;  2CKH B;  3MTN B;  4W9H A;  5JHA A;  1UEL A;  2O2V B;  4HWI B;  1S1Q B;  3H7P B;  2J7Q B;  2GBK A;  4F1S A;  1LM8 B;  2L3Z A;  4GDK A;  4GN1 A;  2WDT B;  4BFR A;  2WYQ A;  2ZVO A;  2DZM A;  4K81 A;  2RSU A;  3BIN A;  2KMA A;  3HM3 A;  2JPH A;  4OVU A;  4NQL B;  2BGF A;  4EEW A;  2JXX A;  1HE8 A;  3O65 B;  4MDK E;  3UQA A;  4GSW A;  3HHM A;  2EKE C;  3PPA A;  4N9F 4;  5CHW A;  4AJY B;  1WH3 A;  1IPG A;  3ZTD A;  1UD7 A;  3PZD A;  5DCN A;  3CMM B;  2NBW B;  2FCS A;  3NS8 A;  3RD2 A;  3DDC B;  1GC7 A;  2ZJD A;  3DVN V;  2HD5 B;  4FA6 A;  1EUV B;  2M8S A;  2RGF A;  3A9J B;  3QWZ B;  2D3G A;  1OGW A;  2KDI A;  3L17 A;  3WIM A;  4JIO U;  3UGB B;  3PHW B;  4GXB A;  1YX5 B;  2KTR B;  1E7V A;  1YJ1 A;  3L0W B;  3ZIM A;  1YQB A;  3KUD B;  3QHT A;  3AXC A;  3PLU A;  4NAW B;  2LXA A;  3TBL D;  3IFW B;  2KNB A;  2JWZ A;  1P9D U;  1V80 A;  2HTH A;  4IM3 A;  3N3K B;  1RAX A;  4HCN B;  3WA0 A;  3TIX A;  4ASW C;  2R2Q A;  1WY8 A;  5AZG A;  1JRU A;  2KZR A;  3KYD D;  2YLM A;  3NOB A;  4IWO A;  2LGY A;  3H6N A;  5JZE B;  4IWP A;  2CHX A;  3VUY A;  2KLC A;  4TUU A;  1UBI A;  4DBG A;  1V5O A;  2ZPN A;  1GNU A;  3OJ4 B;  1WZ3 A;  3ZNG C;  2MRP A;  2G3Q B;  3DCG A;  5L83 A;  3MJW A;  3VTV A;  2IYD B;  4HJK A;  4WWP A;  4F8C B;  3DVG X;  2LRU A;  3ECI A;  1ZKH A;  4IM0 A;  2ZVN A;  5D2M B;  3R7Q A;  2KX3 A;  4EFO A;  3PGE A;  3DVN U;  4KDL B;  3WAM A;  4W9I A;  4K7S A;  2LAS A;  2DZI A;  3QCA A;  3DOW A;  4K7W A;  4E3C A;  4TQ1 A;  4ZDV A;  4A3O A;  4IG7 B;  4EZL A;  2ZZP B;  2C7N B;  3B08 A;  1OQY A;  4HDQ A;  3DBS A;  4W9C A;  3TL5 A;  3L10 B;  4PS7 A;  3TMP B;  4MM3 A;  3PRM B;  4LDT B;  3ZVV A;  3PSE B;  3W1Y A;  4KIK B;  4K7U A;  3U30 A;  5LLI A;  2BKR B;  4K1R B;  2XBB C;  1WXA A;  2KJ6 A;  2WWZ A;  1J0G A;  4JL9 A;  5E6N A;  2N4F A;  4WJQ A;  3JSV B; 
#chains in the Genus database with same CATH topology
 2B76 B;  3BII D;  4IM2 A;  4G11 A;  2MEK A;  1FRR A;  2EMS A;  1UH6 A;  3DQV A;  2JRI B;  4NAM A;  4W9K A;  2KKC A;  3U4E G;  3GE3 C;  2VH1 A;  2M17 A;  3RYT A;  3Q8C A;  4URK A;  1H4R A;  1CQV A;  1P1A A;  3A9J A;  4MSQ B;  1UUP A;  3UIN B;  4NJ6 A;  4PS8 A;  3FAH A;  1N6Z A;  1I4P A;  1ET9 A;  1A5R A;  2X8X X;  3KQ4 A;  2KYW A;  3AEB B;  2KFJ A;  1V81 A;  2PLP A;  4A55 A;  4LK0 M;  2EMT A;  4GLS C;  2NR2 A;  3PT2 B;  1WJN A;  3TEZ A;  3RCZ A;  1C1Y B;  1FFU A;  2BT6 A;  2KHW B;  4ZYN A;  4M00 A;  3QA8 A;  3V05 A;  3VVW B;  2N7J A;  2G1E A;  2LUE A;  3AE4 B;  1SF0 A;  4JWU C;  2D5G A;  3UQB A;  5BYR A;  2KQS A;  1L0V B;  4YSX B;  2ZEQ A;  1C9F A;  1E90 A;  2M19 A;  4GDL A;  4JGH B;  2KO3 A;  2AQ3 B;  1ISN A;  3AEF B;  2UWQ A;  4KIK A;  5AZH A;  5TR5 A;  3ZW3 A;  2DYB A;  1R4M B;  4WWN A;  3JSV A;  4LDT D;  1BT0 A;  1WYG A;  2K6D B;  4YSY B;  3ZNZ B;  1K51 A;  2LEK A;  4ANV A;  5FR3 A;  1XCQ L;  2AQ2 B;  2BWE S;  3L4P A;  1T6B X;  4PT5 A;  2WU2 B;  3BYY B;  2BBC A;  4WIP A;  3PVL A;  3P63 A;  4MGI E;  3C19 A;  4MGZ E;  4GDL B;  1WYW B;  3HIZ A;  3HUI A;  2PE6 B;  1XF5 L;  3GB1 A;  3AUL A;  3RNG C;  2WQY B;  2NVU I;  2JX5 A;  4NQK E;  1RFA A;  1Y56 A;  4XWW A;  2IO1 B;  5JXV A;  3A9K A;  1E8X A;  2YEP B;  3CF6 E;  2XNA C;  3PZ8 A;  3VUX A;  2L05 A;  3H7S A;  1GC6 A;  3WAL A;  1WE6 A;  3TCA A;  3Q8E A;  3ZKJ C;  2J42 A;  3VTU A;  3A1Q B;  3NVV A;  2XK5 A;  1T5X D;  4IWQ A;  1WGG A;  2KDF B;  2FIF A;  3SHQ A;  2PEA A;  4HPP A;  4KGS A;  4PK1 A;  5T8I A;  4BKG A;  1LO5 D;  1JW9 D;  1OFF A;  2O6V D;  3VH3 B;  1S3S G;  3DHG C;  3P4R B;  3A4R A;  1L6U A;  2OOB B;  4LNO A;  1KM7 A;  3GZN I;  4W9E A;  4DHJ B;  3TUO A;  1EO6 A;  1MJD A;  1Y8R C;  1QOB A;  1K52 A;  2ZPY A;  1V49 A;  1MI0 A;  4A20 A;  1TT5 B;  2PW9 A;  2FNJ B;  4WWO A;  3K9O B;  1ZUD 2;  1FNU A;  1FCC C;  1IGD A;  3VXW A;  3EC8 A;  5E6O A;  3APF A;  5C2T B;  1RLF A;  3IXS A;  4MH0 E;  2KOX A;  3RUL A;  2KC2 A;  4AJW A;  3NZU A;  2MWS B;  1PFD A;  2B3A A;  4BOZ B;  4KDI C;  3A4S C;  2W54 A;  2QCZ A;  2KVR A;  3X23 A;  3EFC A;  5J2R A;  1TYG B;  1VCB A;  4K3C A;  2LVP A;  5D7G A;  4FJZ A;  2M0X A;  4RMA A;  5KHQ A;  2WXP A;  1V6E A;  4PYZ A;  4TKN A;  2MBE A;  2HTM E;  2BW2 A;  4FJV B;  2JYT A;  1WX9 A;  2JRH A;  1IBX B;  1L5P A;  1TZ1 A;  1WMH A;  3P4S B;  2QC8 A;  1KJT A;  3AB5 A;  1ZP0 B;  4YWG G;  4EZK A;  1N62 A;  1FM0 D;  1LXD A;  2HJ1 A;  2R61 A;  3MJ5 A;  1A70 A;  1SB3 C;  2QJL A;  2PMV A;  1ZE3 D;  3B2F A;  1JWU D;  3L16 A;  1WGK A;  5CX3 A;  2KDB A;  3ZXR A;  2IJ0 A;  4AQ7 A;  2PVO D;  2KTF A;  5J17 A;  2Z0E B;  3R66 C;  1TTN A;  3RNB C;  2MBH A;  3PRZ A;  3H9D A;  1ET6 A;  4DHZ E;  4HDO A;  1TS2 A;  2NPT A;  3PO0 A;  2W55 A;  3ZDT A;  1N60 A;  2O6V A;  2CS4 A;  2L7R A;  5HKH A;  3OLM D;  1RRB A;  1NVI D;  2RPQ A;  4C4V B;  4RFB A;  3B2G A;  3LB8 C;  3E56 A;  5GMV A;  4BKS D;  2VZK D;  3OAW A;  2CJN A;  1F77 A;  1CJE A;  3KUC B;  2PIA A;  3NUH B;  2MJE A;  2BPS A;  3ETR A;  3N20 C;  2JT4 B;  1J8C A;  4DXF A;  1GAQ B;  1JWS D;  1M94 A;  4USA A;  4G3X B;  2L0T A;  4I6P A;  1OTR B;  3I5J C;  3EUB 2;  4C7Y A;  5IKC M;  1WJU A;  3U7Z A;  2I1K A;  4IC7 B;  3UI3 A;  5DPW A;  4MM3 B;  4REZ A;  1TZO A;  3GP7 A;  2G9H D;  2IO0 B;  2MBQ A;  2DWQ A;  4LTU A;  4XZ4 A;  2BYE A;  1I4R A;  2LGS A;  4W9H A;  3MTN B;  5JHA A;  4HWI B;  4JPS A;  2ONQ A;  1WRI A;  4GN1 A;  2WYQ A;  1R4N B;  3DBH B;  4ZHP A;  2RSU A;  3IAM 1;  2KMA A;  4HKQ A;  1EU3 A;  3PPA A;  2YEP F;  3ZTD A;  3RD2 A;  2JXT A;  1GC7 A;  5FK9 C;  4M01 A;  3DVN V;  4YTM B;  2RGF A;  5E6J A;  3QWZ B;  5H8Y E;  3ZJV A;  3WIM A;  3UGB B;  4BZA A;  3DWG C;  1YQB A;  3QHT A;  2LJI A;  2KNB A;  2JWZ A;  1QOG A;  3P42 A;  2HTH A;  4RGT A;  3TIX A;  3AV8 A;  3ZJU A;  2L1A A;  2LGY A;  3H6N A;  2V4I B;  4M0W A;  3VUY A;  2WGS A;  3P1M A;  2WXI A;  3MJW A;  3KLS X;  1TIF A;  4WWP A;  3DVG X;  2RPV A;  3ECI A;  4KX6 B;  4IM0 A;  5D2M B;  2KX3 A;  3DVN U;  4OVZ A;  1T0Q C;  2DZI A;  3TL5 A;  2INC C;  2LHD A;  3AE8 B;  3ZVV A;  1RM6 C;  3PSE B;  5LLI A;  2BKR B;  4K1R B;  1C78 A;  1JAL A;  4WJQ A;  1EU4 A;  4ZHO A;  2W3S A;  3H7P A;  2ASQ A;  2KK8 A;  1IP9 A;  3AU4 A;  2Z59 B;  3SFD B;  3I63 C;  1QT9 A;  2IO2 B;  4YL8 A;  2QIE B;  1D5Z C;  2WXG A;  4UDU C;  1E8Y A;  2BTE A;  1YOV B;  2KVZ A;  1TKE A;  4HRO A;  2KFK B;  3QJZ A;  2GBN A;  2KDE B;  4A9A A;  3IVF A;  2M1M A;  2KTR A;  5D6J B;  1DOX A;  3UIP B;  2KWC A;  1E7U A;  4NAW A;  3D32 A;  1WM3 A;  4KSK C;  2QMT A;  3P4P B;  3VH4 B;  1FXA A;  3N30 A;  2KWV B;  2AWT A;  5D94 A;  1JWM D;  2D10 A;  2GBR A;  4E71 A;  5AUK A;  3PHX B;  4CQN A;  2KMM A;  4HJG E;  2NS5 A;  3RMK C;  3ZRC A;  1Q0W B;  4OZC A;  3VAW A;  2W82 A;  5I4D A;  1P0R A;  5GXG B;  3RT3 B;  2N1V A;  2DZK A;  4F7Z A;  3T3O A;  1RYJ A;  3HM6 X;  4P7I A;  3GZN B;  3N1Z C;  3PS6 A;  2AYO B;  2FID A;  3LDZ E;  2WS3 B;  3JW0 X;  1XXG A;  2CU1 A;  4W9J A;  2IGD A;  1XD3 B;  2PE9 A;  1AAR A;  4AS1 A;  3PV1 A;  2C7M B;  3AE2 B;  3M95 A;  3N32 A;  4XYC A;  4FXC A;  3IAS 1;  2NBV B;  2K5P A;  1WXS A;  1HA5 A;  3ZGZ A;  2V1Y A;  1E10 A;  2H89 B;  3FIL B;  4M02 A;  1EWC A;  3RN9 C;  3RZF A;  2C7H A;  3QIJ A;  4GIV A;  2G45 B;  1I35 A;  4I6L B;  3VRA B;  1V8C A;  2JZ3 B;  2N9L A;  1TGZ B;  5DPR A;  2LHE A;  2K1F A;  4CYE A;  4OHJ A;  1C79 A;  2MJ3 A;  2K3U A;  2GMI C;  4A3P A;  3R8B A;  1X1M A;  1UGJ A;  5G55 A;  2MBO A;  4I6N B;  1R4N I;  3DBH I;  3VR8 B;  2IY0 B;  2NCN A;  3ONS A;  4DHJ D;  2DYO A;  1JWB D;  4IUM B;  5E6P A;  2D3C A;  3ZRF A;  1E9M A;  4MJS B;  5EE9 A;  1KH0 A;  1SXT A;  2WX1 A;  4P1C C;  3Q8A A;  2FUG 1;  3JVZ X;  2W9N A;  2L83 A;  3EEC A;  1WXM A;  2HE7 A;  2MP2 B;  4RF0 A;  2BVC A;  1ZPS A;  3NJT A;  1YNT E;  3RI7 C;  4IDI A;  2Y5B B;  1WR6 E;  4BBN C;  4C56 C;  2BS4 B;  3PZ7 A;  3RFZ B;  2R2O A;  1L2N A;  3V60 A;  2IDY A;  2V3S A;  2WU5 B;  1HQR D;  4HPL B;  1FNW A;  2VRR B;  1KLU D;  3AEE B;  4XWT A;  1GUA B;  2ZW0 A;  2BB5 A;  4KZ0 A;  1MG8 A;  4YXD B;  2LFI A;  1L0X B;  1U4A A;  2OJR A;  2WXN A;  2JF5 A;  4Q2J A;  5J18 A;  3HVD A;  3V62 A;  3TEY A;  5LXH A;  1DGJ A;  2K25 A;  5L95 C;  4G50 A;  1STE A;  4HXD A;  2X38 A;  1XEE A;  4ANX A;  1WZ0 A;  3A1Q A;  2KAN A;  3RZW C;  4RM9 A;  3PLV A;  4X57 B;  2MQJ A;  1MG4 A;  4GU2 A;  5BO4 B;  3T8M A;  4N6E B;  5CTR C;  1V9J A;  4P16 A;  3SD5 A;  2SAK A;  2WLB A;  2BYV E;  1ZDX A;  2KMC A;  4AUQ C;  4TQ0 A;  3QK0 A;  1ZGU B;  2KDM A;  2A5U A;  2E6X A;  3AE6 B;  2EEL A;  1SE3 A;  2N9K A;  1XLQ A;  2JY6 A;  2IGG A;  4BVU C;  1ZOY B;  2INN E;  4WJO A;  3QX1 A;  5HG2 A;  2N9P C;  3AE3 B;  1GPX A;  3AED B;  1EF5 A;  2Z8L A;  1VLB A;  4H2A A;  1KF6 B;  2JZZ A;  5H92 C;  3T9L A;  5EE1 A;  3LXF A;  1F52 A;  4A6Q A;  1H8C A;  1BXT A;  2FAZ A;  1P7F A;  3WAP A;  5IA7 A;  4OZA A;  4AWJ A;  4FUL A;  4YSZ B;  4BOS C;  2QHO A;  3VHT C;  4NJC A;  5AZF A;  3BVG A;  2KT7 A;  2KN5 A;  2LJ5 A;  2JVC A;  4HK2 A;  3B1L X;  1NEN B;  3B0A A;  4LLG M;  4EZJ A;  2RD0 A;  1NEK B;  1ESF A;  3RUI B;  5IAA C;  4DQO C;  3APC A;  2M0A A;  4EKU A;  4LNN A;  1IBX A;  2PJH A;  1Q10 A;  1WWT A;  3L54 A;  4WAF A;  1WM2 A;  3N9Y C;  2KX0 A;  3V3X A;  2HJ8 A;  3IHP C;  2CKH B;  1S1Q B;  3BYT B;  4F1S A;  4BFR A;  4K81 A;  1KFY B;  2DZM A;  1ENF A;  1PYW D;  1C77 A;  4OVU A;  5BMI A;  1CZP A;  1HE8 A;  3MC9 A;  4GSW A;  1NYR A;  4AJY B;  3BK1 A;  1ROE A;  3Q2A C;  1DOY A;  3PZD A;  1HTO A;  2NBW B;  2BQQ A;  2V3N A;  3DDC B;  2HD5 B;  1FRD A;  2KN4 A;  2Y5P A;  2UU7 A;  1E7P B;  1C76 A;  2KDI A;  2QEJ C;  2W3R A;  4GXB A;  1YX5 B;  3L0W B;  3ZIM A;  3KUD B;  2LXA A;  1FFV A;  1PGB A;  1HZ5 A;  2V3P A;  1YN3 A;  4IM3 A;  4C4V A;  4ASW C;  2R2Q A;  2GB1 A;  1JRU A;  1HXY D;  3RNE C;  2LGI A;  3AE9 B;  4IWP A;  2GI9 A;  3ZQ4 A;  3OJ4 B;  1GNU A;  1HTQ A;  3ZNG C;  2G3Q B;  3DCG A;  4KGR A;  4HJK A;  2WXO A;  4F8C B;  2LRU A;  3DHI C;  1NYQ A;  4NZL B;  3Q69 A;  3R7Q A;  1KTK A;  4US8 A;  4KDL B;  3WAM A;  3ZXV A;  2L52 A;  3NS1 A;  4W9I A;  3B9J A;  4K7W A;  3W2D A;  5D3D A;  4ZDV A;  1VRA B;  2C7N B;  4WQM A;  1OQY A;  1BUI C;  4PS7 A;  4MM3 A;  3TMP B;  4LDT B;  2Y5C A;  3BVM A;  3U30 A;  3AEG B;  3RNF C;  2XBB C;  1WXA A;  1J0G A;  4JL9 A;  2N4F A;  4RGO S;  3K9P B;  1OEY A;  1E8W A;  4KKJ A;  4B0E A;  3SU8 X;  3W5V B;  1G6J A;  1M4V A;  3RNA C;  2PVG C;  3V6C B;  4XGA B;  1LGR A;  1SIF A;  1WGR A;  2FCQ A;  3C8Y A;  3NVW A;  2K9X A;  1L7Y A;  3QAR A;  2G4D B;  2Z0D B;  3VR9 B;  4II3 B;  1WXQ A;  3AH7 A;  2LI5 A;  2CR5 A;  3DPD A;  3IG3 A;  2DX5 B;  5KHO A;  5BYQ A;  3WAN A;  1ACC A;  3L08 A;  4MEM A;  2G4S A;  4NNJ B;  3Q3O C;  2KJH B;  3C0R B;  3EHV A;  2ICI A;  5HHD G;  2WDV B;  1SGH A;  2LRW A;  1FO4 A;  3EA6 A;  2KJR A;  1YQ4 B;  3ZUN A;  4JQW C;  2NBU A;  3MC0 B;  3HVZ A;  4ZRP A;  4PYU A;  2MH7 A;  2N9X A;  1QLB B;  4NJ7 A;  2WDR B;  4ZOH C;  3NZS A;  2ZCB A;  2V9H A;  2VH2 A;  4GB9 A;  1XLO A;  3ENE A;  1D6E C;  1MVK A;  1E5W A;  3IT4 B;  1I4X A;  2C60 A;  2N0S B;  3ALB A;  5AEK B;  4BBN F;  2L00 B;  1ZXI A;  4ANW A;  1MFW A;  2DEN B;  2XEW A;  4B95 A;  1PGX A;  3N1X C;  3Q14 C;  2DYM A;  1PQS A;  2PKO A;  1FD6 A;  1FCL A;  3L13 A;  1J7C A;  1WRD B;  2I2Y A;  1OQR A;  2K8C A;  1FMA D;  1WFY A;  4RNA A;  2J52 A;  4J3O D;  2LVQ A;  3SDL C;  3UIO B;  5G5H A;  1I4G A;  1NDD A;  2OJW A;  2K22 A;  1KLV A;  2KFK A;  1JRO A;  1K53 A;  1LFD A;  1Q1O A;  2OED A;  3EGR A;  2I38 A;  2WXF A;  2KWU B;  3U7D A;  2DAJ A;  1P98 A;  2WDQ B;  4ZRI A;  2GBJ A;  5JHB A;  4IW0 A;  2KAC A;  3VDZ A;  1YQ3 B;  4DHZ B;  3GOE A;  1VD2 A;  5BYS A;  1VZ7 A;  1N61 A;  3QQ8 B;  1FXI A;  3LJ3 A;  5DPT A;  1MPE A;  1SE9 A;  1ZW7 A;  2AL3 A;  3VQI A;  1XT9 B;  4MSM B;  1C3T A;  3S2A A;  2SEB D;  1Z5S B;  2WP9 B;  2V4L A;  4ARC A;  1FEH A;  2DBY A;  1GOZ A;  3DBR I;  3Q3J A;  3LYY A;  2IND C;  1GJZ A;  1T0R C;  3ZJT A;  3ML9 A;  4KSL C;  3A33 B;  1BML C;  1WGD A;  2PTL A;  2N1W A;  2ZNV C;  4OW0 A;  2DLB A;  4KVG B;  4IKG A;  2IBI B;  4TSS A;  3ZNH B;  2C5L C;  2EKI A;  3QC8 B;  1HZ6 A;  4WAA A;  4WJP A;  2VZK B;  4MEL A;  4WUR A;  1VZ8 A;  1J7B A;  2WXR A;  2HDE A;  2LWP A;  4ITK A;  1TJE A;  4ZRK A;  3J9C A;  2RDG A;  3RNC C;  4XC2 A;  2CHZ A;  1V1O A;  2IZV B;  4ZRQ A;  5IN7 A;  1QOF A;  3FIL A;  1JWA D;  1TY2 A;  4CO7 A;  3E9S A;  2MX2 A;  2L8J A;  4S17 A;  5AUI A;  3M3J A;  1VJK A;  4GMV A;  4PS3 A;  4DDI D;  1AYF A;  1OEY J;  2GLS A;  1QIL A;  4DXG A;  1QF6 A;  2WHI A;  4O1N A;  3PRE A;  1CMX B;  3T3N A;  2LGX A;  2AQ1 B;  4QAY A;  1NBF C;  4W9L A;  1SE2 A;  3NZ3 A;  4FHJ A;  2RR9 A;  4HKZ E;  3KYC D;  1UZX B;  2D07 B;  4HEA 1;  4KGT A;  2MCN B;  3P2B A;  4MJS A;  4C00 A;  2UYZ B;  3ZLZ A;  4TV3 A;  2KC1 A;  4DWF A;  3DBL I;  1Z2M A;  1L0Y B;  2KAJ A;  1XLP A;  3DVG Y;  4ICV A;  3AE5 B;  4GDK B;  1QOA A;  1WXV A;  4MT5 A;  3Q3F A;  1J19 A;  1DOI A;  2IO3 B;  1WX8 A;  1C4P A;  2MP2 A;  3R3M A;  1C4A A;  3ZTC A;  4ACF A;  1EF1 A;  5CHV C;  1T0S C;  2BS2 B;  3WCQ A;  1UNS A;  5CHF A;  4RF1 A;  5IO9 A;  1FPY A;  2AL6 A;  4E74 A;  5BMG A;  1MHH E;  2LVO A;  3W9C B;  1VZ6 A;  2MJD A;  1L4Z B;  4L2Y A;  1N5W A;  4LNK A;  2ZNV B;  2E3T A;  3R7R A;  2MA9 B;  1F2R I;  4BKT A;  4WWM A;  3O13 A;  4JE3 B;  2O2V A;  2MSE D;  3KUZ A;  2L0F A;  4KZC A;  2KLG A;  1B1Z A;  2JU6 X;  2BWF A;  1XCT L;  4KV2 A;  1MHX A;  2N7D A;  2LXC A;  1FIQ A;  1FNV A;  1WSP A;  1NI2 A;  2LUM A;  3TJP A;  1SEB D;  2BYF A;  2PPH A;  3MC8 A;  3V61 A;  5IOI A;  2JSV X;  2K39 A;  4A8X C;  2AEH A;  5EE0 A;  1JQ4 A;  4DK5 A;  3PTF C;  3AE1 B;  2WX0 A;  4KKI A;  2FCM A;  1K8R B;  1JRP A;  1UF0 A;  2QSD A;  1PDX A;  2BS3 B;  1TS5 A;  1UEL A;  2O2V B;  5HI1 A;  2J7Q B;  3URY A;  3BIN A;  3DHH C;  3HM3 A;  2JPH A;  4EEW A;  2JXX A;  3O65 B;  2BB6 A;  3UQA A;  2EKE C;  1WH3 A;  1IPG A;  3AEC B;  2NMQ A;  5DCN A;  3CMM B;  3NVZ A;  3NS8 A;  4L23 A;  3A9J B;  1OGW A;  3OWE B;  1JCK B;  1P7E A;  3PHW B;  5EE3 A;  1E7V A;  3AM9 A;  4EE2 A;  1YJ1 A;  4XE0 A;  2V0G A;  3AXC A;  3TBL D;  4C80 A;  3IFW B;  2JZP A;  3P4Q B;  1T3Q A;  4B0M A;  2WXM A;  3N3K B;  1RAX A;  4HCN B;  5AZG A;  1WY8 A;  4IOI E;  3KYD D;  2NTS A;  2QIL A;  2YLM A;  3NOB A;  4IWO A;  5JZE B;  4TUU A;  1UBI A;  4DBG A;  1V5O A;  2L32 A;  1N5X A;  1WZ3 A;  2MRP A;  4L1B A;  2JWU A;  3N1Y C;  2ZVN A;  4RGN A;  4K7S A;  2D3B A;  1XO3 A;  3I57 A;  2RDB C;  1L6V A;  2LAS A;  3DOW A;  3R2T A;  3CIR B;  4TQ1 A;  4A3O A;  4IG7 B;  4EZL A;  2IPK D;  2TSS A;  4R3D A;  4W9C A;  2XN9 C;  3L10 B;  1R7S A;  1OQQ A;  3I9V 1;  4K7U A;  4KIK B;  2WWZ A;  3IBE A;  3JSV B;  2L76 A;  2WXJ A;  3VRB B;  1LQB A;  2J0J A;  3AI5 A;  4K3B A;  3U52 E;  1B9R A;  3KH0 A;  1WGY A;  4FJY A;  3NRZ A;  2WXH A;  3KWV A;  1WF9 A;  4LNI A;  2N7E A;  2A4Z A;  1WJ6 A;  4MH8 A;  2FCN A;  3DWM A;  4AP4 C;  1YMH E;  4FAD A;  1YJJ A;  3ZNI D;  2ZW1 A;  2DZJ A;  2C9W B;  3MHS D;  4EOY A;  4CHK A;  2WNM A;  2N9E B;  2GOW A;  3UF8 A;  5DPS A;  2IGH A;  1IUE A;  3CST A;  2BYT A;  1SIJ A;  3NHE B;  3ZDM C;  3WAO A;  3A9K B;  5G2N A;  3FKY A;  2KXJ A;  3M63 B;  4ICU A;  3H8H A;  1PGA A;  4JLC A;  5FKA C;  1ZDV A;  1WI0 A;  1F1H A;  3Q8F A;  4FBJ B;  1GG3 A;  2XK5 B;  2DHZ A;  2MBB B;  4W9F A;  3NY5 A;  4YTN B;  4W9D A;  3Q6B A;  1V1P A;  2LD9 A;  3CSF A;  1UGM A;  4B9K A;  1V97 A;  5C1Z A;  4ZYS A;  3DBR B;  2BF8 B;  3HK0 A;  2K8H A;  3VUW A;  1YJI A;  1YX6 B;  1SBB B;  1VR9 A;  1QQR A;  1V5T A;  1D5M C;  2JQR B;  5C3J B;  1ZXH A;  1QKZ A;  1TKY A;  5MPO A;  1WJ4 A;  3BY4 B;  4MAC A;  3U2S C;  3TEX A;  1TY0 A;  1F2R C;  1RWS A;  1RFK A;  3V6E B;  2DAF A;  3W5U B;  1QZE A;  4HPM B;  3SFE B;  1VDV A;  1V1P B;  3AMZ A;  4WH4 A;  1I4H A;  4DDG D;  1Q5W B;  4GOC A;  2ZCC A;  3M62 B;  4FHK A;  4RCO A;  1WIA A;  2KD0 A;  3NG0 A;  2J0M A;  1AN8 A;  2ON8 A;  1FXT B;  3Q3N C;  2MW5 A;  2WXQ A;  3APD A;  2MLB A;  5LXI B;  1I7H A;  5TSS A;  2CJO A;  3KVF B;  3PRP B;  4HVB A;  4XDD A;  1WMH B;  4FN2 A;  1KRH A;  2FBW B;  3SEB A;  1EWY C;  4B6W A;  4RH6 A;  4GGQ A;  4JX1 C;  3AEA B;  1HEZ E;  1GB4 A;  1SSN A;  3MP9 A;  2KQ7 A;  2CHW A;  3BVZ A;  3DBL B;  2IY1 B;  5JH5 C;  1WGH A;  1D3Z A;  1AWD A;  1WE7 A;  1R4M I;  4D2K A;  4BAX A;  1E8Z A;  1IYF A;  4M8N A;  2K6Q A;  2NPT B;  2I1J A;  2NTT A;  3FC4 A;  3IT6 B;  2O6V B;  3CWI A;  1KOT A;  4J6I A;  3TSS A;  5BMH A;  1I42 A;  3U8Z A;  2GBM A;  3ML8 A;  4WQO B;  5C23 A;  3AE7 B;  1SE4 A;  1SJE D;  5EDS A;  4NPN A;  4ZRJ A;  1TBE A;  4N59 A;  2M4N A;  5HFY A;  4TMA B;  1EM7 A;  3MHZ A;  2K8B A;  4ANU A;  4LJO B;  4MGK E;  2LGD A;  2K0P A;  1J7A A;  4ARI A;  2QDF A;  4XDC A;  2ACZ B;  1F9J A;  1PUT A;  1T0Y A;  4LCD E;  1K50 A;  3JYU A;  4HRS A;  3TEW A;  4A90 A;  3MFG A;  2J4X A;  3NVY A;  4N58 A;  3VFK A;  4NY0 A;  2D3A A;  3W1S C;  1TKG A;  4FLH A;  1V2Y A;  2D2Q A;  5D3I B;  4MGY E;  1WX7 A;  2GRI A;  3OJ3 A;  3AN1 A;  4P1B C;  1I4Q A;  4WJN A;  5FR6 A;  1YN5 A;  4W9G A;  2OHF A;  1P3Q U;  1XQQ A;  3AU5 A;  4HLE A;  2D11 A;  4DXA B;  3KW5 B;  4EUT A;  1TS4 A;  4BKS A;  4RGM A;  3X0W A;  1YD8 U;  3EFU A;  4XX5 A;  4LJP B;  2KWD A;  3H1U A;  2RMM A;  2J0K A;  1SJH D;  4C7Z A;  3RPF C;  4OVV A;  1D5X C;  2AX5 A;  4M0W B;  3QAQ A;  2LZ6 A;  4S0R A;  2Q5W D;  4LNF A;  4YTP B;  1C4C A;  5G5G A;  2DNF A;  2REX A;  2WXK A;  4HCP B;  2RDH A;  3I3T B;  2BKF A;  1UBQ A;  1UWM A;  3R2I A;  1V86 A;  1UWX A;  1XLN A;  1IGC A;  4RM8 A;  3VTW A;  3W1S A;  3BZD B;  2FUH B;  2YVC A;  2LMC A;  1WR1 A;  4M8M A;  1NI3 A;  2JUO A;  4US9 A;  1YIW A;  4G0N B;  1N63 A;  1D4B A;  3KWL A;  4II2 B;  4YT0 B;  3ZO5 B;  4AOF A;  1JML A;  3H7P B;  2GBK A;  1LM8 B;  2L3Z A;  4GDK A;  2WDT B;  3BWU D;  2ZVO A;  4NQL B;  2BGF A;  3BK2 A;  4MDK E;  3HRD D;  3HHM A;  4N9F 4;  5CHW A;  3Q3M C;  3OG5 A;  1F0Z A;  1UD7 A;  2Y3A A;  2FCS A;  2ZJD A;  4FA6 A;  3Q8B A;  1EUV B;  2M8S A;  2D3G A;  3L17 A;  4JIO U;  2KTR B;  1DYQ A;  1E0Z A;  3GE8 C;  2CU3 A;  4NAW B;  3PLU A;  2MHJ A;  1P9D U;  1V80 A;  3WA0 A;  2KZR A;  5LNK 1;  1AW7 A;  3GS2 A;  2CHX A;  2KLC A;  1L4D B;  2ZPN A;  5IP4 D;  5L83 A;  1TS3 A;  3VTV A;  2IYD B;  4OZB A;  1ZKH A;  4EFO A;  2WXL A;  3PGE A;  2FE8 A;  4JWS C;  4P6V F;  2INP E;  1CK1 A;  3QCA A;  2JYE A;  1YN4 A;  4E3C A;  2KQ4 X;  1GB1 A;  2ZZP B;  3B08 A;  4HDQ A;  3ZYY X;  3DBS A;  2J53 A;  3ABV B;  2H88 B;  3PRM B;  3SR6 A;  3W1Y A;  1E6E B;  2M56 B;  2KJ6 A;  5E6N A;  1KLG D; 
#chains in the Genus database with same CATH homology
 2L76 A;  4IM2 A;  3K9P B;  4G11 A;  1LQB A;  2J0J A;  3AI5 A;  1OEY A;  3KH0 A;  1E8W A;  3H7P A;  1WGY A;  3SU8 X;  4FJY A;  2ASQ A;  2EMS A;  1UH6 A;  2KK8 A;  1WF9 A;  3DQV A;  1IP9 A;  2N7E A;  3AU4 A;  2A4Z A;  2Z59 B;  2JRI B;  1G6J A;  1WJ6 A;  2FCN A;  4W9K A;  2IO2 B;  2KKC A;  4YL8 A;  4AP4 C;  3V6C B;  2M17 A;  3RYT A;  4FAD A;  1SIF A;  1E8Y A;  1WGR A;  2FCQ A;  3ZNI D;  2DZJ A;  2C9W B;  3MHS D;  4EOY A;  4URK A;  4CHK A;  1H4R A;  2KFK B;  2N9E B;  3QJZ A;  1P1A A;  2GBN A;  3A9J A;  4MSQ B;  1L7Y A;  3QAR A;  2KDE B;  3UIN B;  4NJ6 A;  4PS8 A;  2GOW A;  3UF8 A;  2G4D B;  2Z0D B;  3IVF A;  5DPS A;  2M1M A;  2KTR A;  5D6J B;  3UIP B;  4II3 B;  3CST A;  2KWC A;  1A5R A;  1E7U A;  4NAW A;  1KLV A;  2LI5 A;  3NHE B;  2CR5 A;  3ZDM C;  3D32 A;  1WM3 A;  3DPD A;  2KFJ A;  3WAO A;  1V81 A;  3A9K B;  3IG3 A;  4KSK C;  2DX5 B;  5G2N A;  5KHO A;  2KXJ A;  3WAN A;  3L08 A;  3VH4 B;  3M63 B;  2EMT A;  4ICU A;  3N30 A;  2G4S A;  2KWV B;  2AWT A;  4MEM A;  4NNJ B;  5D94 A;  2KJH B;  2NR2 A;  3C0R B;  3EHV A;  4JLC A;  3PT2 B;  1WJN A;  1SGH A;  1WI0 A;  2LRW A;  3RCZ A;  4FBJ B;  1GG3 A;  2KJR A;  1C1Y B;  2D10 A;  2KHW B;  4JQW C;  4ZYN A;  3ZUN A;  2GBR A;  2NBU A;  4E71 A;  2XK5 B;  3QA8 A;  3VVW B;  3PHX B;  2DHZ A;  2LUE A;  2MBB B;  2NS5 A;  4W9F A;  3NY5 A;  4PYU A;  3ZRC A;  2N9X A;  1Q0W B;  4W9D A;  4NJ7 A;  3UQB A;  2LD9 A;  3VAW A;  3CSF A;  3NZS A;  2ZCB A;  1UGM A;  2KQS A;  4B9K A;  5C1Z A;  2ZEQ A;  4GB9 A;  1E90 A;  3ENE A;  1P0R A;  4GDL A;  1E5W A;  4JGH B;  2KO3 A;  2BF8 B;  1ISN A;  2K8H A;  3HK0 A;  3VUW A;  2C60 A;  3RT3 B;  2UWQ A;  2N1V A;  2DZK A;  4F7Z A;  1YX6 B;  3ALB A;  4KIK A;  5AZH A;  5AEK B;  4BBN F;  1V5T A;  2L00 B;  5TR5 A;  3HM6 X;  4ANW A;  2DEN B;  2XEW A;  4B95 A;  3ZW3 A;  2DYB A;  2DYM A;  4WWN A;  3JSV A;  1PQS A;  4LDT D;  4P7I A;  3PS6 A;  1BT0 A;  2AYO B;  2FID A;  3LDZ E;  1WJ4 A;  2K6D B;  3BY4 B;  3JW0 X;  3ZNZ B;  3L13 A;  1WRD B;  2CU1 A;  4W9J A;  3V6E B;  2K8C A;  4ANV A;  2DAF A;  1XD3 B;  1WFY A;  2PE9 A;  1QZE A;  4HPM B;  2LVQ A;  2BWE S;  1AAR A;  3PV1 A;  2C7M B;  3M95 A;  3N32 A;  3SDL C;  3UIO B;  1NDD A;  4DDG D;  1Q5W B;  2NBV B;  3PVL A;  1WXS A;  2V1Y A;  4GOC A;  2ZCC A;  3M62 B;  4FHK A;  4MGI E;  1WIA A;  4MGZ E;  4GDL B;  1WYW B;  2KD0 A;  2J0M A;  3HIZ A;  3RZF A;  2C7H A;  1FXT B;  2KFK A;  3QIJ A;  4GIV A;  2G45 B;  1I35 A;  1LFD A;  2PE6 B;  4I6L B;  2MW5 A;  3APD A;  3AUL A;  1Q1O A;  2JZ3 B;  1TGZ B;  2MLB A;  5LXI B;  2NVU I;  5DPR A;  2KWU B;  4NQK E;  1RFA A;  2DAJ A;  3U7D A;  2K1F A;  4CYE A;  2IO1 B;  1P98 A;  4ZRI A;  2GBJ A;  5JHB A;  4IW0 A;  2GMI C;  3A9K A;  1E8X A;  3CF6 E;  4A3P A;  1X1M A;  3VDZ A;  3VUX A;  5G55 A;  2MBO A;  2L05 A;  3KVF B;  4I6N B;  3PRP B;  3H7S A;  1GC6 A;  1R4N I;  3DBH I;  3GOE A;  3WAL A;  4DHZ B;  1WE6 A;  4HVB A;  1VD2 A;  3IBE A;  2IY0 B;  2NCN A;  3TCA A;  3ONS A;  3ZKJ C;  4DHJ D;  1WMH B;  3VTU A;  3A1Q B;  4FN2 A;  2DYO A;  2XK5 A;  3QQ8 B;  3LJ3 A;  5DPT A;  4B6W A;  1SE9 A;  1ZW7 A;  2AL3 A;  4IWQ A;  4GGQ A;  4IUM B;  1XT9 B;  1WGG A;  2KDF B;  4MSM B;  5E6P A;  2FIF A;  4MJS B;  3ZRF A;  3SHQ A;  3S2A A;  1C3T A;  2WX1 A;  1Z5S B;  2PEA A;  4BKG A;  2O6V D;  2V4L A;  3VH3 B;  1S3S G;  2KQ7 A;  2CHW A;  3DBR I;  3A4R A;  3JVZ X;  3Q3J A;  2W9N A;  1GJZ A;  3EEC A;  2IY1 B;  1WXM A;  5JH5 C;  3ML9 A;  2HE7 A;  1WGH A;  2MP2 B;  1D3Z A;  4KSL C;  1WE7 A;  2OOB B;  3A33 B;  1R4M I;  1KM7 A;  1WGD A;  3GZN I;  2N1W A;  2ZNV C;  4W9E A;  4DHJ B;  2Y5B B;  1WR6 E;  4BBN C;  1EO6 A;  1Y8R C;  2ZPY A;  1L2N A;  1E8Z A;  2R2O A;  4KVG B;  2IBI B;  1V49 A;  3V60 A;  4M8N A;  1IYF A;  4A20 A;  3ZNH B;  2V3S A;  2FNJ B;  4WWO A;  2C5L C;  3K9O B;  2K6Q A;  3QC8 B;  3VXW A;  3EC8 A;  5E6O A;  2NPT B;  4WAA A;  2I1J A;  3APF A;  4HPL B;  1RLF A;  4WJP A;  2O6V B;  4MEL A;  2VRR B;  4MH0 E;  3VQI A;  2KOX A;  3RUL A;  1KOT A;  4J6I A;  1I42 A;  2LWP A;  3U8Z A;  2GBM A;  2KC2 A;  4AJW A;  3NZU A;  3ML8 A;  4ZRK A;  4WQO B;  2MWS B;  2B3A A;  5C23 A;  1GUA B;  4BOZ B;  4XC2 A;  2CHZ A;  2IZV B;  4KZ0 A;  1MG8 A;  5EDS A;  4KDI C;  3A4S C;  4NPN A;  4ZRJ A;  2KVR A;  3X23 A;  1TBE A;  4CO7 A;  5J2R A;  2MX2 A;  2L8J A;  1VCB A;  1U4A A;  2OJR A;  2LVP A;  5D7G A;  4FJZ A;  2JF5 A;  2M0X A;  3M3J A;  4RMA A;  2M4N A;  4GMV A;  5KHQ A;  4PS3 A;  4DDI D;  1V6E A;  5J18 A;  4PYZ A;  1OEY J;  3V62 A;  2K8B A;  4TKN A;  4ANU A;  4LJO B;  2MBE A;  4MGK E;  3PRE A;  5LXH A;  1CMX B;  4FJV B;  2LGD A;  2LGX A;  2K25 A;  5L95 C;  4G50 A;  1NBF C;  4HXD A;  1WX9 A;  1F9J A;  2JRH A;  4W9L A;  1T0Y A;  1TZ1 A;  4LCD E;  3JYU A;  1WMH A;  4ANX A;  1WZ0 A;  3A1Q A;  4FHJ A;  2KAN A;  2RR9 A;  3RZW C;  4RM9 A;  3KYC D;  1KJT A;  3PLV A;  1UZX B;  2D07 B;  3VFK A;  2MCN B;  3P2B A;  4X57 B;  4EZK A;  2MQJ A;  4MJS A;  4NY0 A;  3W1S C;  2UYZ B;  4FLH A;  1LXD A;  3ZLZ A;  4GU2 A;  4TV3 A;  2KC1 A;  1V2Y A;  5BO4 B;  4DWF A;  3T8M A;  3DBL I;  1Z2M A;  2D2Q A;  5CTR C;  3DVG Y;  1V9J A;  4MGY E;  4ICV A;  4GDK B;  1WX7 A;  1WXV A;  3L16 A;  3Q3F A;  3SD5 A;  5CX3 A;  1J19 A;  2KDB A;  2IO3 B;  1WX8 A;  3OJ3 A;  2BYV E;  2KMC A;  2KTF A;  4AUQ C;  2MP2 A;  3R3M A;  3QK0 A;  3ZTC A;  4TQ0 A;  5J17 A;  2Z0E B;  3R66 C;  1ZGU B;  1EF1 A;  4WJN A;  5CHV C;  2A5U A;  5FR6 A;  1TTN A;  2MBH A;  3PRZ A;  4W9G A;  3H9D A;  1P3Q U;  1XQQ A;  4DHZ E;  2JY6 A;  5CHF A;  4HDO A;  3AU5 A;  4BVU C;  4HLE A;  2D11 A;  2AL6 A;  4DXA B;  4E74 A;  2NPT A;  3KW5 B;  4EUT A;  3ZDT A;  4BKS A;  4WJO A;  3X0W A;  2O6V A;  1YD8 U;  2CS4 A;  3QX1 A;  3EFU A;  2L7R A;  4XX5 A;  2LVO A;  3OLM D;  2N9P C;  4LJP B;  1RRB A;  3H1U A;  5HKH A;  2RPQ A;  2J0K A;  1EF5 A;  2ZNV B;  3R7R A;  5GMV A;  2JZZ A;  4BKS D;  2MA9 B;  3T9L A;  4OVV A;  4M0W B;  1H8C A;  3OAW A;  2LZ6 A;  3QAQ A;  4BKT A;  2FAZ A;  3KUC B;  2O2V A;  2MSE D;  3KUZ A;  3WAP A;  2BPS A;  2L0F A;  5IA7 A;  2REX A;  4KZC A;  4HCP B;  2KLG A;  4AWJ A;  3I3T B;  2BKF A;  2JT4 B;  4FUL A;  1UBQ A;  4BOS C;  2QHO A;  1J8C A;  3VHT C;  5AZF A;  1V86 A;  2KN5 A;  2LJ5 A;  2BWF A;  1M94 A;  2JVC A;  4G3X B;  4HK2 A;  4KV2 A;  3B1L X;  4RM8 A;  2L0T A;  3VTW A;  3W1S A;  4I6P A;  2N7D A;  1OTR B;  3B0A A;  4EZJ A;  1WJU A;  2RD0 A;  2FUH B;  3RUI B;  2LXC A;  2YVC A;  5IAA C;  1NI2 A;  3APC A;  3TJP A;  2I1K A;  2BYF A;  1WR1 A;  4IC7 B;  2PPH A;  3V61 A;  4EKU A;  5DPW A;  4M8M A;  2K39 A;  2AEH A;  2JUO A;  2PJH A;  2IO0 B;  3L54 A;  2MBQ A;  4DK5 A;  3PTF C;  1WM2 A;  2WX0 A;  1YIW A;  2FCM A;  1K8R B;  4G0N B;  4XZ4 A;  2KX0 A;  2BYE A;  4II2 B;  3ZO5 B;  4AOF A;  2HJ8 A;  3IHP C;  2CKH B;  3MTN B;  4W9H A;  5JHA A;  1UEL A;  2O2V B;  4HWI B;  1S1Q B;  3H7P B;  2J7Q B;  2GBK A;  4F1S A;  1LM8 B;  2L3Z A;  4GDK A;  4GN1 A;  2WDT B;  4BFR A;  2WYQ A;  2ZVO A;  2DZM A;  4K81 A;  2RSU A;  3BIN A;  2KMA A;  3HM3 A;  2JPH A;  4OVU A;  4NQL B;  2BGF A;  4EEW A;  2JXX A;  1HE8 A;  3O65 B;  4MDK E;  3UQA A;  4GSW A;  3HHM A;  2EKE C;  3PPA A;  4N9F 4;  5CHW A;  4AJY B;  1WH3 A;  1IPG A;  3ZTD A;  1UD7 A;  3PZD A;  5DCN A;  3CMM B;  2NBW B;  2FCS A;  3NS8 A;  3RD2 A;  3DDC B;  1GC7 A;  2ZJD A;  3DVN V;  2HD5 B;  4FA6 A;  1EUV B;  2M8S A;  2RGF A;  3A9J B;  3QWZ B;  2D3G A;  1OGW A;  2KDI A;  3L17 A;  3WIM A;  4JIO U;  3UGB B;  3PHW B;  4GXB A;  1YX5 B;  2KTR B;  1E7V A;  1YJ1 A;  3L0W B;  3ZIM A;  1YQB A;  3KUD B;  3QHT A;  3AXC A;  3PLU A;  4NAW B;  2LXA A;  3TBL D;  3IFW B;  2KNB A;  2JWZ A;  1P9D U;  1V80 A;  2HTH A;  4IM3 A;  3N3K B;  1RAX A;  4HCN B;  3WA0 A;  3TIX A;  4ASW C;  2R2Q A;  1WY8 A;  5AZG A;  1JRU A;  2KZR A;  3KYD D;  2YLM A;  3NOB A;  4IWO A;  2LGY A;  3H6N A;  5JZE B;  4IWP A;  2CHX A;  3VUY A;  2KLC A;  4TUU A;  1UBI A;  4DBG A;  1V5O A;  2ZPN A;  1GNU A;  3OJ4 B;  1WZ3 A;  3ZNG C;  2MRP A;  2G3Q B;  3DCG A;  5L83 A;  3MJW A;  3VTV A;  2IYD B;  4HJK A;  4WWP A;  4F8C B;  3DVG X;  2LRU A;  3ECI A;  1ZKH A;  4IM0 A;  2ZVN A;  5D2M B;  3R7Q A;  2KX3 A;  4EFO A;  3PGE A;  3DVN U;  4KDL B;  3WAM A;  4W9I A;  4K7S A;  2LAS A;  2DZI A;  3QCA A;  3DOW A;  4K7W A;  4E3C A;  4TQ1 A;  4ZDV A;  4A3O A;  4IG7 B;  4EZL A;  2ZZP B;  2C7N B;  3B08 A;  1OQY A;  4HDQ A;  3DBS A;  4W9C A;  3TL5 A;  3L10 B;  4PS7 A;  3TMP B;  4MM3 A;  3PRM B;  4LDT B;  3ZVV A;  3PSE B;  3W1Y A;  4KIK B;  4K7U A;  3U30 A;  5LLI A;  2BKR B;  4K1R B;  2XBB C;  1WXA A;  2KJ6 A;  2WWZ A;  1J0G A;  4JL9 A;  5E6N A;  2N4F A;  4WJQ A;  3JSV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...