2MWPA

Solution structure of 53bp1 tandem tudor domains in complex with a p53k382me2 peptide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
molecule tags Transcription/antitumor protein
source organism Homo sapiens
publication title Structural Plasticity of Methyllysine Recognition by the Tandem Tudor Domain of 53BP1.
pubmed doi rcsb
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwpA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2mwpA01
2X4XA 2PQWA 3SD4A 2RHZA 3A5ZB 3NTKA 2IG0A 1YITA 4PLLA 3CPWA 3OMCA 1NPRA 3OW2S 1Q86C 1N8RU 2RHXA 3OS2A 4II1A 5KH6A 3LYIA 2LVMA 4QQDA 4FL6A 5C0MA 3CCMA 3CPFA 1Q82U 3CC4T 3P8HA 3FC3A 1WJRA 2R57A 2OTLA 3G4SA 1BKBA 4X34A 3J7AF 3OYCA 1VQOA 2EFIA 3CCUT 3I55T 2E70A 3MEWA 2OTJA 2E6ZA 3OYIA 2D9TA 1K73U 3BDLA 2EKOA 1VQKA 4N4HA 3G6ET 3OYEA 3CCEA 3EAEA 1VQ8A 3E9FA 3CC7T 2M0OA 3CCRT 2M16A 4Q5WA 3ME9A 3CXCA 2RJCA 3OYYA 1VQMT 2EQJA 3LH0A 2RHYA 4IUTA 2DIQA 2E5QA 1N8RC 2GFAA 3OYAA 1VQNA 1NZ9A 1MHNA 3KBGA 3CPWS 1Q86U 1VQPT 1XTDA 2MWOA 2JNGA 1M1KC 3CC4A 3CCVA 5J39A 2DAQA 2L3RA 3OQ5A 5HY6A 1VQ4A 4C5IA 1N27A 3G6EA 5CIUA 1VQ7T 4E7KA 2RJDA 2RHIA 3CCJT 3OA6A 4IUPA 2RI5A 3ZEHA 1KHCA 2YRVA 4QW2A 1OZ3A 1VQMA 3QKJA 1YJNA 1YJ9A 3H8ZA 4RG2A 3OYLA 2RI3A 1KC8C 4N4GA 5FLXE 2QEXT 3KUFA 1S72T 1RL2A 3LGFA 3CCLA 2QA4T 1JJ2S 1K9MU 3I56A 4PLIA 5A2QE 3CCJA 5FRNA 3L2QA 1EIFA 2KDSA 1VQOT 3MP1A 2LCLA 3FEOA 2E6NA 4IUUA 5KE3A 3DLLA 3DB4A 3LGLA 2MWPA 3PIPA 2EIFA 1M1KU 2L89A 3CCSA 3CMAT 3DLMA 1OI1A 1X6OA 2XK0A 5FRMA 1KC8U 3NTHA 4N4IA 1KHIA 4CRIA 1KQSS 4A4EA 3PMIA 3CCLT 1M90C 1OZ2A 2K3YA 3OYHA 1UEBA 3L2VA 2MI6A 3HKSA 3OMGA 1WGSA 3I55A 2BUDA 4BDYA 1VQ6T 2RO0A 4BD3A 3P8DA 5IAYA 3CD6A 4E7JA 3MO8A 3J80E 2WACA 3G71A 5LL6S 3CMEA 2LCCA 1H3ZA 3MP8A 3OYDA 3M9QA 3CCQT 4TVRA 2HQEA 4QQGA 3S3MA 2EQKA 1KD1U 5D6XA 5KE2A 2LRQA 3LLRA 1VQ5A 3NTIA 3L42A 4BACA 2DIGA 2FHDA 3CXCS 2JUFA 1W2BS 2QQRA 3META 4BE2A 3Q1JA 3ASKA 4C5GA 3OYNA 3P8BB 5FROA 2OTLT 2XDPA 2JVVA 4ZN3A 5C6SA 2X35A 1YIJA 2RJFA 4E7HA 1Q81C 2M1HA 4NS5A 3OYKA 4ZTFA 2OTJT 4QQ6A 3E9GA 2EQUA 2GFUA 1RI0A 3CC2A 1KD1C 3OB9A 3C4SA 1QVGS 2R5MA 1YJ9T 2K3XA 3S3NA 2O4XA 1VQKT 4LD6A 1YJWT 1YHQA 2CKKA 4ZTJA 3OYFA 3CCST 3MEAA 2QEXA 3OW2A 2KVQG 2LTOA 3F70A 3O8VA 4ZN1A 3LX7A 4IKFA 1VQ9A 1SSFA 3L2UA 1Q7YU 2GF7A 2RHUA 3QBYA 3OS1A 3OYBA 1M90U 3CCVT 2O4XB 3H6ZA 1W2BA 1KQSA 3MP6A 4YTLA 4QVZA 1NJIC 3QIIA 1VQ4T 3UWNA 4GY5A 2B8AA 5M9OA 3QJ6A 1XNIA 1VQLA 2LDMA 3CMET 1K73C 1K8AU 3CCQA 4OVAA 3CCET 3S6WA 4HCZA 4A4FA 3CC7A 1YJNT 2L8DA 1VQ9T 1VQ5T 4Z02A 2BKDN 1S72A 3MEVA 1Q81U 2F5KA 3MEUA 5IT9E 1VQNT 3L2RA 5DM7R 3JAME 5D6YA 2HQXA 4BDZA 1K9MC 2EQMA 1YI2A 4C5HA 4B9WA 3CD6T 2R5AA 1WJSA 2QA4A 3PNWC 3TREA 4L59A 1QVFA 4UC4A 4C5EA 3OYGA 1YIJT 2P0KA 1WJQA 2X4WA 1K8AC 3CCRA 2RJEA 4BE0A 1VQ8T 2JTFA 4IURA 1QVGA 1VQLT 3CC2T 1NPPA 2JZ2A 1Q7YC 4A4HA 3OYJA 2NLUA 2LQ8A 5KCOA 3CMAA 1YJWA 4IUVA 1M1GA 1YHQT 2X4YA 4BE1A 3S3OA 1VQPA 3FLGA 3OYMA 3J81E 3DB3A 4PL6A 5IN1A 4EDUA 1YITT 4IUQA 3PFSA 5J26A 4B9XA 3CCMT 1YI2T 1VQ6A 2XHCA 5D6WA 5J3BA 3ER0A 1Q82C 3OS0A 3G4ST 4A4GA 4E7LA 5KCHA 2JOYA 2G3RA 2R58A 2DO3A 4FU6A 3FDRA 1VQ7A 3I56T 3GOXA 3G71T 3UT1A 2VYTA 3CEYA 3CCUA 3OY9A 3PIOA 1IZ6A 3PMTA 1JJ2A 2BIVA 1NJIU 1QVFS 2QQSA 2RI2A 1YBYA 5DLQE 4E7IA 1G5VA 1OYXA 3L2WA
chains in the Genus database with same CATH superfamily
1VOMA 1Z9QA 2E65A 4OMFB 3VS5A 3SD4A 2EWNA 2RHZA 3A5ZB 3NTKA 2IG0A 4Z89A 4J6YA 4PLLA 3U23A 3CPWA 1NPRA 1YJ9Q 1Q86C 1N8RU 5GMKh 3OS2A 5GANd 3LYIA 1VQMQ 1MMGA 4AG1C 4JDSA 1W1FA 1Y07A 4VUBA 3CPFA 1RABB 3JCMe 4NL2A 2I0NA 3M0RA 2R57A 2OTLA 1C0MA 1BKBA 3OYCA 4M78B 3J7AF 1W2BP 4D8KA 2DBKA 1H92A 4CI0C 3X28B 3CCUT 2E70A 2OTJA 2KEAA 3RMSA 2EVRA 2EYQA 3QZ9B 4JPBW 4WF2A 3JB9D 3RNJA 5GAOl 1KQ1A 2XU8A 4PK4A 3ULRB 4CC7A 3OYEA 3EAEA 2EKHA 2XKOC 1VQ8A 2M0OA 3CC7T 4PKCC 3ME9A 3CXCA 1D1AA 2DD5A 5CR2A 1W6XA 2D0NA 5GAMh 2ZCFB 1V76A 1NYFA 4PNOA 4N0AC 2FB7A 1EZZB 1ZA1B 3QDFA 4M7AA 4F17A 4A4KA 4WCIA 4XU0A 2K5IA 4OP0A 2KAFA 3INZA 4FCYA 5GAOq 1KQ2A 4C5IA 2AHJB 4BI3A 3CCSQ 2RJDA 2RHIA 3OA6A 3ZEHA 2VWFA 4F7UA 1SRMA 2XDBA 4XTUA 3HRSA 4M77D 3QKJA 1W70A 2AZSA 2PUOB 2DEQA 3H8ZA 5GAMd 2FZCB 3UA7A 5I2SA 3C12A 1U1SA 3RMQA 1LJOA 2YUNA 1KC8C 2C06A 2AIRB 4N4GA 1N8RR 5KYUB 1F1BB 2WSFE 1S72T 2DTIA 4OMOA 3R6OA 1X6BA 1JJ2S 2FG0A 1X75C 3M56A 3JCMd 1NLPC 2YT6A 1K73R 4DBFA 3CCUQ 2K6DA 2B86A 4M75F 3WVDB 1D3BB 2AKLA 3CCJA 2EGEA 1N9SA 2DXBA 4KGXB 1YI2Q 3SWNC 1QW1A 3JCMP 3MP1A 3TU4K 2E64A 2ZPEB 1LNXA 5KE3A 3QWXX 2K9GA 4ZNXA 1VQ6Q 4DBHA 3PIPA 2EIFA 2F5TX 3EGDB 2LQKA 3CMAT 1M2OA 3G6EQ 1UUEA 1TSFA 5DY9A 3VUZA 4D6WA 1OI1A 2ROLA 2EGCA 3I35A 5I22A 4R0KA 3VYGA 1AHJB 3NTHA 1KHIA 1I81A 4A4EA 4ZGJB 2RPNA 2MI6A 3SDZA 1Q7YR 1YFNA 3JV3A 1VQOQ 3SWNB 2AT1B 3OBYA 3GNGA 3HTRA 4NOYA 2DFUA 2RO0A 4J5YA 3P8DA 3M55A 2IVWA 2VGMA 2PU9B 3I5RA 3CMEA 2LCCA 5IH2A 4RTUA 1QQJA 5LJ3d 3OYDA 3M59A 4OB1B 3M9QA 2VV5A 3EFOA 4TVRA 4HXJA 2HQEA 1ZQ1A 1KD1U 1HYOA 2BZXA 3NTIA 1WHKA 3RKYA 3GNFB 4RTZA 1IHWA 4V2SA 4A63B 1RI9A 3HSBA 2YSQA 1QCOA 4BACA 3O5ZA 1QCFA 1RAGB 3CXCS 3CPWP 3META 2VVKA 1QWFA 4M7AE 2LX7A 3C94A 4JZ3A 4C5GA 2CGHA 3OYNA 2HQHA 3JCMf 2D8JA 2COYA 5GAMj 2OTLT 4M78F 4LD9K 3THKA 2X35A 1YIJA 4E7HA 4KBMB 4RTTA 2J05A 1PC0A 2CT4A 4NS5A 2W10A 4QQ6A 2X51A 2ECZA 3E9GA 1OU9A 1G3YA 2A36A 1V1CA 1ZUYA 2KXDA 2DTHA 3CC2A 4LUEA 4DA4A 1KD1C 1AWWA 5HK3A 3QSUA 2K3XA 2DL3A 3UF4A 4GLMA 4FT4A 3A8HB 4RKUE 4ZGDB 1NYGA 2M02A 2QG9B 1HXDA 2LTOA 2DNUA 2M9UA 1T3LA 2GCXA 3HPWA 1SSFA 3QJYA 5CQXA 3L2UA 5CQYA 4DBQA 3V7RA 2ABLA 2GF7A 5LJ5j 4ELYC 3QG1A 2QDLA 1N9RA 4J9BA 1BI2A 4HCBA 1QVGP 2CP5A 3H6ZA 1Y0MA 1GBQA 1KQSA 2LC4A 4LDVA 3MP6A 5GAMg 5GAMe 3EGUA 2OJ2A 4E7ZA 2H8HA 1D1CA 3CQTA 3QIIA 1FXXA 5LJ3g 1WDXA 2DL7A 2QDYB 2VUBA 1MNEA 1K8AU 1JBMA 5IXBA 2DZCA 3VRZA 4PJLA 3EGDA 4M75E 3V8LA 4Z02A 1M2VA 1YCYA 2QTXA 3V7CA 5CO7A 2DERA 1KC8R 2F5KA 3EHQA 3MEUA 1VQNT 3L2RA 2Z0WA 4FT2A 2BE9B 4M75G 5D6YA 1OPKA 2F2XA 4BDZA 2RQVA 4C5HA 1PM3A 2LT4A 1YI2A 4B9WA 4RTVA 3KXTA 1UGQB 3SWNA 2DLPA 3TREA 1ARKA 1IGQA 4LNPA 4XQ3A 2NUTA 4JLIA 2NUTB 2VKNA 3QZ5B 3I55Q 1BI1A 2YXYA 2MYSA 3SHWA 1VQLT 3X20B 2HL5C 3GBQA 1NG2A 2CZ0B 2RH2A 2JZ2A 4XU1A 1Q7YC 2BZYA 2NLUA 1OV3A 3I5SA 1UHCA 1FMVA 2JTEA 1M1GA 2ZPBB 2OX7A 4JJCA 2L2PA 3TCJA 1Y96B 2E1HA 2JT4A 5A0GA 4EDUA 5J26A 4B9XA 3E19A 3OW2P 5KYWB 1UE9A 1YI2T 1VQ6A 2YUPA 1Q82C 2HCKA 4DEYA 1AWXA 3PTAA 2A37A 1TUGB 2R58A 1ZSZB 4FU6A 3CMAQ 2AZVA 3GOXA 3CCJQ 1MNDA 2VYTA 4OGEA 2FO0A 1WHJA 1IZ6A 4BB7A 2QQSA 2RI2A 1Q95G 1QVFS 1H3HA 2HNIA 4E7IA 2DVEA 3L2WA 2FZGB 5GAN4 2COZA 1Q86R 5CKFA 4BI8B 2DL4A 1XQHA 2GBQA 4M78G 2JM9A 3EGXA 4C92F 1PRLC 3OW2S 1TXQA 3TSWA 2V8IA 5CKHA 2LVMA 4QQDA 5I2MA 3P8HA 1WJRA 2ED0A 3GP8A 3H0HA 2QGGA 1VUBA 4X34A 1X2KA 1UGPB 4AT1B 4HKEA 4JJBA 3MEWA 4JS4A 3A8LB 5LJ5e 2D9TA 1K73U 3FIFA 3BDLA 2SRCA 4RCCA 4ZGEB 4PJOG 1VQLQ 1VQKA 4HT9A 1DJ7B 4N4HA 4HVUA 3JCMb 2PTKA 4AMCA 2BZ8A 1Z9ZA 2M16A 2RJCA 3OYYA 3EG0A 5I21A 1ABQA 4IUTA 2GFAA 4C8QF 1VQNA 1FMKA 4QVCA 4J8OA 1UDLA 2O31A 2WSEE 4AFQC 2XD0A 4J9EA 1Q86U 4MMKA 2HDAA 1XTDA 3H0FA 4JUVA 3H41A 3EH2A 3CCEQ 2M51A 1M1KC 2J7IA 3CCVA 1K0SA 1YWOA 1SPKA 2IIMA 2KK4A 1G8XA 2PZ1A 2K79A 2A0FB 1M5Q1 3EH1A 5HY6A 2O9VA 1QMCA 2QQAA 5HCKA 3V8JA 3LWHA 1MUZA 4E7KA 3VYHB 4M77E 4AFUC 2RI5A 1KHCA 4F7UE 4QW2A 2DD4A 4CC4B 1M90R 1I5LA 2E12A 3HFOA 1XJWB 1YJ9A 3A8MB 3OYLA 4M4ZA 2FPFA 2RI3A 1CKAA 1I0CA 1UG1A 1M8VA 5LJ5d 1SSHA 1QP3A 5GMKe 2HZYA 2NUZA 2DXUA 3KUFA 1X69A 1RL2A 3LGFA 2QASA 3PGGA 4MDWA 2L3QA 2C0TA 4A53A 2VGNA 3CBMA 1AZGB 4FM4B 4PLIA 1KG1A 1BCOA 4KRTA 1K4US 1FMWA 3CC4Q 1U5SA 5A2QE 1D09B 5FRNA 3QDRB 1Y57A 2KQWA 2YLCA 3L2QA 1EIFA 4M7DB 1VQOT 8AT1B 4X9DA 4C92D 5L23A 1AVZC 4IUUA 1IHVA 1OOTA 2E41A 3DLLA 3DB4A 3LGLA 2ENMA 2JS2A 2FEIA 3QO3A 1M1KU 2L89A 1D0XA 2DK3A 3CC7Q 2MAMA 1MV3A 2RM4A 1QKWA 3VV0A 2QAZA 3QUIA 4M75C 3PVQA 1OZ2A 3G1JA 3L2VA 2EYXA 1GRIA 1K9AA 1RAEB 1PSEA 3HKSA 1WGSA 1UTIA 1IXDA 3L1AA 5HKCA 1Y7XA 1X27A 4BD3A 3CC2Q 3CD6A 1W4SA 2DX1A 1LVKA 4E7JA 2Y90A 2MF2A 2IPOB 2EJFA 3RERA 2WACA 5LL6S 1PKSA 1H3ZA 1U3OA 1B07A 3MP8A 4HA8A 2LJ3A 2EYYA 2OAWA 1IB8A 5AT1B 2DEUA 1KK7A 2M0YA 1PKTA 3CCQT 3X24B 5KE2A 3MHXA 2LRQA 4MZMA 1X6GA 2KRMA 4OMPA 5IXFA 5GAMf 2JN0A 4XTXA 2C0OA 4OF1A 2GGRA 2VXFA 2YWWA 4BE2A 1TH7A 1NEGA 4OB2B 4J7IA 2JXBA 3DKMA 2P0QA 1M1FA 1JO8A 2KRSA 1QKXA 5FROA 2DXTA 2E10A 4QT7A 2JVVA 3WXMB 2D6FA 4C8QE 2RD1A 3LWIA 2M1HA 4ZTFA 1FYNA 4PJNA 2HD0A 2EQUA 1R77A 2XDDA 4RUGA 4AFZC 4C8QG 4XK8E 1QVGS 1YJ9T 3S3NA 5IHIA 1D3BA 2RK1A 2CKKA 4ZTJA 2KGTA 1TWBA 3VRYA 4Y91A 2MOXA 1VQ7Q 2JJ9A 3MEAA 4M78C 2PVGB 2MCNA 3M53A 3CXCP 2W0ZA 3OSSC 4KH1B 3EG1A 2XIDA 2F1LA 3HRUA 2K3BA 3G4SQ 2P4TA 2RHUA 1SHFA 3OBWA 3OS1A 1MMAA 3OS5A 2VB6A 1OPLA 1U8RA 3HHTB 1H8KA 2O4XB 2K2MA 5D7UA 2QYZA 4QVZA 2V8KA 1NJIC 4KUDK 5GAN5 1AEYA 1VQ4T 3UWNA 2B8AA 3G71Q 3QHSA 1XNIA 1VQLA 2LDMA 2LCSA 3GPLA 2DJZA 1QVFP 3CCQA 4OVAA 2QGFB 5L8RE 3CCET 1YJNT 1PG5B 1SKUB 5KYYB 4C92B 2BKDN 1S72A 5FU6C 3L2ZA 3JB9F 2DF6A 1JB0E 1SEMA 4RCBA 2EQMA 5KYNA 3CD6T 2R5AA 1WJSA 4M75B 2P0PA 2QA4A 2DRKA 4L59A 2V1QA 2X9HA 1BK2A 4M7DF 1MMNA 1WHMA 5LJ5h 1D0ZA 2EBPA 1G3TA 1TTHB 1E7OA 2V26A 4IURA 1G2BA 1QVGA 1ZSZA 1BCMA 4A4HA 3OYJA 5HK0A 5LJ3e 4M77A 1Y71A 3BW1A 3OYMA 1T0JA 1UGSB 3DB3A 1UB4A 2YRDA 1YITT 3PFSA 4DOVA 3OSVA 1NM7A 4OB0B 2LZ6B 4J83A 3E1SA 3ER0A 4PJMA 1GFCA 3OS0A 1ZUKA 5GJWB 4KT0E 4O6JA 5GAOp 2JMAA 2DL8A 4IIMA 5LJ3h 3UPUA 3CCVQ 1SHGA 2KMTA 2K5FA 2KNBB 2QQ9A 3OY9A 1WA7A 2P4RA 3X25B 2DETA 3PIOA 3PMTA 1JJ2A 1NJIU 2A28A 2CUBA 3JB9H 1WXUA 3PT9A 4EMHA 2X4XA 4J9CA 1PSFA 1ZSZC 3BDUA 1WLPB 1RAFB 2O88A 5LJ5f 3OMCA 2RHXA 5CKEA 1VQKQ 2ESWA 2HL3A 4II1A 5KH6A 4AFSC 1KIKA 1K0XA 2KYMA 5C0MA 4PFOA 3HL8A 1M3AA 4R56A 1Q82U 2NWMA 2ED1A 3FRNA 4M78E 3FC3A 3EHRA 3AHUA 1HSQA 3FJPA 3G4SA 2MIOA 1NE8A 2LNHB 1VQOA 2EFIA 3I55T 4Y28E 1AWOA 2E6ZA 1M27C 1WNLA 4L6V5 2FRWA 4EMKB 1ZLMA 2EKOA 3BFMA 5GAOm 2RNAA 3G6ET 3N5BB 4C92G 3CCEA 3RUXA 3E9FA 2CDTA 4Q5WA 3M0UA 3JCMh 2EQJA 2E4HA 4PJOE 4MZTA 2RHYA 2E5QA 1N8RC 3OYAA 4JRPA 3H9NA 1NZ9A 2DYBA 3KBGA 1P92A 2CUDA 2MWOA 4CC2A 3QXEB 2ZPFB 4PJOF 3KFVA 1MGQA 3FJ5A 1YP5A 2KY9A 1ZSGA 3CCRQ 1X43A 2L3SA 2ZAEA 5KYUA 1ZUUA 1VQ4A 5KYWA 2AKKA 1OU8A 4XTWA 5CIUA 4R55A 4IUPA 1ZX6A 4DOWA 3M4YA 1FWZA 2K5LA 5GANh 1IO6A 2A3LA 4LXCA 3WVEB 1VIFA 5A0DA 3MKDA 1YJNA 5CK9A 2D0QB 2VXEA 1AOJA 3MPUB 2COWA 4RG2A 8ATCB 3A8GB 2WSCE 3EFRA 1OX8A 4M77B 4O5VA 2PVOB 1BIAA 1RACB 1OX9A 5FLXE 2QEXT 5IHNA 3NGPA 2BTTA 2C0IA 1UFFA 2KE9A 3M0SA 3VS1A 4M7DG 4JJDA 3GIBA 1K9MU 1WX6A 4P5NA 4M7DD 1RLPC 3C0CA 3JSCA 3JRZA 2XI9A 3EGXB 4ME7A 2J6FA 4MZPA 2NYSA 1BIBA 1AWJA 4PJOD 3ZBDA 5LJ5g 3LH5A 4ANJA 2KDSA 2RQRA 2RK2A 1I4K1 4DQ2A 3VS7A 4J6XA 1LOJA 4XTVA 3PVLA 4PJJA 2CZ1B 2ZGWA 3FB9A 4RTXA 3M0PA 2HSEB 2DILA 3DLMA 2NUPA 3NMZC 5LJ3j 2QA4Q 1BI3A 1PCXA 1UGVA 1X6OA 5GAOn 2KROA 4XU3A 1JXMA 2X3XD 4KH0B 4FYWB 3T9NA 1KC8U 1N6AA 2DTOA 4N4IA 1KQSS 1TUCA 1R0CB 3PMIA 1M90C 2K3YA 2DVJA 3OYHA 1UEBA 1ZBXA 4JS5A 1VYTA 5CVIA 4NL3A 2D8HA 3OMGA 2HMAA 5FWCA 3SB2A 3PE0A 3I55A 2EJGA 2KI7A 1GL5A 5GANg 1GCQA 3M57A 3RR6A 2O01E 3J80E 3R6NA 4MMLA 3G71A 1R8OB 5FU7C 2EGAA 2CREA 3M5AA 4LDYA 1K9MR 2CS7A 1QWEA 1Q82R 4EIKA 3S3MA 2EQKA 5D6XA 3EG2A 2CZ7B 3IQLA 4JZ4A 1VQ5A 4HCCA 2FRYA 2O9SA 3L42A 5CAIA 2GTOA 2X3WD 3VS2A 2KBTA 2DIGA 2FHDA 2DM1A 2P84A 1W2BS 1B34B 3EG9A 3Q1JA 4M77F 3ASKA 3P8BB 2LJ1A 3JCMg 4AG2C 1ABOA 2XDPA 5GANj 1TS9A 4ZN3A 5C6SA 3UATA 2RJFA 1YIJQ 1Q81C 2H3JA 5EC7A 2HKNA 1M3CA 2DZ9A 2DRMA 1K8AR 4XAXB 3OYKA 1R0BG 2H3EB 2JM8A 2KSSA 4JLGA 2DE0X 2L5QA 4KUIA 2X4JA 3C4SA 5KYXB 2R5MA 3JCMQ 4LD6A 1YJWT 4C8QB 2J6OA 2LQNA 1YHQA 1TG0A 2KXCA 4FSXA 3OYFA 3URGA 4M7DA 4C8QA 3CCST 2QEXA 5I11A 3F70A 4RTWA 3VKIA 1WFWA 1WHHA 4ZN1A 3LX7A 4IKFA 1E6GA 2GQIA 1YHQQ 1VQ9A 3V8KA 4Z8AA 1X01A 1Q7YU 3QBYA 3OYBA 2CP2A 4M7AF 4EMKC 9ATCB 3M4GA 7AT1B 1PHTA 1M90U 4KGVB 4LDWA 5CCAA 3VU3C 2QTVA 5GMKj 2E3HA 1SRLA 4F14A 4GY5A 5M9OA 5LJ3f 1MV0B 4N0AA 4OMQA 1I07A 4F04B 5GAN6 1BU1A 1PRMC 3CCQQ 2RMOA 4HCZA 4A4FA 1UHFA 1VQ5T 4CC3A 2YUOA 2YHTA 3MEVA 1HK9A 1Q81U 2GQVA 2V8JA 2A7YA 4M75D 3JCMJ 5IT9E 3A8OB 1RADB 2JW4A 2LNVA 4E2FB 1RAHB 3JAME 3AT1B 1PNJA 3A1PA 3LW5E 2JTMA 3VS0A 1WHGA 3CMEQ 1LPLA 1RAAB 2YUQA 2EAYA 3JCMc 4C5EA 3OYGA 2DXCA 1WJQA 2K57A 2K4YA 2X4WA 1K8AC 3M0TA 1M2VB 2CH4W 2CSIA 4E6RA 4KULA 2LP5A 2KR3A 4BE0A 2O2OA 1YJWQ 3JB9G 2J6KA 2CP7A 1J3TA 4C0GA 1B3QA 1RUWA 5KCOA 1YJWA 2DL5A 3NFCA 4LDUA 1YHQT 3HRTA 4PJOC 3S3OA 1BYMA 1NEBA 3VUBA 3FLGA 4HT8A 5GAN3 3J81E 2EPDA 2LJ0A 5IN1A 4OMNA 4M7DC 2HKQB 4PJOB 4JRKA 1WXBA 5J3BA 3REAB 3G4ST 4A4GA 4E7LA 3NHNA 3TQ7P 2Y4XA 5KCHA 4FW1A 2G3RA 1M30A 2DO3A 1NJIR 1WQWA 2DMOA 3FDRA 3I56T 2MPXC 3G71T 2CP6A 1VYUA 1CKBA 1EFNA 4FYYB 2DPPB 3CCUA 2EJ9A 1TUDA 2BIVA 2ZZDA 3QPHA 4FW2A 2PVDB 5DLQE 1AZEA 3CCMQ 1GCPA 2PQWA 1QVPA 5IHKA 4RG8A 4M77G 2QQBA 1RLQC 4EMKA 4F7UG 2PUKB 1YITA 2CSQA 1VIEA 2AK5A 1PWTA 1B7TA 3ZFJA 2EQIA 3VS6A 4M78D 4FL6A 1TU0B 3CCMA 1AT1B 1WHLA 3SEMA 1NBEB 1VQNQ 3CBOA 1UJYA 2MMPA 3CC4T 3VJPA 1UGRB 4M78A 3G7ZA 5GAN2 1YN8A 1I8FA 4J9GA 4MDXA 2ZPHB 4XTZA 3OYIA 1KSWA 4M7AC 3V7SA 4PFZA 2RA2A 4C0DC 4M75A 1BI0A 3MJXA 3CCRT 1WIEA 1KJWA 1VQMT 1GFDA 1D0YA 4FYXB 2BE7D 4OMLA 4BY6B 3LH0A 2KRNA 2PNIA 3REBB 2DIQA 1I5OB 4C92E 1MHNA 1YWPA 4JJNK 4LDXA 3CPWS 1GBRA 5KYYA 1WPYA 1VQPT 1KQSP 4M7AB 1M4ZA 4J9FA 2RQTA 2JNGA 4HVVA 3CC4A 1YITQ 5CKBA 1GXIE 3QWYA 3I56Q 5J39A 1UECA 5GAN8 2ZPGB 2DAQA 2L3RA 3OQ5A 1M8MA 1N27A 2FZKB 3VS4A 2XMFA 3G6EA 4F7UB 1VQ7T 1I1JA 3CCJT 5GAOr 3BE3A 1K1ZA 1ZHIA 4PFPA 2YRVA 1O9SA 1OZ3A 1SF9A 2RQUA 1PD1A 4F16A 1VQMA 1JRIA 4M77C 2VASA 2DYIA 1GCQC 2RB6A 1ZBJA 1XOVA 4C0DB 4EPCA 2E5KA 3UDCA 3RBBB 2HEQA 4A54A 2EYWA 2OI3A 4GBQA 4K11A 3CCLA 2NUPB 5EG2A 2QA4T 2JMCA 3MCAB 3D7SB 4J9DA 3I56A 3TVTA 2QXFA 2F69A 1TOVA 4M7DE 4C0FA 1CSKA 4J7FA 1YJNQ 1ACMB 2LCLA 1IRXA 3FEOA 2E6NA 5GJVB 2FVUA 1JEGA 2JS0A 2MWPA 5A0LA 1S72Q 1LCKA 4QVDA 3CCSA 2YRCA 1QP2A 2K7AA 3CD6Q 1O75A 2XK0A 2LQWA 2L0AA 4Z88A 1VQPQ 5FRMA 4BUGA 4E47A 4CRIA 3EG3A 5DLOA 1IGUA 3CCLT 4OMMA 5GMKm 1V29B 3VS3A 2LMJA 1RAIB 1VA7A 2QI2A 2RQWA 4FYVB 3RKWA 2FPEA 2FL7A 2LX9A 5FWBA 1KD1R 2BUDA 2DJQA 2I2LA 4BDYA 4C8QC 1VQ6T 5FU6B 1NLOC 3HP9A 5IAYA 4B6MA 1B34A 2CZ6B 3MO8A 1C6VX 4HVWA 2DKGA 1Q81R 2CP3A 3M54A 4IIOA 2CYZB 4OB3B 4C92A 4ELZC 3EFOB 4D8DA 4F7UF 4J9HA 1IREB 3GF5A 2MK5A 4J6WA 1M3BA 1A0NB 1WYXA 2EYZA 2KYBA 4QQGA 1M1KR 3CBPA 4HCKA 1HD3A 2EW3A 2FYKA 4E7SA 3LLRA 5GMKi 2OTJQ 4ESRA 1QLYA 1Y96A 3RESA 5GAN7 2K2VA 3RDVA 1OULA 2KT8A 2XICA 4Y92A 2JUFA 2QQRA 3QYGB 5GANe 3X26B 2L3PA 4QKUA 2QEXQ 3EG9B 2VC8A 2HBWA 3ZL7C 4C0ZA 1G3SA 1OQKA 2ATCB 3JCMW 3JB9J 4RMOA 2HAXA 2KT1A 4L5GA 1S1NA 3RKXA 2OTJT 4C8QD 2GFUA 1PD0A 1RI0A 2CT3A 2RF0A 3OB9A 3E2UA 1D1BA 4JRIA 1UJ0A 2O4XA 4GLKA 1VQKT 1BBZA 4RTYA 1FX7A 4JRQA 1VQ8Q 4XTYA 4LUDA 3TSZA 2G6FX 1HJDA 1T3SA 2CP0A 4DBRA 3OW2A 2KVQG 2A08A 3O8VA 2HSPA 3M58A 4ATOA 1JQQA 4XU2A 1YNZA 2YLBA 1EX4A 1WXTA 3C95A 1WQ7A 3I9QA 1VQ5Q 3EFSA 1JU5C 3CCVT 3JCMX 1G3WA 1X2QA 4J9IA 1W2BA 2LT1A 4YTLA 5FW9A 4LN2A 2GTJA 3QJ6A 1SG5A 6AT1B 3CMET 1K73C 3SFMA 4M7AD 1JXOA 2E3IA 2Y4YA 3GLXA 5ECAA 3S6WA 4M7AG 3CC7A 2L8DA 3QYHB 1VQ9T 2YDLA 2D1XA 4FIBA 2HBPA 1U1TA 2GNCA 1MMDA 2QK0A 5DM7R 4KGZB 2HQXA 1K9MC 3JB9I 2DA9A 3PNWC 1M9SA 1QVFA 3TEEA 4BY6C 1OEBA 2SEMA 1E6HA 4UC4A 4PJOA 1N5ZA 2CH4A 2P0KA 1YIJT 5CKDA 1VQ9Q 4FSSA 3CCRA 2DBMA 4EMGA 2FPDA 2RJEA 1VQ8T 2JTFA 1G83A 2F2VA 4X1VA 1ZA2B 2ROTA 3CC2T 4X9CA 4LE9A 2XG8D 1NPPA 2V1RA 2LQ8A 2F2WA 3CMAA 4IUVA 1JJ2P 2X4YA 1C1AA 4BE1A 1VQPA 3BY7A 3A98A 1KFZA 4PL6A 1WI7A 1K76A 3M0QA 5FU7B 4IUQA 5GANf 2J06A 3CCMT 5AYFA 1U06A 1YCSB 2XHCA 1WZOA 1BB9A 3JCMV 5D6WA 3RIRA 4WTOB 5GMKl 4ORZA 2JOYA 4C92C 1VYVA 1VQ7A 4BI4A 2RN8A 3UT1A 3CEYA 2OAUA 4DEXA 1AD5A 3H0IA 1T0HA 1H641 4OGCA 3NPFA 2OTLQ 1VQ4Q 1YBYA 1G5VA 2ZPIB 3CCLQ 3HFNA 1OYXA 1QCNA 3UA6A 5KYXA
chains in the Genus database with same CATH topology
5GAN4 2X4XA 2PQWA 1QVPA 2E65A 4OMFB 1PSFA 4RG8A 4M77G 2QQBA 3BDUA 5CKFA 2EWNA 2RHZA 3A5ZB 3NTKA 3SD4A 4BI8B 4EMKA 2IG0A 2PUKB 4F7UG 1YITA 4J6YA 5LJ5f 1XQHA 4PLLA 1VIEA 3CPWA 3OMCA 4M78G 1NPRA 4C92F 3ZFJA 3OW2S 1Q86C 1N8RU 2RHXA 5CKEA 4M78D 5GMKh 2V8IA 3OS2A 4II1A 5KH6A 5GANd 3LYIA 2LVMA 4QQDA 5CKHA 5I2MA 4FL6A 5C0MA 4JDSA 3CCMA 1Y07A 4VUBA 3CPFA 3HL8A 3CBOA 4R56A 1Q82U 2MMPA 3JCMe 4NL2A 3FRNA 3VJPA 3CC4T 1UGRB 3P8HA 4M78E 4M78A 3FC3A 1WJRA 3GP8A 3AHUA 3G7ZA 5GAN2 2R57A 2OTLA 1I8FA 1VUBA 3FJPA 3G4SA 1BKBA 4X34A 3OYCA 4M78B 3J7AF 1NE8A 1UGPB 1VQOA 2EFIA 4CI0C 4HKEA 4MDXA 2ZPHB 3X28B 3I55T 2E70A 4Y28E 3MEWA 3CCUT 4JS4A 3A8LB 2E6ZA 4XTZA 3RMSA 2OTJA 1WNLA 2D9TA 5LJ5e 3OYIA 2EYQA 4L6V5 1K73U 3FIFA 3BDLA 4M7AC 4EMKB 4RCCA 3V7SA 3QZ9B 4WF2A 4ZGEB 2EKOA 4PJOG 3JB9D 3BFMA 2RA2A 5GAOm 1VQKA 5GAOl 4HT9A 1KQ1A 2XU8A 1DJ7B 4C0DC 4N4HA 4M75A 3G6ET 3N5BB 3JCMb 4C92G 3OYEA 3EAEA 3RUXA 1BI0A 2XKOC 3CCEA 1VQ8A 2M0OA 3E9FA 3CC7T 3CCRT 2M16A 4Q5WA 4PKCC 3ME9A 3CXCA 2RJCA 3OYYA 2DD5A 1VQMT 5I21A 3JCMh 2EQJA 4PJOE 4BY6B 4MZTA 3LH0A 5CR2A 2RHYA 4IUTA 2DIQA 5GAMh 2E5QA 2GFAA 3OYAA 4C8QF 1N8RC 2ZCFB 1VQNA 4C92E 4JRPA 4PNOA 4QVCA 4J8OA 4N0AC 2FB7A 1NZ9A 1MHNA 3KBGA 2WSEE 4JJNK 4LDXA 3CPWS 2XD0A 1P92A 1WPYA 1Q86U 1VQPT 4MMKA 4M7AB 1XTDA 1M4ZA 2MWOA 4JUVA 2JNGA 3QXEB 1M1KC 2ZPFB 5CKBA 3CC4A 3CCVA 4PJOF 4A4KA 4M7AA 1GXIE 1MGQA 4XU0A 2KY9A 2KK4A 2K5IA 5J39A 5GAN8 2ZPGB 4OP0A 2DAQA 2KAFA 3INZA 2L3RA 1M5Q1 3OQ5A 5HY6A 5GAOq 1KQ2A 2QQAA 4C5IA 1VQ4A 1N27A 3V8JA 3G6EA 3LWHA 2AHJB 4XTWA 5CIUA 4BI3A 4F7UB 1VQ7T 4E7KA 2RJDA 4R55A 2RHIA 3CCJT 5GAOr 3OA6A 4IUPA 3VYHB 4M77E 2RI5A 3ZEHA 1ZHIA 4DOWA 3M4YA 1KHCA 2YRVA 1FWZA 4F7UA 4F7UE 1O9SA 2K5LA 4QW2A 5GANh 1OZ3A 2XDBA 4XTUA 2DD4A 3HRSA 1VQMA 2A3LA 1JRIA 4M77D 1I5LA 3QKJA 3WVEB 2E12A 4M77C 1VIFA 3HFOA 5A0DA 1YJNA 5CK9A 1YJ9A 2D0QB 2RB6A 2VXEA 2PUOB 2DEQA 3A8MB 3H8ZA 4RG2A 3OYLA 5GAMd 2RI3A 3A8GB 5I2SA 1M8VA 3C12A 1XOVA 4C0DB 1U1SA 3RMQA 1LJOA 2WSCE 3EFRA 5LJ5d 1KC8C 4EPCA 2C06A 4M77B 1QP3A 4O5VA 2PVOB 3UDCA 5GMKe 1BIAA 4N4GA 5FLXE 2QEXT 4A54A 2DXUA 3KUFA 2WSFE 1S72T 1RL2A 2DTIA 3LGFA 3CCLA 3R6OA 3PGGA 4MDWA 5EG2A 2QA4T 4M7DG 1JJ2S 3GIBA 1K9MU 3MCAB 4P5NA 1X75C 3M56A 2VGNA 3CBMA 4A53A 3JCMd 4M7DD 4FM4B 3I56A 2QXFA 4PLIA 3JSCA 2F69A 1KG1A 3JRZA 2XI9A 4M75F 4ME7A 3WVDB 5A2QE 4M7DE 1D3BB 4MZPA 3CCJA 1BIBA 5FRNA 4C0FA 3QDRB 1N9SA 2DXBA 2KQWA 4J7FA 4PJOD 3ZBDA 2YLCA 5LJ5g 3L2QA 1EIFA 4M7DB 3SWNC 2KDSA 1QW1A 1VQOT 4X9DA 3JCMP 3MP1A 2RK2A 3TU4K 2LCLA 3FEOA 2E64A 1I4K1 1LNXA 2E6NA 2FVUA 2ZPEB 4C92D 4DQ2A 4J6XA 1LOJA 4IUUA 4XTVA 5KE3A 2E41A 3DLLA 3DB4A 3LGLA 2MWPA 5A0LA 3QO3A 2CZ1B 3PIPA 2EIFA 2ZGWA 3FB9A 1M1KU 2F5TX 2L89A 2LQKA 4QVDA 3DLMA 3CCSA 3CMAT 1QP2A 5LJ3j 2DK3A 1BI3A 5DY9A 3VUZA 4D6WA 1OI1A 1X6OA 1O75A 2MAMA 2XK0A 5GAOn 2RM4A 4XU3A 3T9NA 5FRMA 4BUGA 1KC8U 1N6AA 3VV0A 3VYGA 1AHJB 2DTOA 3NTHA 4N4IA 1KHIA 1I81A 3QUIA 4CRIA 4E47A 5DLOA 4M75C 1KQSS 4A4EA 3PMIA 1OZ2A 3CCLT 1M90C 2K3YA 4ZGJB 5GMKm 1V29B 1UEBA 1ZBXA 3OYHA 4JS5A 3L2VA 2MI6A 3SDZA 1PSEA 3HKSA 5CVIA 4NL3A 3OMGA 3SWNB 1WGSA 2QI2A 3RKWA 3SB2A 2LX9A 2FL7A 3OBYA 3L1AA 3GNGA 5HKCA 3I55A 2BUDA 1Y7XA 2EJGA 2I2LA 4NOYA 2RO0A 4C8QC 4BDYA 1VQ6T 4BD3A 5FU6B 4J5YA 3P8DA 3HP9A 2IVWA 2VGMA 3M55A 5IAYA 5GANg 3CD6A 1W4SA 3M57A 4E7JA 1B34A 2CZ6B 2MF2A 2Y90A 2O01E 3MO8A 2EJFA 3J80E 2DKGA 2PU9B 2WACA 4MMLA 3G71A 3RERA 3M54A 5LL6S 1R8OB 5FU7C 3CMEA 2LCCA 2CYZB 1H3ZA 4OB3B 3M5AA 4C92A 4ELZC 3MP8A 4HA8A 5LJ3d 4LDYA 4F7UF 3OYDA 3M59A 4OB1B 1IREB 2VV5A 3M9QA 3CCQT 3GF5A 2CS7A 4J6WA 4TVRA 2HQEA 4QQGA 3S3MA 1ZQ1A 2EQKA 1KD1U 5D6XA 3CBPA 3X24B 5KE2A 2CZ7B 3MHXA 2FYKA 2LRQA 3LLRA 4MZMA 1VQ5A 5GMKi 3NTIA 4HCCA 3RKYA 3GNFB 3L42A 5CAIA 1Y96A 4V2SA 3RESA 5GAN7 5GAMf 2JN0A 3HSBA 4XTXA 4BACA 2DIGA 2FHDA 2K2VA 4OF1A 2XICA 3CXCS 2JUFA 2QQRA 1W2BS 1B34B 3META 3QYGB 2VXFA 4BE2A 4M7AE 1TH7A 3Q1JA 4M77F 5GANe 3C94A 3ASKA 4C5GA 2CGHA 4OB2B 4J7IA 3P8BB 3OYNA 3X26B 3JCMf 3DKMA 2P0QA 2VC8A 1M1FA 3JCMg 4C0ZA 1G3SA 5FROA 5GAMj 2OTLT 2XDPA 2DXTA 4M78F 2E10A 4LD9K 5GANj 2JVVA 3JCMW 3JB9J 4ZN3A 5C6SA 4RMOA 2HAXA 2X35A 1YIJA 2RJFA 3WXMB 4E7HA 1Q81C 2H3JA 2D6FA 4KBMB 4C8QE 4L5GA 2RD1A 3LWIA 2DZ9A 2M1HA 4XAXB 4NS5A 3RKXA 3OYKA 4ZTFA 2OTJT 4QQ6A 2HD0A 3E9GA 4C8QD 1G3YA 2EQUA 2GFUA 1RI0A 2KSSA 2DTHA 4JLGA 2XDDA 2L5QA 4KUIA 4DA4A 3OB9A 1KD1C 2X4JA 3CC2A 4C8QG 3C4SA 4JRIA 4XK8E 1QVGS 2R5MA 5HK3A 1YJ9T 3QSUA 2K3XA 3S3NA 2O4XA 4GLKA 1VQKT 3JCMQ 4LD6A 1FX7A 1D3BA 4JRQA 1YJWT 4C8QB 4XTYA 4FT4A 3A8HB 2RK1A 1YHQA 4RKUE 4ZGDB 2CKKA 4ZTJA 4FSXA 3OYFA 4M7DA 4Y91A 3URGA 4C8QA 3CCST 1HXDA 3MEAA 2QEXA 3OW2A 2KVQG 4M78C 2LTOA 3F70A 2PVGB 2M9UA 3O8VA 3VKIA 3M53A 3M58A 4ZN1A 3OSSC 3LX7A 4IKFA 4ATOA 2GCXA 1VQ9A 3HPWA 1SSFA 3QJYA 4XU2A 5CQXA 3L2UA 3V8KA 2XIDA 5CQYA 1X01A 3HRUA 2YLBA 3V7RA 2P4TA 2GF7A 1Q7YU 5LJ5j 2RHUA 3QBYA 3OBWA 3OS1A 3OYBA 4M7AF 4EMKC 3OS5A 4ELYC 3QG1A 3C95A 1WQ7A 3M4GA 1N9RA 1M90U 1U8RA 1BI2A 4HCBA 3EFSA 4LDWA 3HHTB 3CCVT 5CCAA 2O4XB 3H6ZA 3VU3C 1G3WA 3JCMX 1W2BA 1KQSA 2LC4A 4LDVA 2LT1A 3MP6A 4YTLA 5GAMg 5GAMe 4QVZA 2V8KA 1NJIC 5GMKj 3QIIA 4KUDK 5GAN5 1VQ4T 3UWNA 4GY5A 2B8AA 5M9OA 5LJ3f 1FXXA 3QJ6A 5LJ3g 2QDYB 3QHSA 4N0AA 1XNIA 2VUBA 1VQLA 2LDMA 3CMET 1K73C 3GPLA 1K8AU 2DJZA 1JBMA 3SFMA 3CCQA 4M7AD 5GAN6 2DZCA 4OVAA 5L8RE 2Y4YA 3GLXA 3CCET 3S6WA 4M7AG 4HCZA 4A4FA 3CC7A 1YJNT 2L8DA 4M75E 3QYHB 3V8LA 1VQ9T 1VQ5T 4Z02A 1YCYA 2QTXA 4C92B 2BKDN 5CO7A 4FIBA 2YHTA 3V7CA 3MEVA 1S72A 1HK9A 2F5KA 2HBPA 1Q81U 2GQVA 2V8JA 1U1TA 5FU6C 2A7YA 3L2ZA 4M75D 3JCMJ 3JB9F 3MEUA 5IT9E 3A8OB 1VQNT 3L2RA 2LNVA 1JB0E 4FT2A 4M75G 5DM7R 4RCBA 3JAME 5D6YA 2HQXA 4BDZA 1K9MC 2EQMA 1YI2A 4C5HA 2LT4A 4B9WA 3LW5E 2JTMA 3CD6T 2R5AA 3KXTA 1UGQB 3JB9I 1WJSA 4M75B 2P0PA 3SWNA 2QA4A 3PNWC 3TREA 1M9SA 4L59A 1QVFA 3TEEA 4XQ3A 4BY6C 4M7DF 2EAYA 4JLIA 4UC4A 3JCMc 4C5EA 4PJOA 3OYGA 2P0KA 1YIJT 2DXCA 1WJQA 2K57A 2K4YA 2X4WA 5CKDA 1K8AC 3QZ5B 5LJ5h 1BI1A 3CCRA 4KULA 4EMGA 2RJEA 1G3TA 4BE0A 1VQ8T 2JTFA 3JB9G 4IURA 4C0GA 1QVGA 1VQLT 3X20B 3CC2T 4X9CA 2CZ0B 2RH2A 2XG8D 1NPPA 2JZ2A 4XU1A 4A4HA 3OYJA 1Q7YC 2NLUA 2LQ8A 5KCOA 3CMAA 5HK0A 1YJWA 4IUVA 5LJ3e 1M1GA 2ZPBB 3NFCA 4LDUA 1YHQT 3HRTA 2X4YA 4PJOC 4BE1A 3S3OA 4M77A 1BYMA 1VQPA 3BY7A 1Y71A 3VUBA 3FLGA 4HT8A 3BW1A 3OYMA 1UGSB 5GAN3 3J81E 3TCJA 3DB3A 4PL6A 1UB4A 1Y96B 2E1HA 5FU7B 5A0GA 5IN1A 4EDUA 1YITT 4IUQA 3PFSA 5GANf 5J26A 4M7DC 4B9XA 3E19A 4DOVA 4JRKA 4PJOB 3CCMT 3OSVA 1YI2T 4OB0B 5AYFA 1VQ6A 2XHCA 4J83A 3JCMV 5D6WA 5J3BA 3E1SA 3ER0A 1Q82C 3PTAA 3OS0A 3RIRA 3G4ST 4A4GA 4E7LA 5GMKl 2Y4XA 5KCHA 4KT0E 4O6JA 2JOYA 2G3RA 5GAOp 4C92C 2R58A 2DO3A 4FU6A 1WQWA 3FDRA 1VQ7A 5LJ3h 3I56T 3GOXA 3UPUA 4BI4A 3UT1A 3G71T 2VYTA 3CEYA 2KMTA 2OAUA 4OGEA 2K5FA 1H641 2DPPB 3CCUA 4OGCA 2QQ9A 3OY9A 3X25B 3PIOA 2EJ9A 1IZ6A 2BIVA 3PMTA 2QQSA 2ZZDA 2RI2A 3QPHA 4BB7A 1NJIU 1JJ2A 2HNIA 1QVFS 3JB9H 1YBYA 2PVDB 5DLQE 3PT9A 2ZPIB 4E7IA 1G5VA 2DVEA 1OYXA 3HFNA 4EMHA 3L2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X4X A;  2PQW A;  3SD4 A;  2RHZ A;  3A5Z B;  3NTK A;  2IG0 A;  1YIT A;  4PLL A;  3CPW A;  3OMC A;  1NPR A;  3OW2 S;  1Q86 C;  1N8R U;  2RHX A;  3OS2 A;  4II1 A;  5KH6 A;  3LYI A;  2LVM A;  4QQD A;  4FL6 A;  5C0M A;  3CCM A;  3CPF A;  1Q82 U;  3CC4 T;  3P8H A;  3FC3 A;  1WJR A;  2R57 A;  2OTL A;  3G4S A;  1BKB A;  4X34 A;  3J7A F;  3OYC A;  1VQO A;  2EFI A;  3CCU T;  3I55 T;  2E70 A;  3MEW A;  2OTJ A;  2E6Z A;  3OYI A;  2D9T A;  1K73 U;  3BDL A;  2EKO A;  1VQK A;  4N4H A;  3G6E T;  3OYE A;  3CCE A;  3EAE A;  1VQ8 A;  3E9F A;  3CC7 T;  2M0O A;  3CCR T;  2M16 A;  4Q5W A;  3ME9 A;  3CXC A;  2RJC A;  3OYY A;  1VQM T;  2EQJ A;  3LH0 A;  2RHY A;  4IUT A;  2DIQ A;  2E5Q A;  1N8R C;  2GFA A;  3OYA A;  1VQN A;  1NZ9 A;  1MHN A;  3KBG A;  3CPW S;  1Q86 U;  1VQP T;  1XTD A;  2MWO A;  2JNG A;  1M1K C;  3CC4 A;  3CCV A;  5J39 A;  2DAQ A;  2L3R A;  3OQ5 A;  5HY6 A;  1VQ4 A;  4C5I A;  1N27 A;  3G6E A;  5CIU A;  1VQ7 T;  4E7K A;  2RJD A;  2RHI A;  3CCJ T;  3OA6 A;  4IUP A;  2RI5 A;  3ZEH A;  1KHC A;  2YRV A;  4QW2 A;  1OZ3 A;  1VQM A;  3QKJ A;  1YJN A;  1YJ9 A;  3H8Z A;  4RG2 A;  3OYL A;  2RI3 A;  1KC8 C;  4N4G A;  5FLX E;  2QEX T;  3KUF A;  1S72 T;  1RL2 A;  3LGF A;  3CCL A;  2QA4 T;  1JJ2 S;  1K9M U;  3I56 A;  4PLI A;  5A2Q E;  3CCJ A;  5FRN A;  3L2Q A;  1EIF A;  2KDS A;  1VQO T;  3MP1 A;  2LCL A;  3FEO A;  2E6N A;  4IUU A;  5KE3 A;  3DLL A;  3DB4 A;  3LGL A;  2MWP A;  3PIP A;  2EIF A;  1M1K U;  2L89 A;  3CCS A;  3CMA T;  3DLM A;  1OI1 A;  1X6O A;  2XK0 A;  5FRM A;  1KC8 U;  3NTH A;  4N4I A;  1KHI A;  4CRI A;  1KQS S;  4A4E A;  3PMI A;  3CCL T;  1M90 C;  1OZ2 A;  2K3Y A;  3OYH A;  1UEB A;  3L2V A;  2MI6 A;  3HKS A;  3OMG A;  1WGS A;  3I55 A;  2BUD A;  4BDY A;  1VQ6 T;  2RO0 A;  4BD3 A;  3P8D A;  5IAY A;  3CD6 A;  4E7J A;  3MO8 A;  3J80 E;  2WAC A;  3G71 A;  5LL6 S;  3CME A;  2LCC A;  1H3Z A;  3MP8 A;  3OYD A;  3M9Q A;  3CCQ T;  4TVR A;  2HQE A;  4QQG A;  3S3M A;  2EQK A;  1KD1 U;  5D6X A;  5KE2 A;  2LRQ A;  3LLR A;  1VQ5 A;  3NTI A;  3L42 A;  4BAC A;  2DIG A;  2FHD A;  3CXC S;  2JUF A;  1W2B S;  2QQR A;  3MET A;  4BE2 A;  3Q1J A;  3ASK A;  4C5G A;  3OYN A;  3P8B B;  5FRO A;  2OTL T;  2XDP A;  2JVV A;  4ZN3 A;  5C6S A;  2X35 A;  1YIJ A;  2RJF A;  4E7H A;  1Q81 C;  2M1H A;  4NS5 A;  3OYK A;  4ZTF A;  2OTJ T;  4QQ6 A;  3E9G A;  2EQU A;  2GFU A;  1RI0 A;  3CC2 A;  1KD1 C;  3OB9 A;  3C4S A;  1QVG S;  2R5M A;  1YJ9 T;  2K3X A;  3S3N A;  2O4X A;  1VQK T;  4LD6 A;  1YJW T;  1YHQ A;  2CKK A;  4ZTJ A;  3OYF A;  3CCS T;  3MEA A;  2QEX A;  3OW2 A;  2KVQ G;  2LTO A;  3F70 A;  3O8V A;  4ZN1 A;  3LX7 A;  4IKF A;  1VQ9 A;  1SSF A;  3L2U A;  1Q7Y U;  2GF7 A;  2RHU A;  3QBY A;  3OS1 A;  3OYB A;  1M90 U;  3CCV T;  2O4X B;  3H6Z A;  1W2B A;  1KQS A;  3MP6 A;  4YTL A;  4QVZ A;  1NJI C;  3QII A;  1VQ4 T;  3UWN A;  4GY5 A;  2B8A A;  5M9O A;  3QJ6 A;  1XNI A;  1VQL A;  2LDM A;  3CME T;  1K73 C;  1K8A U;  3CCQ A;  4OVA A;  3CCE T;  3S6W A;  4HCZ A;  4A4F A;  3CC7 A;  1YJN T;  2L8D A;  1VQ9 T;  1VQ5 T;  4Z02 A;  2BKD N;  1S72 A;  3MEV A;  1Q81 U;  2F5K A;  3MEU A;  5IT9 E;  1VQN T;  3L2R A;  5DM7 R;  3JAM E;  5D6Y A;  2HQX A;  4BDZ A;  1K9M C;  2EQM A;  1YI2 A;  4C5H A;  4B9W A;  3CD6 T;  2R5A A;  1WJS A;  2QA4 A;  3PNW C;  3TRE A;  4L59 A;  1QVF A;  4UC4 A;  4C5E A;  3OYG A;  1YIJ T;  2P0K A;  1WJQ A;  2X4W A;  1K8A C;  3CCR A;  2RJE A;  4BE0 A;  1VQ8 T;  2JTF A;  4IUR A;  1QVG A;  1VQL T;  3CC2 T;  1NPP A;  2JZ2 A;  1Q7Y C;  4A4H A;  3OYJ A;  2NLU A;  2LQ8 A;  5KCO A;  3CMA A;  1YJW A;  4IUV A;  1M1G A;  1YHQ T;  2X4Y A;  4BE1 A;  3S3O A;  1VQP A;  3FLG A;  3OYM A;  3J81 E;  3DB3 A;  4PL6 A;  5IN1 A;  4EDU A;  1YIT T;  4IUQ A;  3PFS A;  5J26 A;  4B9X A;  3CCM T;  1YI2 T;  1VQ6 A;  2XHC A;  5D6W A;  5J3B A;  3ER0 A;  1Q82 C;  3OS0 A;  3G4S T;  4A4G A;  4E7L A;  5KCH A;  2JOY A;  2G3R A;  2R58 A;  2DO3 A;  4FU6 A;  3FDR A;  1VQ7 A;  3I56 T;  3GOX A;  3G71 T;  3UT1 A;  2VYT A;  3CEY A;  3CCU A;  3OY9 A;  3PIO A;  1IZ6 A;  3PMT A;  1JJ2 A;  2BIV A;  1NJI U;  1QVF S;  2QQS A;  2RI2 A;  1YBY A;  5DLQ E;  4E7I A;  1G5V A;  1OYX A;  3L2W A; 
#chains in the Genus database with same CATH topology
 1VOM A;  1Z9Q A;  2E65 A;  4OMF B;  3VS5 A;  3SD4 A;  2EWN A;  2RHZ A;  3A5Z B;  3NTK A;  2IG0 A;  4Z89 A;  4J6Y A;  4PLL A;  3U23 A;  3CPW A;  1NPR A;  1YJ9 Q;  1Q86 C;  1N8R U;  5GMK h;  3OS2 A;  5GAN d;  3LYI A;  1VQM Q;  1MMG A;  4AG1 C;  4JDS A;  1W1F A;  1Y07 A;  4VUB A;  3CPF A;  1RAB B;  3JCM e;  4NL2 A;  2I0N A;  3M0R A;  2R57 A;  2OTL A;  1C0M A;  1BKB A;  3OYC A;  4M78 B;  3J7A F;  1W2B P;  4D8K A;  2DBK A;  1H92 A;  4CI0 C;  3X28 B;  3CCU T;  2E70 A;  2OTJ A;  2KEA A;  3RMS A;  2EVR A;  2EYQ A;  3QZ9 B;  4JPB W;  4WF2 A;  3JB9 D;  3RNJ A;  5GAO l;  1KQ1 A;  2XU8 A;  4PK4 A;  3ULR B;  4CC7 A;  3OYE A;  3EAE A;  2EKH A;  2XKO C;  1VQ8 A;  2M0O A;  3CC7 T;  4PKC C;  3ME9 A;  3CXC A;  1D1A A;  2DD5 A;  5CR2 A;  1W6X A;  2D0N A;  5GAM h;  2ZCF B;  1V76 A;  1NYF A;  4PNO A;  4N0A C;  2FB7 A;  1EZZ B;  1ZA1 B;  3QDF A;  4M7A A;  4F17 A;  4A4K A;  4WCI A;  4XU0 A;  2K5I A;  4OP0 A;  2KAF A;  3INZ A;  4FCY A;  5GAO q;  1KQ2 A;  4C5I A;  2AHJ B;  4BI3 A;  3CCS Q;  2RJD A;  2RHI A;  3OA6 A;  3ZEH A;  2VWF A;  4F7U A;  1SRM A;  2XDB A;  4XTU A;  3HRS A;  4M77 D;  3QKJ A;  1W70 A;  2AZS A;  2PUO B;  2DEQ A;  3H8Z A;  5GAM d;  2FZC B;  3UA7 A;  5I2S A;  3C12 A;  1U1S A;  3RMQ A;  1LJO A;  2YUN A;  1KC8 C;  2C06 A;  2AIR B;  4N4G A;  1N8R R;  5KYU B;  1F1B B;  2WSF E;  1S72 T;  2DTI A;  4OMO A;  3R6O A;  1X6B A;  1JJ2 S;  2FG0 A;  1X75 C;  3M56 A;  3JCM d;  1NLP C;  2YT6 A;  1K73 R;  4DBF A;  3CCU Q;  2K6D A;  2B86 A;  4M75 F;  3WVD B;  1D3B B;  2AKL A;  3CCJ A;  2EGE A;  1N9S A;  2DXB A;  4KGX B;  1YI2 Q;  3SWN C;  1QW1 A;  3JCM P;  3MP1 A;  3TU4 K;  2E64 A;  2ZPE B;  1LNX A;  5KE3 A;  3QWX X;  2K9G A;  4ZNX A;  1VQ6 Q;  4DBH A;  3PIP A;  2EIF A;  2F5T X;  3EGD B;  2LQK A;  3CMA T;  1M2O A;  3G6E Q;  1UUE A;  1TSF A;  5DY9 A;  3VUZ A;  4D6W A;  1OI1 A;  2ROL A;  2EGC A;  3I35 A;  5I22 A;  4R0K A;  3VYG A;  1AHJ B;  3NTH A;  1KHI A;  1I81 A;  4A4E A;  4ZGJ B;  2RPN A;  2MI6 A;  3SDZ A;  1Q7Y R;  1YFN A;  3JV3 A;  1VQO Q;  3SWN B;  2AT1 B;  3OBY A;  3GNG A;  3HTR A;  4NOY A;  2DFU A;  2RO0 A;  4J5Y A;  3P8D A;  3M55 A;  2IVW A;  2VGM A;  2PU9 B;  3I5R A;  3CME A;  2LCC A;  5IH2 A;  4RTU A;  1QQJ A;  5LJ3 d;  3OYD A;  3M59 A;  4OB1 B;  3M9Q A;  2VV5 A;  3EFO A;  4TVR A;  4HXJ A;  2HQE A;  1ZQ1 A;  1KD1 U;  1HYO A;  2BZX A;  3NTI A;  1WHK A;  3RKY A;  3GNF B;  4RTZ A;  1IHW A;  4V2S A;  4A63 B;  1RI9 A;  3HSB A;  2YSQ A;  1QCO A;  4BAC A;  3O5Z A;  1QCF A;  1RAG B;  3CXC S;  3CPW P;  3MET A;  2VVK A;  1QWF A;  4M7A E;  2LX7 A;  3C94 A;  4JZ3 A;  4C5G A;  2CGH A;  3OYN A;  2HQH A;  3JCM f;  2D8J A;  2COY A;  5GAM j;  2OTL T;  4M78 F;  4LD9 K;  3THK A;  2X35 A;  1YIJ A;  4E7H A;  4KBM B;  4RTT A;  2J05 A;  1PC0 A;  2CT4 A;  4NS5 A;  2W10 A;  4QQ6 A;  2X51 A;  2ECZ A;  3E9G A;  1OU9 A;  1G3Y A;  2A36 A;  1V1C A;  1ZUY A;  2KXD A;  2DTH A;  3CC2 A;  4LUE A;  4DA4 A;  1KD1 C;  1AWW A;  5HK3 A;  3QSU A;  2K3X A;  2DL3 A;  3UF4 A;  4GLM A;  4FT4 A;  3A8H B;  4RKU E;  4ZGD B;  1NYG A;  2M02 A;  2QG9 B;  1HXD A;  2LTO A;  2DNU A;  2M9U A;  1T3L A;  2GCX A;  3HPW A;  1SSF A;  3QJY A;  5CQX A;  3L2U A;  5CQY A;  4DBQ A;  3V7R A;  2ABL A;  2GF7 A;  5LJ5 j;  4ELY C;  3QG1 A;  2QDL A;  1N9R A;  4J9B A;  1BI2 A;  4HCB A;  1QVG P;  2CP5 A;  3H6Z A;  1Y0M A;  1GBQ A;  1KQS A;  2LC4 A;  4LDV A;  3MP6 A;  5GAM g;  5GAM e;  3EGU A;  2OJ2 A;  4E7Z A;  2H8H A;  1D1C A;  3CQT A;  3QII A;  1FXX A;  5LJ3 g;  1WDX A;  2DL7 A;  2QDY B;  2VUB A;  1MNE A;  1K8A U;  1JBM A;  5IXB A;  2DZC A;  3VRZ A;  4PJL A;  3EGD A;  4M75 E;  3V8L A;  4Z02 A;  1M2V A;  1YCY A;  2QTX A;  3V7C A;  5CO7 A;  2DER A;  1KC8 R;  2F5K A;  3EHQ A;  3MEU A;  1VQN T;  3L2R A;  2Z0W A;  4FT2 A;  2BE9 B;  4M75 G;  5D6Y A;  1OPK A;  2F2X A;  4BDZ A;  2RQV A;  4C5H A;  1PM3 A;  2LT4 A;  1YI2 A;  4B9W A;  4RTV A;  3KXT A;  1UGQ B;  3SWN A;  2DLP A;  3TRE A;  1ARK A;  1IGQ A;  4LNP A;  4XQ3 A;  2NUT A;  4JLI A;  2NUT B;  2VKN A;  3QZ5 B;  3I55 Q;  1BI1 A;  2YXY A;  2MYS A;  3SHW A;  1VQL T;  3X20 B;  2HL5 C;  3GBQ A;  1NG2 A;  2CZ0 B;  2RH2 A;  2JZ2 A;  4XU1 A;  1Q7Y C;  2BZY A;  2NLU A;  1OV3 A;  3I5S A;  1UHC A;  1FMV A;  2JTE A;  1M1G A;  2ZPB B;  2OX7 A;  4JJC A;  2L2P A;  3TCJ A;  1Y96 B;  2E1H A;  2JT4 A;  5A0G A;  4EDU A;  5J26 A;  4B9X A;  3E19 A;  3OW2 P;  5KYW B;  1UE9 A;  1YI2 T;  1VQ6 A;  2YUP A;  1Q82 C;  2HCK A;  4DEY A;  1AWX A;  3PTA A;  2A37 A;  1TUG B;  2R58 A;  1ZSZ B;  4FU6 A;  3CMA Q;  2AZV A;  3GOX A;  3CCJ Q;  1MND A;  2VYT A;  4OGE A;  2FO0 A;  1WHJ A;  1IZ6 A;  4BB7 A;  2QQS A;  2RI2 A;  1Q95 G;  1QVF S;  1H3H A;  2HNI A;  4E7I A;  2DVE A;  3L2W A;  2FZG B;  5GAN 4;  2COZ A;  1Q86 R;  5CKF A;  4BI8 B;  2DL4 A;  1XQH A;  2GBQ A;  4M78 G;  2JM9 A;  3EGX A;  4C92 F;  1PRL C;  3OW2 S;  1TXQ A;  3TSW A;  2V8I A;  5CKH A;  2LVM A;  4QQD A;  5I2M A;  3P8H A;  1WJR A;  2ED0 A;  3GP8 A;  3H0H A;  2QGG A;  1VUB A;  4X34 A;  1X2K A;  1UGP B;  4AT1 B;  4HKE A;  4JJB A;  3MEW A;  4JS4 A;  3A8L B;  5LJ5 e;  2D9T A;  1K73 U;  3FIF A;  3BDL A;  2SRC A;  4RCC A;  4ZGE B;  4PJO G;  1VQL Q;  1VQK A;  4HT9 A;  1DJ7 B;  4N4H A;  4HVU A;  3JCM b;  2PTK A;  4AMC A;  2BZ8 A;  1Z9Z A;  2M16 A;  2RJC A;  3OYY A;  3EG0 A;  5I21 A;  1ABQ A;  4IUT A;  2GFA A;  4C8Q F;  1VQN A;  1FMK A;  4QVC A;  4J8O A;  1UDL A;  2O31 A;  2WSE E;  4AFQ C;  2XD0 A;  4J9E A;  1Q86 U;  4MMK A;  2HDA A;  1XTD A;  3H0F A;  4JUV A;  3H41 A;  3EH2 A;  3CCE Q;  2M51 A;  1M1K C;  2J7I A;  3CCV A;  1K0S A;  1YWO A;  1SPK A;  2IIM A;  2KK4 A;  1G8X A;  2PZ1 A;  2K79 A;  2A0F B;  1M5Q 1;  3EH1 A;  5HY6 A;  2O9V A;  1QMC A;  2QQA A;  5HCK A;  3V8J A;  3LWH A;  1MUZ A;  4E7K A;  3VYH B;  4M77 E;  4AFU C;  2RI5 A;  1KHC A;  4F7U E;  4QW2 A;  2DD4 A;  4CC4 B;  1M90 R;  1I5L A;  2E12 A;  3HFO A;  1XJW B;  1YJ9 A;  3A8M B;  3OYL A;  4M4Z A;  2FPF A;  2RI3 A;  1CKA A;  1I0C A;  1UG1 A;  1M8V A;  5LJ5 d;  1SSH A;  1QP3 A;  5GMK e;  2HZY A;  2NUZ A;  2DXU A;  3KUF A;  1X69 A;  1RL2 A;  3LGF A;  2QAS A;  3PGG A;  4MDW A;  2L3Q A;  2C0T A;  4A53 A;  2VGN A;  3CBM A;  1AZG B;  4FM4 B;  4PLI A;  1KG1 A;  1BCO A;  4KRT A;  1K4U S;  1FMW A;  3CC4 Q;  1U5S A;  5A2Q E;  1D09 B;  5FRN A;  3QDR B;  1Y57 A;  2KQW A;  2YLC A;  3L2Q A;  1EIF A;  4M7D B;  1VQO T;  8AT1 B;  4X9D A;  4C92 D;  5L23 A;  1AVZ C;  4IUU A;  1IHV A;  1OOT A;  2E41 A;  3DLL A;  3DB4 A;  3LGL A;  2ENM A;  2JS2 A;  2FEI A;  3QO3 A;  1M1K U;  2L89 A;  1D0X A;  2DK3 A;  3CC7 Q;  2MAM A;  1MV3 A;  2RM4 A;  1QKW A;  3VV0 A;  2QAZ A;  3QUI A;  4M75 C;  3PVQ A;  1OZ2 A;  3G1J A;  3L2V A;  2EYX A;  1GRI A;  1K9A A;  1RAE B;  1PSE A;  3HKS A;  1WGS A;  1UTI A;  1IXD A;  3L1A A;  5HKC A;  1Y7X A;  1X27 A;  4BD3 A;  3CC2 Q;  3CD6 A;  1W4S A;  2DX1 A;  1LVK A;  4E7J A;  2Y90 A;  2MF2 A;  2IPO B;  2EJF A;  3RER A;  2WAC A;  5LL6 S;  1PKS A;  1H3Z A;  1U3O A;  1B07 A;  3MP8 A;  4HA8 A;  2LJ3 A;  2EYY A;  2OAW A;  1IB8 A;  5AT1 B;  2DEU A;  1KK7 A;  2M0Y A;  1PKT A;  3CCQ T;  3X24 B;  5KE2 A;  3MHX A;  2LRQ A;  4MZM A;  1X6G A;  2KRM A;  4OMP A;  5IXF A;  5GAM f;  2JN0 A;  4XTX A;  2C0O A;  4OF1 A;  2GGR A;  2VXF A;  2YWW A;  4BE2 A;  1TH7 A;  1NEG A;  4OB2 B;  4J7I A;  2JXB A;  3DKM A;  2P0Q A;  1M1F A;  1JO8 A;  2KRS A;  1QKX A;  5FRO A;  2DXT A;  2E10 A;  4QT7 A;  2JVV A;  3WXM B;  2D6F A;  4C8Q E;  2RD1 A;  3LWI A;  2M1H A;  4ZTF A;  1FYN A;  4PJN A;  2HD0 A;  2EQU A;  1R77 A;  2XDD A;  4RUG A;  4AFZ C;  4C8Q G;  4XK8 E;  1QVG S;  1YJ9 T;  3S3N A;  5IHI A;  1D3B A;  2RK1 A;  2CKK A;  4ZTJ A;  2KGT A;  1TWB A;  3VRY A;  4Y91 A;  2MOX A;  1VQ7 Q;  2JJ9 A;  3MEA A;  4M78 C;  2PVG B;  2MCN A;  3M53 A;  3CXC P;  2W0Z A;  3OSS C;  4KH1 B;  3EG1 A;  2XID A;  2F1L A;  3HRU A;  2K3B A;  3G4S Q;  2P4T A;  2RHU A;  1SHF A;  3OBW A;  3OS1 A;  1MMA A;  3OS5 A;  2VB6 A;  1OPL A;  1U8R A;  3HHT B;  1H8K A;  2O4X B;  2K2M A;  5D7U A;  2QYZ A;  4QVZ A;  2V8K A;  1NJI C;  4KUD K;  5GAN 5;  1AEY A;  1VQ4 T;  3UWN A;  2B8A A;  3G71 Q;  3QHS A;  1XNI A;  1VQL A;  2LDM A;  2LCS A;  3GPL A;  2DJZ A;  1QVF P;  3CCQ A;  4OVA A;  2QGF B;  5L8R E;  3CCE T;  1YJN T;  1PG5 B;  1SKU B;  5KYY B;  4C92 B;  2BKD N;  1S72 A;  5FU6 C;  3L2Z A;  3JB9 F;  2DF6 A;  1JB0 E;  1SEM A;  4RCB A;  2EQM A;  5KYN A;  3CD6 T;  2R5A A;  1WJS A;  4M75 B;  2P0P A;  2QA4 A;  2DRK A;  4L59 A;  2V1Q A;  2X9H A;  1BK2 A;  4M7D F;  1MMN A;  1WHM A;  5LJ5 h;  1D0Z A;  2EBP A;  1G3T A;  1TTH B;  1E7O A;  2V26 A;  4IUR A;  1G2B A;  1QVG A;  1ZSZ A;  1BCM A;  4A4H A;  3OYJ A;  5HK0 A;  5LJ3 e;  4M77 A;  1Y71 A;  3BW1 A;  3OYM A;  1T0J A;  1UGS B;  3DB3 A;  1UB4 A;  2YRD A;  1YIT T;  3PFS A;  4DOV A;  3OSV A;  1NM7 A;  4OB0 B;  2LZ6 B;  4J83 A;  3E1S A;  3ER0 A;  4PJM A;  1GFC A;  3OS0 A;  1ZUK A;  5GJW B;  4KT0 E;  4O6J A;  5GAO p;  2JMA A;  2DL8 A;  4IIM A;  5LJ3 h;  3UPU A;  3CCV Q;  1SHG A;  2KMT A;  2K5F A;  2KNB B;  2QQ9 A;  3OY9 A;  1WA7 A;  2P4R A;  3X25 B;  2DET A;  3PIO A;  3PMT A;  1JJ2 A;  1NJI U;  2A28 A;  2CUB A;  3JB9 H;  1WXU A;  3PT9 A;  4EMH A;  2X4X A;  4J9C A;  1PSF A;  1ZSZ C;  3BDU A;  1WLP B;  1RAF B;  2O88 A;  5LJ5 f;  3OMC A;  2RHX A;  5CKE A;  1VQK Q;  2ESW A;  2HL3 A;  4II1 A;  5KH6 A;  4AFS C;  1KIK A;  1K0X A;  2KYM A;  5C0M A;  4PFO A;  3HL8 A;  1M3A A;  4R56 A;  1Q82 U;  2NWM A;  2ED1 A;  3FRN A;  4M78 E;  3FC3 A;  3EHR A;  3AHU A;  1HSQ A;  3FJP A;  3G4S A;  2MIO A;  1NE8 A;  2LNH B;  1VQO A;  2EFI A;  3I55 T;  4Y28 E;  1AWO A;  2E6Z A;  1M27 C;  1WNL A;  4L6V 5;  2FRW A;  4EMK B;  1ZLM A;  2EKO A;  3BFM A;  5GAO m;  2RNA A;  3G6E T;  3N5B B;  4C92 G;  3CCE A;  3RUX A;  3E9F A;  2CDT A;  4Q5W A;  3M0U A;  3JCM h;  2EQJ A;  2E4H A;  4PJO E;  4MZT A;  2RHY A;  2E5Q A;  1N8R C;  3OYA A;  4JRP A;  3H9N A;  1NZ9 A;  2DYB A;  3KBG A;  1P92 A;  2CUD A;  2MWO A;  4CC2 A;  3QXE B;  2ZPF B;  4PJO F;  3KFV A;  1MGQ A;  3FJ5 A;  1YP5 A;  2KY9 A;  1ZSG A;  3CCR Q;  1X43 A;  2L3S A;  2ZAE A;  5KYU A;  1ZUU A;  1VQ4 A;  5KYW A;  2AKK A;  1OU8 A;  4XTW A;  5CIU A;  4R55 A;  4IUP A;  1ZX6 A;  4DOW A;  3M4Y A;  1FWZ A;  2K5L A;  5GAN h;  1IO6 A;  2A3L A;  4LXC A;  3WVE B;  1VIF A;  5A0D A;  3MKD A;  1YJN A;  5CK9 A;  2D0Q B;  2VXE A;  1AOJ A;  3MPU B;  2COW A;  4RG2 A;  8ATC B;  3A8G B;  2WSC E;  3EFR A;  1OX8 A;  4M77 B;  4O5V A;  2PVO B;  1BIA A;  1RAC B;  1OX9 A;  5FLX E;  2QEX T;  5IHN A;  3NGP A;  2BTT A;  2C0I A;  1UFF A;  2KE9 A;  3M0S A;  3VS1 A;  4M7D G;  4JJD A;  3GIB A;  1K9M U;  1WX6 A;  4P5N A;  4M7D D;  1RLP C;  3C0C A;  3JSC A;  3JRZ A;  2XI9 A;  3EGX B;  4ME7 A;  2J6F A;  4MZP A;  2NYS A;  1BIB A;  1AWJ A;  4PJO D;  3ZBD A;  5LJ5 g;  3LH5 A;  4ANJ A;  2KDS A;  2RQR A;  2RK2 A;  1I4K 1;  4DQ2 A;  3VS7 A;  4J6X A;  1LOJ A;  4XTV A;  3PVL A;  4PJJ A;  2CZ1 B;  2ZGW A;  3FB9 A;  4RTX A;  3M0P A;  2HSE B;  2DIL A;  3DLM A;  2NUP A;  3NMZ C;  5LJ3 j;  2QA4 Q;  1BI3 A;  1PCX A;  1UGV A;  1X6O A;  5GAO n;  2KRO A;  4XU3 A;  1JXM A;  2X3X D;  4KH0 B;  4FYW B;  3T9N A;  1KC8 U;  1N6A A;  2DTO A;  4N4I A;  1KQS S;  1TUC A;  1R0C B;  3PMI A;  1M90 C;  2K3Y A;  2DVJ A;  3OYH A;  1UEB A;  1ZBX A;  4JS5 A;  1VYT A;  5CVI A;  4NL3 A;  2D8H A;  3OMG A;  2HMA A;  5FWC A;  3SB2 A;  3PE0 A;  3I55 A;  2EJG A;  2KI7 A;  1GL5 A;  5GAN g;  1GCQ A;  3M57 A;  3RR6 A;  2O01 E;  3J80 E;  3R6N A;  4MML A;  3G71 A;  1R8O B;  5FU7 C;  2EGA A;  2CRE A;  3M5A A;  4LDY A;  1K9M R;  2CS7 A;  1QWE A;  1Q82 R;  4EIK A;  3S3M A;  2EQK A;  5D6X A;  3EG2 A;  2CZ7 B;  3IQL A;  4JZ4 A;  1VQ5 A;  4HCC A;  2FRY A;  2O9S A;  3L42 A;  5CAI A;  2GTO A;  2X3W D;  3VS2 A;  2KBT A;  2DIG A;  2FHD A;  2DM1 A;  2P84 A;  1W2B S;  1B34 B;  3EG9 A;  3Q1J A;  4M77 F;  3ASK A;  3P8B B;  2LJ1 A;  3JCM g;  4AG2 C;  1ABO A;  2XDP A;  5GAN j;  1TS9 A;  4ZN3 A;  5C6S A;  3UAT A;  2RJF A;  1YIJ Q;  1Q81 C;  2H3J A;  5EC7 A;  2HKN A;  1M3C A;  2DZ9 A;  2DRM A;  1K8A R;  4XAX B;  3OYK A;  1R0B G;  2H3E B;  2JM8 A;  2KSS A;  4JLG A;  2DE0 X;  2L5Q A;  4KUI A;  2X4J A;  3C4S A;  5KYX B;  2R5M A;  3JCM Q;  4LD6 A;  1YJW T;  4C8Q B;  2J6O A;  2LQN A;  1YHQ A;  1TG0 A;  2KXC A;  4FSX A;  3OYF A;  3URG A;  4M7D A;  4C8Q A;  3CCS T;  2QEX A;  5I11 A;  3F70 A;  4RTW A;  3VKI A;  1WFW A;  1WHH A;  4ZN1 A;  3LX7 A;  4IKF A;  1E6G A;  2GQI A;  1YHQ Q;  1VQ9 A;  3V8K A;  4Z8A A;  1X01 A;  1Q7Y U;  3QBY A;  3OYB A;  2CP2 A;  4M7A F;  4EMK C;  9ATC B;  3M4G A;  7AT1 B;  1PHT A;  1M90 U;  4KGV B;  4LDW A;  5CCA A;  3VU3 C;  2QTV A;  5GMK j;  2E3H A;  1SRL A;  4F14 A;  4GY5 A;  5M9O A;  5LJ3 f;  1MV0 B;  4N0A A;  4OMQ A;  1I07 A;  4F04 B;  5GAN 6;  1BU1 A;  1PRM C;  3CCQ Q;  2RMO A;  4HCZ A;  4A4F A;  1UHF A;  1VQ5 T;  4CC3 A;  2YUO A;  2YHT A;  3MEV A;  1HK9 A;  1Q81 U;  2GQV A;  2V8J A;  2A7Y A;  4M75 D;  3JCM J;  5IT9 E;  3A8O B;  1RAD B;  2JW4 A;  2LNV A;  4E2F B;  1RAH B;  3JAM E;  3AT1 B;  1PNJ A;  3A1P A;  3LW5 E;  2JTM A;  3VS0 A;  1WHG A;  3CME Q;  1LPL A;  1RAA B;  2YUQ A;  2EAY A;  3JCM c;  4C5E A;  3OYG A;  2DXC A;  1WJQ A;  2K57 A;  2K4Y A;  2X4W A;  1K8A C;  3M0T A;  1M2V B;  2CH4 W;  2CSI A;  4E6R A;  4KUL A;  2LP5 A;  2KR3 A;  4BE0 A;  2O2O A;  1YJW Q;  3JB9 G;  2J6K A;  2CP7 A;  1J3T A;  4C0G A;  1B3Q A;  1RUW A;  5KCO A;  1YJW A;  2DL5 A;  3NFC A;  4LDU A;  1YHQ T;  3HRT A;  4PJO C;  3S3O A;  1BYM A;  1NEB A;  3VUB A;  3FLG A;  4HT8 A;  5GAN 3;  3J81 E;  2EPD A;  2LJ0 A;  5IN1 A;  4OMN A;  4M7D C;  2HKQ B;  4PJO B;  4JRK A;  1WXB A;  5J3B A;  3REA B;  3G4S T;  4A4G A;  4E7L A;  3NHN A;  3TQ7 P;  2Y4X A;  5KCH A;  4FW1 A;  2G3R A;  1M30 A;  2DO3 A;  1NJI R;  1WQW A;  2DMO A;  3FDR A;  3I56 T;  2MPX C;  3G71 T;  2CP6 A;  1VYU A;  1CKB A;  1EFN A;  4FYY B;  2DPP B;  3CCU A;  2EJ9 A;  1TUD A;  2BIV A;  2ZZD A;  3QPH A;  4FW2 A;  2PVD B;  5DLQ E;  1AZE A;  3CCM Q;  1GCP A;  2PQW A;  1QVP A;  5IHK A;  4RG8 A;  4M77 G;  2QQB A;  1RLQ C;  4EMK A;  4F7U G;  2PUK B;  1YIT A;  2CSQ A;  1VIE A;  2AK5 A;  1PWT A;  1B7T A;  3ZFJ A;  2EQI A;  3VS6 A;  4M78 D;  4FL6 A;  1TU0 B;  3CCM A;  1AT1 B;  1WHL A;  3SEM A;  1NBE B;  1VQN Q;  3CBO A;  1UJY A;  2MMP A;  3CC4 T;  3VJP A;  1UGR B;  4M78 A;  3G7Z A;  5GAN 2;  1YN8 A;  1I8F A;  4J9G A;  4MDX A;  2ZPH B;  4XTZ A;  3OYI A;  1KSW A;  4M7A C;  3V7S A;  4PFZ A;  2RA2 A;  4C0D C;  4M75 A;  1BI0 A;  3MJX A;  3CCR T;  1WIE A;  1KJW A;  1VQM T;  1GFD A;  1D0Y A;  4FYX B;  2BE7 D;  4OML A;  4BY6 B;  3LH0 A;  2KRN A;  2PNI A;  3REB B;  2DIQ A;  1I5O B;  4C92 E;  1MHN A;  1YWP A;  4JJN K;  4LDX A;  3CPW S;  1GBR A;  5KYY A;  1WPY A;  1VQP T;  1KQS P;  4M7A B;  1M4Z A;  4J9F A;  2RQT A;  2JNG A;  4HVV A;  3CC4 A;  1YIT Q;  5CKB A;  1GXI E;  3QWY A;  3I56 Q;  5J39 A;  1UEC A;  5GAN 8;  2ZPG B;  2DAQ A;  2L3R A;  3OQ5 A;  1M8M A;  1N27 A;  2FZK B;  3VS4 A;  2XMF A;  3G6E A;  4F7U B;  1VQ7 T;  1I1J A;  3CCJ T;  5GAO r;  3BE3 A;  1K1Z A;  1ZHI A;  4PFP A;  2YRV A;  1O9S A;  1OZ3 A;  1SF9 A;  2RQU A;  1PD1 A;  4F16 A;  1VQM A;  1JRI A;  4M77 C;  2VAS A;  2DYI A;  1GCQ C;  2RB6 A;  1ZBJ A;  1XOV A;  4C0D B;  4EPC A;  2E5K A;  3UDC A;  3RBB B;  2HEQ A;  4A54 A;  2EYW A;  2OI3 A;  4GBQ A;  4K11 A;  3CCL A;  2NUP B;  5EG2 A;  2QA4 T;  2JMC A;  3MCA B;  3D7S B;  4J9D A;  3I56 A;  3TVT A;  2QXF A;  2F69 A;  1TOV A;  4M7D E;  4C0F A;  1CSK A;  4J7F A;  1YJN Q;  1ACM B;  2LCL A;  1IRX A;  3FEO A;  2E6N A;  5GJV B;  2FVU A;  1JEG A;  2JS0 A;  2MWP A;  5A0L A;  1S72 Q;  1LCK A;  4QVD A;  3CCS A;  2YRC A;  1QP2 A;  2K7A A;  3CD6 Q;  1O75 A;  2XK0 A;  2LQW A;  2L0A A;  4Z88 A;  1VQP Q;  5FRM A;  4BUG A;  4E47 A;  4CRI A;  3EG3 A;  5DLO A;  1IGU A;  3CCL T;  4OMM A;  5GMK m;  1V29 B;  3VS3 A;  2LMJ A;  1RAI B;  1VA7 A;  2QI2 A;  2RQW A;  4FYV B;  3RKW A;  2FPE A;  2FL7 A;  2LX9 A;  5FWB A;  1KD1 R;  2BUD A;  2DJQ A;  2I2L A;  4BDY A;  4C8Q C;  1VQ6 T;  5FU6 B;  1NLO C;  3HP9 A;  5IAY A;  4B6M A;  1B34 A;  2CZ6 B;  3MO8 A;  1C6V X;  4HVW A;  2DKG A;  1Q81 R;  2CP3 A;  3M54 A;  4IIO A;  2CYZ B;  4OB3 B;  4C92 A;  4ELZ C;  3EFO B;  4D8D A;  4F7U F;  4J9H A;  1IRE B;  3GF5 A;  2MK5 A;  4J6W A;  1M3B A;  1A0N B;  1WYX A;  2EYZ A;  2KYB A;  4QQG A;  1M1K R;  3CBP A;  4HCK A;  1HD3 A;  2EW3 A;  2FYK A;  4E7S A;  3LLR A;  5GMK i;  2OTJ Q;  4ESR A;  1QLY A;  1Y96 A;  3RES A;  5GAN 7;  2K2V A;  3RDV A;  1OUL A;  2KT8 A;  2XIC A;  4Y92 A;  2JUF A;  2QQR A;  3QYG B;  5GAN e;  3X26 B;  2L3P A;  4QKU A;  2QEX Q;  3EG9 B;  2VC8 A;  2HBW A;  3ZL7 C;  4C0Z A;  1G3S A;  1OQK A;  2ATC B;  3JCM W;  3JB9 J;  4RMO A;  2HAX A;  2KT1 A;  4L5G A;  1S1N A;  3RKX A;  2OTJ T;  4C8Q D;  2GFU A;  1PD0 A;  1RI0 A;  2CT3 A;  2RF0 A;  3OB9 A;  3E2U A;  1D1B A;  4JRI A;  1UJ0 A;  2O4X A;  4GLK A;  1VQK T;  1BBZ A;  4RTY A;  1FX7 A;  4JRQ A;  1VQ8 Q;  4XTY A;  4LUD A;  3TSZ A;  2G6F X;  1HJD A;  1T3S A;  2CP0 A;  4DBR A;  3OW2 A;  2KVQ G;  2A08 A;  3O8V A;  2HSP A;  3M58 A;  4ATO A;  1JQQ A;  4XU2 A;  1YNZ A;  2YLB A;  1EX4 A;  1WXT A;  3C95 A;  1WQ7 A;  3I9Q A;  1VQ5 Q;  3EFS A;  1JU5 C;  3CCV T;  3JCM X;  1G3W A;  1X2Q A;  4J9I A;  1W2B A;  2LT1 A;  4YTL A;  5FW9 A;  4LN2 A;  2GTJ A;  3QJ6 A;  1SG5 A;  6AT1 B;  3CME T;  1K73 C;  3SFM A;  4M7A D;  1JXO A;  2E3I A;  2Y4Y A;  3GLX A;  5ECA A;  3S6W A;  4M7A G;  3CC7 A;  2L8D A;  3QYH B;  1VQ9 T;  2YDL A;  2D1X A;  4FIB A;  2HBP A;  1U1T A;  2GNC A;  1MMD A;  2QK0 A;  5DM7 R;  4KGZ B;  2HQX A;  1K9M C;  3JB9 I;  2DA9 A;  3PNW C;  1M9S A;  1QVF A;  3TEE A;  4BY6 C;  1OEB A;  2SEM A;  1E6H A;  4UC4 A;  4PJO A;  1N5Z A;  2CH4 A;  2P0K A;  1YIJ T;  5CKD A;  1VQ9 Q;  4FSS A;  3CCR A;  2DBM A;  4EMG A;  2FPD A;  2RJE A;  1VQ8 T;  2JTF A;  1G83 A;  2F2V A;  4X1V A;  1ZA2 B;  2ROT A;  3CC2 T;  4X9C A;  4LE9 A;  2XG8 D;  1NPP A;  2V1R A;  2LQ8 A;  2F2W A;  3CMA A;  4IUV A;  1JJ2 P;  2X4Y A;  1C1A A;  4BE1 A;  1VQP A;  3BY7 A;  3A98 A;  1KFZ A;  4PL6 A;  1WI7 A;  1K76 A;  3M0Q A;  5FU7 B;  4IUQ A;  5GAN f;  2J06 A;  3CCM T;  5AYF A;  1U06 A;  1YCS B;  2XHC A;  1WZO A;  1BB9 A;  3JCM V;  5D6W A;  3RIR A;  4WTO B;  5GMK l;  4ORZ A;  2JOY A;  4C92 C;  1VYV A;  1VQ7 A;  4BI4 A;  2RN8 A;  3UT1 A;  3CEY A;  2OAU A;  4DEX A;  1AD5 A;  3H0I A;  1T0H A;  1H64 1;  4OGC A;  3NPF A;  2OTL Q;  1VQ4 Q;  1YBY A;  1G5V A;  2ZPI B;  3CCL Q;  3HFN A;  1OYX A;  1QCN A;  3UA6 A;  5KYX A; 
#chains in the Genus database with same CATH homology
 5GAN 4;  2X4X A;  2PQW A;  1QVP A;  2E65 A;  4OMF B;  1PSF A;  4RG8 A;  4M77 G;  2QQB A;  3BDU A;  5CKF A;  2EWN A;  2RHZ A;  3A5Z B;  3NTK A;  3SD4 A;  4BI8 B;  4EMK A;  2IG0 A;  2PUK B;  4F7U G;  1YIT A;  4J6Y A;  5LJ5 f;  1XQH A;  4PLL A;  1VIE A;  3CPW A;  3OMC A;  4M78 G;  1NPR A;  4C92 F;  3ZFJ A;  3OW2 S;  1Q86 C;  1N8R U;  2RHX A;  5CKE A;  4M78 D;  5GMK h;  2V8I A;  3OS2 A;  4II1 A;  5KH6 A;  5GAN d;  3LYI A;  2LVM A;  4QQD A;  5CKH A;  5I2M A;  4FL6 A;  5C0M A;  4JDS A;  3CCM A;  1Y07 A;  4VUB A;  3CPF A;  3HL8 A;  3CBO A;  4R56 A;  1Q82 U;  2MMP A;  3JCM e;  4NL2 A;  3FRN A;  3VJP A;  3CC4 T;  1UGR B;  3P8H A;  4M78 E;  4M78 A;  3FC3 A;  1WJR A;  3GP8 A;  3AHU A;  3G7Z A;  5GAN 2;  2R57 A;  2OTL A;  1I8F A;  1VUB A;  3FJP A;  3G4S A;  1BKB A;  4X34 A;  3OYC A;  4M78 B;  3J7A F;  1NE8 A;  1UGP B;  1VQO A;  2EFI A;  4CI0 C;  4HKE A;  4MDX A;  2ZPH B;  3X28 B;  3I55 T;  2E70 A;  4Y28 E;  3MEW A;  3CCU T;  4JS4 A;  3A8L B;  2E6Z A;  4XTZ A;  3RMS A;  2OTJ A;  1WNL A;  2D9T A;  5LJ5 e;  3OYI A;  2EYQ A;  4L6V 5;  1K73 U;  3FIF A;  3BDL A;  4M7A C;  4EMK B;  4RCC A;  3V7S A;  3QZ9 B;  4WF2 A;  4ZGE B;  2EKO A;  4PJO G;  3JB9 D;  3BFM A;  2RA2 A;  5GAO m;  1VQK A;  5GAO l;  4HT9 A;  1KQ1 A;  2XU8 A;  1DJ7 B;  4C0D C;  4N4H A;  4M75 A;  3G6E T;  3N5B B;  3JCM b;  4C92 G;  3OYE A;  3EAE A;  3RUX A;  1BI0 A;  2XKO C;  3CCE A;  1VQ8 A;  2M0O A;  3E9F A;  3CC7 T;  3CCR T;  2M16 A;  4Q5W A;  4PKC C;  3ME9 A;  3CXC A;  2RJC A;  3OYY A;  2DD5 A;  1VQM T;  5I21 A;  3JCM h;  2EQJ A;  4PJO E;  4BY6 B;  4MZT A;  3LH0 A;  5CR2 A;  2RHY A;  4IUT A;  2DIQ A;  5GAM h;  2E5Q A;  2GFA A;  3OYA A;  4C8Q F;  1N8R C;  2ZCF B;  1VQN A;  4C92 E;  4JRP A;  4PNO A;  4QVC A;  4J8O A;  4N0A C;  2FB7 A;  1NZ9 A;  1MHN A;  3KBG A;  2WSE E;  4JJN K;  4LDX A;  3CPW S;  2XD0 A;  1P92 A;  1WPY A;  1Q86 U;  1VQP T;  4MMK A;  4M7A B;  1XTD A;  1M4Z A;  2MWO A;  4JUV A;  2JNG A;  3QXE B;  1M1K C;  2ZPF B;  5CKB A;  3CC4 A;  3CCV A;  4PJO F;  4A4K A;  4M7A A;  1GXI E;  1MGQ A;  4XU0 A;  2KY9 A;  2KK4 A;  2K5I A;  5J39 A;  5GAN 8;  2ZPG B;  4OP0 A;  2DAQ A;  2KAF A;  3INZ A;  2L3R A;  1M5Q 1;  3OQ5 A;  5HY6 A;  5GAO q;  1KQ2 A;  2QQA A;  4C5I A;  1VQ4 A;  1N27 A;  3V8J A;  3G6E A;  3LWH A;  2AHJ B;  4XTW A;  5CIU A;  4BI3 A;  4F7U B;  1VQ7 T;  4E7K A;  2RJD A;  4R55 A;  2RHI A;  3CCJ T;  5GAO r;  3OA6 A;  4IUP A;  3VYH B;  4M77 E;  2RI5 A;  3ZEH A;  1ZHI A;  4DOW A;  3M4Y A;  1KHC A;  2YRV A;  1FWZ A;  4F7U A;  4F7U E;  1O9S A;  2K5L A;  4QW2 A;  5GAN h;  1OZ3 A;  2XDB A;  4XTU A;  2DD4 A;  3HRS A;  1VQM A;  2A3L A;  1JRI A;  4M77 D;  1I5L A;  3QKJ A;  3WVE B;  2E12 A;  4M77 C;  1VIF A;  3HFO A;  5A0D A;  1YJN A;  5CK9 A;  1YJ9 A;  2D0Q B;  2RB6 A;  2VXE A;  2PUO B;  2DEQ A;  3A8M B;  3H8Z A;  4RG2 A;  3OYL A;  5GAM d;  2RI3 A;  3A8G B;  5I2S A;  1M8V A;  3C12 A;  1XOV A;  4C0D B;  1U1S A;  3RMQ A;  1LJO A;  2WSC E;  3EFR A;  5LJ5 d;  1KC8 C;  4EPC A;  2C06 A;  4M77 B;  1QP3 A;  4O5V A;  2PVO B;  3UDC A;  5GMK e;  1BIA A;  4N4G A;  5FLX E;  2QEX T;  4A54 A;  2DXU A;  3KUF A;  2WSF E;  1S72 T;  1RL2 A;  2DTI A;  3LGF A;  3CCL A;  3R6O A;  3PGG A;  4MDW A;  5EG2 A;  2QA4 T;  4M7D G;  1JJ2 S;  3GIB A;  1K9M U;  3MCA B;  4P5N A;  1X75 C;  3M56 A;  2VGN A;  3CBM A;  4A53 A;  3JCM d;  4M7D D;  4FM4 B;  3I56 A;  2QXF A;  4PLI A;  3JSC A;  2F69 A;  1KG1 A;  3JRZ A;  2XI9 A;  4M75 F;  4ME7 A;  3WVD B;  5A2Q E;  4M7D E;  1D3B B;  4MZP A;  3CCJ A;  1BIB A;  5FRN A;  4C0F A;  3QDR B;  1N9S A;  2DXB A;  2KQW A;  4J7F A;  4PJO D;  3ZBD A;  2YLC A;  5LJ5 g;  3L2Q A;  1EIF A;  4M7D B;  3SWN C;  2KDS A;  1QW1 A;  1VQO T;  4X9D A;  3JCM P;  3MP1 A;  2RK2 A;  3TU4 K;  2LCL A;  3FEO A;  2E64 A;  1I4K 1;  1LNX A;  2E6N A;  2FVU A;  2ZPE B;  4C92 D;  4DQ2 A;  4J6X A;  1LOJ A;  4IUU A;  4XTV A;  5KE3 A;  2E41 A;  3DLL A;  3DB4 A;  3LGL A;  2MWP A;  5A0L A;  3QO3 A;  2CZ1 B;  3PIP A;  2EIF A;  2ZGW A;  3FB9 A;  1M1K U;  2F5T X;  2L89 A;  2LQK A;  4QVD A;  3DLM A;  3CCS A;  3CMA T;  1QP2 A;  5LJ3 j;  2DK3 A;  1BI3 A;  5DY9 A;  3VUZ A;  4D6W A;  1OI1 A;  1X6O A;  1O75 A;  2MAM A;  2XK0 A;  5GAO n;  2RM4 A;  4XU3 A;  3T9N A;  5FRM A;  4BUG A;  1KC8 U;  1N6A A;  3VV0 A;  3VYG A;  1AHJ B;  2DTO A;  3NTH A;  4N4I A;  1KHI A;  1I81 A;  3QUI A;  4CRI A;  4E47 A;  5DLO A;  4M75 C;  1KQS S;  4A4E A;  3PMI A;  1OZ2 A;  3CCL T;  1M90 C;  2K3Y A;  4ZGJ B;  5GMK m;  1V29 B;  1UEB A;  1ZBX A;  3OYH A;  4JS5 A;  3L2V A;  2MI6 A;  3SDZ A;  1PSE A;  3HKS A;  5CVI A;  4NL3 A;  3OMG A;  3SWN B;  1WGS A;  2QI2 A;  3RKW A;  3SB2 A;  2LX9 A;  2FL7 A;  3OBY A;  3L1A A;  3GNG A;  5HKC A;  3I55 A;  2BUD A;  1Y7X A;  2EJG A;  2I2L A;  4NOY A;  2RO0 A;  4C8Q C;  4BDY A;  1VQ6 T;  4BD3 A;  5FU6 B;  4J5Y A;  3P8D A;  3HP9 A;  2IVW A;  2VGM A;  3M55 A;  5IAY A;  5GAN g;  3CD6 A;  1W4S A;  3M57 A;  4E7J A;  1B34 A;  2CZ6 B;  2MF2 A;  2Y90 A;  2O01 E;  3MO8 A;  2EJF A;  3J80 E;  2DKG A;  2PU9 B;  2WAC A;  4MML A;  3G71 A;  3RER A;  3M54 A;  5LL6 S;  1R8O B;  5FU7 C;  3CME A;  2LCC A;  2CYZ B;  1H3Z A;  4OB3 B;  3M5A A;  4C92 A;  4ELZ C;  3MP8 A;  4HA8 A;  5LJ3 d;  4LDY A;  4F7U F;  3OYD A;  3M59 A;  4OB1 B;  1IRE B;  2VV5 A;  3M9Q A;  3CCQ T;  3GF5 A;  2CS7 A;  4J6W A;  4TVR A;  2HQE A;  4QQG A;  3S3M A;  1ZQ1 A;  2EQK A;  1KD1 U;  5D6X A;  3CBP A;  3X24 B;  5KE2 A;  2CZ7 B;  3MHX A;  2FYK A;  2LRQ A;  3LLR A;  4MZM A;  1VQ5 A;  5GMK i;  3NTI A;  4HCC A;  3RKY A;  3GNF B;  3L42 A;  5CAI A;  1Y96 A;  4V2S A;  3RES A;  5GAN 7;  5GAM f;  2JN0 A;  3HSB A;  4XTX A;  4BAC A;  2DIG A;  2FHD A;  2K2V A;  4OF1 A;  2XIC A;  3CXC S;  2JUF A;  2QQR A;  1W2B S;  1B34 B;  3MET A;  3QYG B;  2VXF A;  4BE2 A;  4M7A E;  1TH7 A;  3Q1J A;  4M77 F;  5GAN e;  3C94 A;  3ASK A;  4C5G A;  2CGH A;  4OB2 B;  4J7I A;  3P8B B;  3OYN A;  3X26 B;  3JCM f;  3DKM A;  2P0Q A;  2VC8 A;  1M1F A;  3JCM g;  4C0Z A;  1G3S A;  5FRO A;  5GAM j;  2OTL T;  2XDP A;  2DXT A;  4M78 F;  2E10 A;  4LD9 K;  5GAN j;  2JVV A;  3JCM W;  3JB9 J;  4ZN3 A;  5C6S A;  4RMO A;  2HAX A;  2X35 A;  1YIJ A;  2RJF A;  3WXM B;  4E7H A;  1Q81 C;  2H3J A;  2D6F A;  4KBM B;  4C8Q E;  4L5G A;  2RD1 A;  3LWI A;  2DZ9 A;  2M1H A;  4XAX B;  4NS5 A;  3RKX A;  3OYK A;  4ZTF A;  2OTJ T;  4QQ6 A;  2HD0 A;  3E9G A;  4C8Q D;  1G3Y A;  2EQU A;  2GFU A;  1RI0 A;  2KSS A;  2DTH A;  4JLG A;  2XDD A;  2L5Q A;  4KUI A;  4DA4 A;  3OB9 A;  1KD1 C;  2X4J A;  3CC2 A;  4C8Q G;  3C4S A;  4JRI A;  4XK8 E;  1QVG S;  2R5M A;  5HK3 A;  1YJ9 T;  3QSU A;  2K3X A;  3S3N A;  2O4X A;  4GLK A;  1VQK T;  3JCM Q;  4LD6 A;  1FX7 A;  1D3B A;  4JRQ A;  1YJW T;  4C8Q B;  4XTY A;  4FT4 A;  3A8H B;  2RK1 A;  1YHQ A;  4RKU E;  4ZGD B;  2CKK A;  4ZTJ A;  4FSX A;  3OYF A;  4M7D A;  4Y91 A;  3URG A;  4C8Q A;  3CCS T;  1HXD A;  3MEA A;  2QEX A;  3OW2 A;  2KVQ G;  4M78 C;  2LTO A;  3F70 A;  2PVG B;  2M9U A;  3O8V A;  3VKI A;  3M53 A;  3M58 A;  4ZN1 A;  3OSS C;  3LX7 A;  4IKF A;  4ATO A;  2GCX A;  1VQ9 A;  3HPW A;  1SSF A;  3QJY A;  4XU2 A;  5CQX A;  3L2U A;  3V8K A;  2XID A;  5CQY A;  1X01 A;  3HRU A;  2YLB A;  3V7R A;  2P4T A;  2GF7 A;  1Q7Y U;  5LJ5 j;  2RHU A;  3QBY A;  3OBW A;  3OS1 A;  3OYB A;  4M7A F;  4EMK C;  3OS5 A;  4ELY C;  3QG1 A;  3C95 A;  1WQ7 A;  3M4G A;  1N9R A;  1M90 U;  1U8R A;  1BI2 A;  4HCB A;  3EFS A;  4LDW A;  3HHT B;  3CCV T;  5CCA A;  2O4X B;  3H6Z A;  3VU3 C;  1G3W A;  3JCM X;  1W2B A;  1KQS A;  2LC4 A;  4LDV A;  2LT1 A;  3MP6 A;  4YTL A;  5GAM g;  5GAM e;  4QVZ A;  2V8K A;  1NJI C;  5GMK j;  3QII A;  4KUD K;  5GAN 5;  1VQ4 T;  3UWN A;  4GY5 A;  2B8A A;  5M9O A;  5LJ3 f;  1FXX A;  3QJ6 A;  5LJ3 g;  2QDY B;  3QHS A;  4N0A A;  1XNI A;  2VUB A;  1VQL A;  2LDM A;  3CME T;  1K73 C;  3GPL A;  1K8A U;  2DJZ A;  1JBM A;  3SFM A;  3CCQ A;  4M7A D;  5GAN 6;  2DZC A;  4OVA A;  5L8R E;  2Y4Y A;  3GLX A;  3CCE T;  3S6W A;  4M7A G;  4HCZ A;  4A4F A;  3CC7 A;  1YJN T;  2L8D A;  4M75 E;  3QYH B;  3V8L A;  1VQ9 T;  1VQ5 T;  4Z02 A;  1YCY A;  2QTX A;  4C92 B;  2BKD N;  5CO7 A;  4FIB A;  2YHT A;  3V7C A;  3MEV A;  1S72 A;  1HK9 A;  2F5K A;  2HBP A;  1Q81 U;  2GQV A;  2V8J A;  1U1T A;  5FU6 C;  2A7Y A;  3L2Z A;  4M75 D;  3JCM J;  3JB9 F;  3MEU A;  5IT9 E;  3A8O B;  1VQN T;  3L2R A;  2LNV A;  1JB0 E;  4FT2 A;  4M75 G;  5DM7 R;  4RCB A;  3JAM E;  5D6Y A;  2HQX A;  4BDZ A;  1K9M C;  2EQM A;  1YI2 A;  4C5H A;  2LT4 A;  4B9W A;  3LW5 E;  2JTM A;  3CD6 T;  2R5A A;  3KXT A;  1UGQ B;  3JB9 I;  1WJS A;  4M75 B;  2P0P A;  3SWN A;  2QA4 A;  3PNW C;  3TRE A;  1M9S A;  4L59 A;  1QVF A;  3TEE A;  4XQ3 A;  4BY6 C;  4M7D F;  2EAY A;  4JLI A;  4UC4 A;  3JCM c;  4C5E A;  4PJO A;  3OYG A;  2P0K A;  1YIJ T;  2DXC A;  1WJQ A;  2K57 A;  2K4Y A;  2X4W A;  5CKD A;  1K8A C;  3QZ5 B;  5LJ5 h;  1BI1 A;  3CCR A;  4KUL A;  4EMG A;  2RJE A;  1G3T A;  4BE0 A;  1VQ8 T;  2JTF A;  3JB9 G;  4IUR A;  4C0G A;  1QVG A;  1VQL T;  3X20 B;  3CC2 T;  4X9C A;  2CZ0 B;  2RH2 A;  2XG8 D;  1NPP A;  2JZ2 A;  4XU1 A;  4A4H A;  3OYJ A;  1Q7Y C;  2NLU A;  2LQ8 A;  5KCO A;  3CMA A;  5HK0 A;  1YJW A;  4IUV A;  5LJ3 e;  1M1G A;  2ZPB B;  3NFC A;  4LDU A;  1YHQ T;  3HRT A;  2X4Y A;  4PJO C;  4BE1 A;  3S3O A;  4M77 A;  1BYM A;  1VQP A;  3BY7 A;  1Y71 A;  3VUB A;  3FLG A;  4HT8 A;  3BW1 A;  3OYM A;  1UGS B;  5GAN 3;  3J81 E;  3TCJ A;  3DB3 A;  4PL6 A;  1UB4 A;  1Y96 B;  2E1H A;  5FU7 B;  5A0G A;  5IN1 A;  4EDU A;  1YIT T;  4IUQ A;  3PFS A;  5GAN f;  5J26 A;  4M7D C;  4B9X A;  3E19 A;  4DOV A;  4JRK A;  4PJO B;  3CCM T;  3OSV A;  1YI2 T;  4OB0 B;  5AYF A;  1VQ6 A;  2XHC A;  4J83 A;  3JCM V;  5D6W A;  5J3B A;  3E1S A;  3ER0 A;  1Q82 C;  3PTA A;  3OS0 A;  3RIR A;  3G4S T;  4A4G A;  4E7L A;  5GMK l;  2Y4X A;  5KCH A;  4KT0 E;  4O6J A;  2JOY A;  2G3R A;  5GAO p;  4C92 C;  2R58 A;  2DO3 A;  4FU6 A;  1WQW A;  3FDR A;  1VQ7 A;  5LJ3 h;  3I56 T;  3GOX A;  3UPU A;  4BI4 A;  3UT1 A;  3G71 T;  2VYT A;  3CEY A;  2KMT A;  2OAU A;  4OGE A;  2K5F A;  1H64 1;  2DPP B;  3CCU A;  4OGC A;  2QQ9 A;  3OY9 A;  3X25 B;  3PIO A;  2EJ9 A;  1IZ6 A;  2BIV A;  3PMT A;  2QQS A;  2ZZD A;  2RI2 A;  3QPH A;  4BB7 A;  1NJI U;  1JJ2 A;  2HNI A;  1QVF S;  3JB9 H;  1YBY A;  2PVD B;  5DLQ E;  3PT9 A;  2ZPI B;  4E7I A;  1G5V A;  2DVE A;  1OYX A;  3HFN A;  4EMH A;  3L2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...