2MWQA

Solution structure of psbq from spinacia oleracea
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxygen-evolving enhancer protein 3, chloroplastic
publication title Solution NMR and molecular dynamics reveal a persistent alpha helix within the dynamic region of PsbQ from photosystem II of higher plants.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Plant protein
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2014-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2mwqA01
3LS0A 3ZSUA 1VYKA 3LS1A 1NZEA 2MWQA 3RFYA 3JCUQ
chains in the Genus database with same CATH superfamily
1XZQA 1RKCA 2WL8A 3SXMA 5HSWA 3NG1A 3LJBA 2R9RB 2DI3A 1SYQA 4PJMA 1FTSA 4U5HA 2OJQA 1MNEA 4PJLA 4BG0A 2IXMA 4OD5A 4BJ6C 3L0IA 1OXKA 1QZXA 1WN0A 3DAFA 4U9DA 2R7RA 2IYLD 2OEVA 1BR1A 2JPUA 4O79A 2EPKX 3DJNB 3ABLC 3LLKA 2A6HF 3B0UX 2I15A 2XLOA 3FVYA 3U9JA 2EIJC 2YKZA 2ZD9A 2LFDA 3EH1A 3ZSUA 4JRZA 2EINC 4EBKA 5FZTA 4G7HF 3AQBA 1NFOA 2LK4A 3GEEA 5CI9A 1N1CA 4OD4A 3U9MA 4CSAA 1A7DA 1DOVA 3DMDA 2L6GA 4CBEA 3ZDLA 1APCA 4JW1A 2EIMC 4CS9A 3NYLA 2YLIA 5BQGA 2A0BA 1Z23A 3WODF 1Z63A 5DS4A 1JPNA 1Z7Qc 1JAFA 1TWAA 3E70C 3MFNA 4KNWA 2GWWA 1V74B 3IQ5A 2BL2A 3O39A 3RFYA 3VYWA 1EA8A 2PP4A 4BJ1A 2R7XA 3FAPB 1ZW3A 2IOQA 2WVOA 4K1OA 1LE4A 4IRUA 2Y39A 2Q9BA 4QDLA 3KMIA 4MVOA 4WGZA 3TJ5A 1OKKA 1OXBA 2D5RB 2FAPB 1M2VA 2R7OA 3I5PA 3LUTB 3JCUQ 3UR3C 4DRIB 1YA7O 3G4ZA 256BA 3VM6A 2AP3A 3LEOA 1KU2A 1OW6A 1YDIA 2A69F 3AG2C 4XLPF 4G7ZF 1CGOA 3S28A 1M57C 1OCRC 4CIHA 2KJGA 3H65A 2MHRA 4DOZA 2TMVP 1RKEA 1FAPB 5COMA 1MMDA 2Y3DA 2VC9A 2NPUA 4J30B 5F5FA 2YHSA 3LNRA 1AUEA 4ZLDA 3ZG1A 3JTLO 4G78A 4I1MA 4NQFA 3NYJA 4LDRA 4FAPB 3B0PA 4NTAA 3WG7C 1FMWA 3ZTMA 2XLWA 3UMIA 3QTHA 4DBQA 1U6HA 2OU6A 2CCYA 3HNKA 4NTFA 3V5YA 4OIPF 3B0VC 4EHPA 3UMKA 2X0CA 5A6JA 3FXHA 4LLCA 1BZ4A 4NC3A 1D1BA 1D0ZA 1Q0FA 5A6BA 1T5OA 3V7OA 4F4BA 1HE9A 1G5ZA 3EFOA 3SZRA 1ZVZA 5L0CA 2YEVA 3J06A 2Q9AA 2WVQA 4DVYP 4KNVA 3EG9A 4BJTA 3DXJF 4XQ1A 3W4YA 5L0IA 2VASA 3FDQA 3F46A 2AU5A 2P6VA 4LDKA 1Q0KA 2D4UA 2Q9CA 4J7TA 1SMYF 3C7JA 1VYKA 1NFNA 1ORJA 2PX0A 4MQ9F 2H8AA 3AGTA 4G0HA 1LI5A 4HFFB 1V4AA 2XLHA 4RD9A 1VMAA 5B1BC 3U8VA 2DGJA 3X1OA 1BDJB 4U5FE 3ZWIA 4DJ9A 2OJED 2J7PA 1DOWA 2YRFA 3LLIA 3H2UA 3SNHA 3U5SA 4YT5A 4JJGA 1LS4A 2CGEA 1NBBA 1LE2A 2YLGA 2L81A 5TJ5E 1LM3B 2KNHA 4E0IA 2KW3C 2UUHA 3B71A 3O6XA 1MMAA 1YZAA 3SYNA 1ORSC 2OG2A 2R7QA 4MVRA 1RMVA 1TWCA 2F22A 4WABA 4YK5A 2HFIA 2EIKC 2OOCA 1H9GA 3HNLA 5EHHA 5T3TA 4U5EE 3ASNC 1FFTC 1T6QA 1AVOB 2HV6A 4C7OB 4YL0A 2R7VA 4M63A 2H7BA 2L7AA 5COFA 3SXZA 3V5ZA 2LSEA 3FHDA 3KYIA 3RH3A 4YWQA 1FNTc 1LS1A 2HV7A 3FMSA 1L7CA 1V55C 2NUPB 4HFKB 4L6RA 4BJ6A 3U2MA 5JUAA 5KYNA 2P1AA 2W45A 1D1CA 3GEIA 1ST6A 1NSGB 1PV3A 5EGYA 2Q3TA 2L9JA 4W8PA 5AC5A 1G4WR 2R02A 2VCAA 3C8GA 3T4RA 4EIYA 2J0WA 2NUTB 2B0HA 1E84A 4IWBA 4EUKB 2Y3BA 3EGDA 4PR9A 4YT8A 4ANJA 5DS6A 4Q4ZF 2XXAB 2VCCA 4XEFA 2WZGA 2P0NA 2Z15A 4JJFA 2XL4A 4K0DA 1TWHA 3K6BA 4U5CE 1K40A 3FAJA 2LP4A 1OR2A 2J9VA 1SR2A 3KL4A 5B1AC 3VRCA 3LEVA 5A69A 2R7UA 2A6EF 1OW7A 1HMOA 2G3VA 3QW0A 5JLIA 1JOGA 2EPOA 2QNLA 1LIHA 3JT1A 3PMRA 1HW2A 1HW1A 1SZIA 2A68F 3K7DA 5KYUB 3MYFA 4MW3A 1TFKB 1QPUA 2DYSC 2YVKA 3DKAA 1QLEC 2J45A 3IEEA 3L34A 3M79A 3US6A 4GEHA 4N6HA 4YT4A 3X2QC 3T9OA 4JCZA 3ZQVA 1TQGA 1E2XA 5JS5A 1RKEB 1A7VA 4MS2A 2HJMA 1AEPA 1ZHXA 2LQGA 2OKUA 2LIGA 4IB4A 5COGA 1GM5A 1NLXA 2ZXOA 4J7YA 1D1AA 1LPEA 2V26A 4N06A 2OEXA 4I1OB 1VOMA 4U5DE 2IBFA 2YLDA 4LACB 4E17A 1WASA 4Z9HA 2PF4E 4MTOA 4IGGA 2IXPA 4JE9A 4UDVA 4ER9A 4HE8D 3GODA 1U0BB 3H2VA 4PACA 5JSLA 1FR0A 4JTCB 1MMNA 2WB7A 2J0XA 3K33A 4XPXA 4DRHB 1VYIA 1VB5A 2CNWD 4FX5A 3RKOF 3TOLA 2Q00A 3MBGA 2ASRA 3MX3A 3DM9B 3GM2A 3LESA 2Y3GA 4U5GA 3K1IA 1OR3A 2Q4FA 4AE4A 1EQ1A 1C02A 4MNDA 3QZCA 2KK1A 3U0CA 1EI7A 5D92A 1Q0MA 1QQ3A 1OCZC 2QLAA 5E2QA 5BQIA 1K04A 2R7WA 3POVA 5CIVA 1JPJA 1HE1A 2GFHA 1U89A 1H9TA 3BEHA 2XLMA 3G50A 3N2ZB 5AGFA 4C3EA 1BR4A 1PD0A 4LLEA 2GA0A 3DE9A 3GWNA 3KH2A 5F28E 1MNDA 2HSBA 5L0JA 1JMWA 3A11A 3V5XA 3DAGA 4Q7CA 5BUOA 2ZXRA 3EHMA 4MTFA 3ZIBA 4KC9A 4PFOA 3AG3C 4YL1A 1WOLA 4AL0A 3HNIA 4ULWA 1LI7A 1VLTA 2XL8A 5L3QA 2HZ8A 2RD9A 5KYYB 1E83A 3U2LA 1IZMA 5KYXB 1M2OA 4C3BA 4ONSA 2IM8A 1C03A 1RJ9B 4W8KA 3K1IC 2JD3A 1OCCC 3OA1A 3ZC4A 3EGXB 2ICWG 2VCBA 5FCLA 4E7SA 2VH3A 3EZHA 3UGOA 2BE5F 1YYXA 1NZEA 1S7ZA 1XZPA 2G62A 4XPYA 5JP7A 3NDBB 3RQFA 3ATPA 3S84A 3PDMP 3AGUA 1RCPA 2EPLX 2R25A 1Z6AA 3HKKA 3O10A 1I4ZA 3EJNA 4MTGA 5EK0A 4IJJA 1IW7F 3MYIA 5AC4A 3ECSA 2QY9A 3QVYA 2NG1A 3KPHA 5JRAA 3DE8A 1G8XA 1TKNA 4IAQA 4CDYA 4MVMA 5E3CA 5B3IA 1VTMP 5D91A 2J46A 3HJCA 3NRHA 3SXYA 4QI2A 4GQHA 4NTBA 2GAQA 1ZHWA 2MYSA 4OINF 4YT2A 1VK5A 3IQCA 4PJJA 4ULVA 3IQ6A 1JRAA 2R7TA 1Z5ZA 2Q7RA 1OKKD 1YA9A 1R5ID 3TJ6A 1Q0GA 2Y3HA 3S29A 3AG4C 2W4MA 1M56C 1XWJA 3NMKA 1PCXA 2JX0A 3DWWA 4J32B 3TD7A 2J8WA 3T6JA 4CJGA 4XLNF 4Q5SF 4X0RA 4Z9JA 1ZHTA 1RXQA 4A4AA 3O55A 3RVYA 4AK9A 3FOOA 2X51A 5IY5C 1MMGA 3BRJA 1CPRA 1NG1A 1L3PA 4JC7A 4N4WA 5DVWA 1D0YA 3U3FA 2R05A 4ZLCA 2V3CC 1J8MF 1YJGA 1T6UA 1ZZPA 2YQYA 2C04A 3SP1A 4XEVA 1ZHZA 3JYYA 3CZ6A 4JKVA 3UNGC 5BQHA 2J9WA 1G4US 1ZW2A 1ZYRF 3TK0A 2A0UA 2E87A 2R7SA 2XRHA 3JSZA 4YN0B 3LNMB 3NKDA 4XWJA 1LVKA 1KTMA 1LKXA 2YWAA 3EZIA 2BC5A 3EQLF 3JZ0A 3NKEA 3M1CB 3RQGA 2OQMA 3SXKA 3U3BA 5A6BD 3AG1C 3TULA 4LDQA 5CI8A 1SF8A 1Q0DA 4PK4A 3ZQYA 3DI5A 2PX3A 3JRMO 1UFBA 3MLGA 4YJWA 5T1DB 3EH2A 5A6KA 3VF0A 2AVKA 3IQTA 4NY3A 4KBLA 3M4CA 4P9TA 1OCOC 2H7VC 4KI2A 2H7OA 3OEOA 2KYHA 4P9FA 2HSQA 1T01A 3G4XA 3NMJA 4HEAJ 4RDAA 3TQOA 1HY5A 2P7VA 5L3VA 3I5QA 1M2VB 5L0FA 3C8ZA 3S90A 3F47A 4JEBA 4PJNA 2YL7A 5DQTA 1BR2A 5JVEA 3AOUA 4CS7A 3K1HA 4O6YA 2J7PD 3Q6NA 2L6HA 4C7OA 3UMHA 2LFFA 4IARA 4AX2A 4C3DA 1I4YA 1Z3IX 2YL3A 2NSFA 1YZCA 2PFDA 4WGYA 3RVZA 2KGOA 2HS5A 5KYUA 2NUPA 2M4EA 4D4XA 5K0IA 1WWPA 5KYYA 2C03A 4XTKA 3TOMA 4BJ5A 1K05A 2DYRC 5DS5A 2CW0F 1WGWA 2W9YA 3AQCA 1YYJA 3GEHA 3QW1A 4JEAA 4OIRF 2I8BA 2XS1A 2M64A 3ABKC 4JZAA 1Y4CA 3JSEO 3GM3A 3QVZA 2NUTA 3T6GB 3W8IA 3ZTZA 3JRTA 2G3KA 1A0BA 3HLZA 4MVQA 3T6BA 4EWCA 2P61A 1O3UA 4O7GA 3W2VA 2Y69C 4JURI 1MQVA 2XXAA 1B68A 1F1MA 1PD1A 3EFOB 1QKRA 2YZSA 4GYTA 1J8YF 2QTVA 1ORYA 3EG9B 1GQAA 1R4TA 5GPGB 2A1DD 4JIOA 2EILC 3C8GD 3DD7A 2J9UA 3RIPA 3B29A 4EBBA 5L0HA 4OIQF 3WAQA 1NU7D 4MVUA 4A2NB 3PHF2 5DLJA 4MVSA 2HJ3A 4BJ5C 4CJOA 4U5BE 5B3SC 4FESA 3U8PA 3W2WA 5JT4A 4OIOF 5A6AA 1W2WA 1I5NA 4NCQA 4I3MA 1H6GA 3CAXA 3ASOC 1YARO 2UUIA 2XSEA 3DM5A 3GORA 4JCHA 5L0GA 2OCCC 4MW8A 3GANA 4IAOA 1E85A 4B6IA 3Q7LA 3RF3A 4CSAC 5KYWB 1TR2A 4XPWA 2PBEA 3ITFA 4PFPA 2FGYA 4CS9C 2DB4A 3R7CA 1C17M 4K7BA 2NSGA 2WZFA 1GS9A 2AWYA 3L1MA 1D0XA 4MVZA 4G7OF 2GDCA 1ZHYA 2FFHA 2QUPA 3N0TA 2AWCA 2XLDA 1Y6DA 4H4KC 4E18A 2CDQA 3M4BA 3LS1A 2RSEB 4RBNA 1S05A 4XEKA 3HTKC 3Q7GA 4AL1A 4CX9A 4E0HA 1A41A 4Z9IA 3A9CA 2QE9A 2XM4A 3I4UA 3KKBA 4EBJA 5E33A 1CGME 3R2PA 1QVXA 2KC3A 4O6MA 1O5HA 1TWGA 4I44A 2LCHA 4QI0A 1V54C 2YL1A 3RQEA 2WZLA 2IXNA 3EHNA 3L8IA 4WJ0A 3C8GB 3RW0A 2XLVA 2B0JA 3Q6MA 4JTDB 4U9EA 1HMDA 3NMIA 3N24A 1ZU4A 5E3AA 3C63A 4FWVA 3ZVRA 4DVZA 3EGDB 2LD6A 3KYJA 4BEJA 3HNJA 3FOPA 3L8JA 1TFOB 2L6FA 3IPMO 3DZAA 2CYDA 2KSFA 3C62A 4CIPA 2HMZA 5DQZA 5KYXA 2O9XA 4CDVA 2EPNA 3S9OA 1RJ9A 3EPVA 2WVNA 1GGQA 3CSKA 4CDAA 2YL0A 1M6TA 2KQ9A 2HMQA 3EGXA 1ZU5A 3OWTA 2HUJA 2IXOA 4JVSA 1CGNA 3WHNA 3CQZA 4P6IC 4DBRA 4BPMA 2HKVA 2XLEA 1NU9C 2XS8A 1BBHA 1O87A 1T9KA 1VLSA 4CS8A 3DJUB 3S27A 3GM1A 2ZXWC 3QMKA 5L0DA 2R03A 5KYWA 1UG7A 3AJMA 4EKWA 1QSPA 2XL6A 1YAUO 3B9QA 1CPQA 1YLMA 2CNWA 2ZXPA 3CEXA 1H7IA 4DXWA 3ABMC 2W4BA 5F5HA 1WTYA 2XM0A 1JR8A 1A7EA 1OW8A 2J9BA 4YL3A 3M15A 4O6NA 3K66A 1FFHA 3C18A 3W8HA 2ZPAA 1FMVA 3LS0A 2ETSA 1E86A 1OQCA 3UGPA 4JTAB 3RYLA 3E9VA 1KNYA 4BEMJ 1T6IA 4H54A 3GWLA 4E7ZA 3NYMA 3JYHA 4CS8C 2EPMX 3IHUA 1YVIA 3VAYA 4DRJB 5HV9A 1EKYA 1WATA 3PCVA 4D4NA 4N6CA 5T3WA 4AE4B 3LAYA 3SEOA 4R32A 2PNOA 2MWQA 4LERA 3S0XA 2VB6A
chains in the Genus database with same CATH topology
2WL8A 5HSWA 3NG1A 3LJBA 4PJMA 1FTSA 4U5HA 4BG0A 1MNEA 4PJLA 2IXMA 4OD5A 4BJ6C 3L0IA 1QZXA 3DAFA 2IYLD 1BR1A 4O79A 3DJNB 3ABLC 3LLKA 2A6HF 3B0UX 3FVYA 3ZSUA 2EIJC 3EH1A 2EINC 4G7HF 3AQBA 5CI9A 1N1CA 4OD4A 4CSAA 3DMDA 4CBEA 4JW1A 2EIMC 4CS9A 3NYLA 1Z23A 3WODF 1Z63A 5DS4A 1JPNA 1TWAA 3E70C 4KNWA 3O39A 3RFYA 3VYWA 2PP4A 4BJ1A 2R7XA 2IOQA 2WVOA 4QDLA 4IRUA 2Y39A 2Q9BA 3KMIA 1OKKA 2D5RB 2R7OA 3I5PA 1M2VA 3UR3C 3JCUQ 1KU2A 2A69F 3AG2C 4XLPF 4G7ZF 3S28A 1M57C 1OCRC 4CIHA 2KJGA 3H65A 4DOZA 1MMDA 2Y3DA 4J30B 5F5FA 4ZLDA 2YHSA 3LNRA 3ZG1A 4I1MA 3NYJA 3B0PA 3WG7C 1FMWA 3UMIA 4DBQA 4OIPF 3B0VC 3UMKA 4LLCA 1D1BA 1D0ZA 3V7OA 4F4BA 3SZRA 3EFOA 2YEVA 2Q9AA 2WVQA 4DVYP 4KNVA 3EG9A 4BJTA 3DXJF 2VASA 3FDQA 3F46A 2P6VA 2Q9CA 1SMYF 1VYKA 2PX0A 4MQ9F 4HFFB 4G0HA 5B1BC 4RD9A 1VMAA 2DGJA 3X1OA 4U5FE 2J7PA 3LLIA 3SNHA 4YT5A 4JJGA 2CGEA 2L81A 2KNHA 2KW3C 3O6XA 1MMAA 3SYNA 2OG2A 2R7QA 1TWCA 2EIKC 5EHHA 5T3TA 4U5EE 3ASNC 1FFTC 2HV6A 4C7OB 2R7VA 4M63A 2H7BA 2LSEA 3FHDA 3RH3A 4YWQA 1LS1A 2HV7A 5KYUB 1V55C 2NUPB 4HFKB 5KYNA 5KYYB 4BJ6A 2W45A 1D1CA 1ST6A 5EGYA 2Q3TA 2L9JA 3T4RA 2J0WA 2NUTB 4IWBA 2Y3BA 3EGDA 4YT8A 5DS6A 4Q4ZF 2XXAB 2WZGA 4JJFA 2Z15A 2XL4A 4K0DA 1TWHA 3K6BA 4U5CE 3FAJA 2J9VA 3KL4A 5B1AC 3LEVA 2R7UA 2A6EF 2G3VA 3JT1A 3PMRA 3K7DA 1SZIA 2A68F 2DYSC 3IEEA 1QLEC 2J45A 3L34A 4GEHA 4YT4A 3X2QC 1ZHXA 2ZXOA 1D1AA 2V26A 4N06A 4I1OB 1VOMA 4U5DE 4LACB 2PF4E 2IXPA 4HE8D 3GODA 1MMNA 3K33A 2WB7A 2J0XA 1VYIA 2CNWD 4FX5A 3RKOF 2R7RA 3MX3A 4U5GA 4ANJA 3DM9B 3LESA 2Y3GA 4AE4A 4MNDA 3QZCA 5D92A 3POVA 1OCZC 5E2QA 2R7WA 1JPJA 2GFHA 3N2ZB 4C3EA 1BR4A 1PD0A 4LLEA 3KH2A 1MNDA 3DAGA 4Q7CA 5BUOA 2ZXRA 3EHMA 3ZIBA 4KC9A 4PFOA 3AG3C 4ULWA 5L3QA 1IZMA 5KYXB 1M2OA 4C3BA 1RJ9B 4W8KA 3K1IC 2JD3A 1OCCC 3OA1A 3ZC4A 3EGXB 5FCLA 4E7SA 2VH3A 3EZHA 3UGOA 2BE5F 1NZEA 1S7ZA 2G62A 3NDBB 5KYWB 1Z6AA 3EJNA 4IJJA 1IW7F 3ECSA 2QY9A 2NG1A 1G8XA 1TKNA 5E3CA 5D91A 2J46A 3HJCA 3NRHA 4QI2A 2MYSA 1ZHWA 4OINF 4YT2A 1VK5A 4PJJA 2R7TA 1Z5ZA 1OKKD 2Y3HA 3S29A 3AG4C 2W4MA 1M56C 1PCXA 4J32B 3TD7A 3T6JA 4XLNF 4Q5SF 4X0RA 1ZHTA 4AK9A 2X51A 5IY5C 1MMGA 1NG1A 5DVWA 2V3CC 1D0YA 4ZLCA 1J8MF 3SP1A 2C04A 1ZHZA 3CZ6A 3UNGC 2J9WA 1ZYRF 2E87A 2R7SA 2XRHA 3JSZA 4YN0B 3NKDA 4XWJA 1LVKA 1LKXA 3EZIA 3EQLF 3NKEA 3M1CB 3AG1C 5CI8A 1SF8A 4PK4A 2PX3A 3MLGA 4YJWA 5T1DB 3EH2A 4NY3A 4KBLA 1OCOC 2H7VC 4KI2A 2H7OA 3OEOA 5L3VA 4HEAJ 4RDAA 2P7VA 3I5QA 1M2VB 3F47A 4PJNA 5DQTA 1BR2A 4CS7A 3K1HA 4O6YA 2J7PD 3Q6NA 4C7OA 3UMHA 4AX2A 4C3DA 1Z3IX 2PFDA 2KGOA 5KYUA 5KYYA 2NUPA 2M4EA 2C03A 4XTKA 4BJ5A 5DS5A 2DYRC 2CW0F 1WGWA 2W9YA 3AQCA 4OIRF 2I8BA 4JZAA 3ABKC 2NUTA 3W8IA 3JRTA 2G3KA 3HLZA 3T6BA 4EWCA 4O7GA 3W2VA 2Y69C 4JURI 2XXAA 1PD1A 3EFOB 2YZSA 4GYTA 1J8YF 2QTVA 3EG9B 2A1DD 2EILC 3DD7A 4EBBA 2J9UA 3RIPA 4OIQF 1NU7D 4A2NB 3PHF2 5DLJA 4BJ5C 4U5BE 5B3SC 4FESA 3W2WA 4OIOF 1W2WA 4I3MA 3ASOC 2XSEA 3DM5A 4JCHA 2OCCC 3GANA 4IAOA 4B6IA 3Q7LA 4CSAC 1TR2A 3ITFA 4PFPA 2FGYA 4CS9C 4K7BA 2WZFA 1D0XA 4G7OF 1ZHYA 2FFHA 3N0TA 4H4KC 2CDQA 3LS1A 4RBNA 3HTKC 3Q7GA 3KKBA 3I4UA 5E33A 4O6MA 1O5HA 1TWGA 4I44A 4QI0A 1V54C 2WZLA 2IXNA 3EHNA 4WJ0A 2B0JA 3Q6MA 3N24A 1ZU4A 5E3AA 4FWVA 3ZVRA 3EGDB 4BEJA 3DZAA 5DQZA 5KYXA 2O9XA 1RJ9A 3EPVA 2WVNA 3CSKA 4DVZA 3EGXA 4JVSA 2KQ9A 3OWTA 1ZU5A 2IXOA 3CQZA 4P6IC 1NU9C 1O87A 4CS8A 3DJUB 3S27A 2ZXWC 3QMKA 5KYWA 3B9QA 2CNWA 2ZXPA 3ABMC 2W4BA 5F5HA 4O6NA 3K66A 1FFHA 3W8HA 2ZPAA 1FMVA 3LS0A 3UGPA 3RYLA 3E9VA 4E7ZA 3NYMA 3JYHA 4CS8C 3VAYA 5T3WA 4AE4B 3LAYA 3SEOA 4DBRA 2MWQA 4LERA 3S0XA 2VB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS0 A;  3ZSU A;  1VYK A;  3LS1 A;  1NZE A;  2MWQ A;  3RFY A;  3JCU Q; 
#chains in the Genus database with same CATH topology
 1XZQ A;  1RKC A;  2WL8 A;  3SXM A;  5HSW A;  3NG1 A;  3LJB A;  2R9R B;  2DI3 A;  1SYQ A;  4PJM A;  1FTS A;  4U5H A;  2OJQ A;  1MNE A;  4PJL A;  4BG0 A;  2IXM A;  4OD5 A;  4BJ6 C;  3L0I A;  1OXK A;  1QZX A;  1WN0 A;  3DAF A;  4U9D A;  2R7R A;  2IYL D;  2OEV A;  1BR1 A;  2JPU A;  4O79 A;  2EPK X;  3DJN B;  3ABL C;  3LLK A;  2A6H F;  3B0U X;  2I15 A;  2XLO A;  3FVY A;  3U9J A;  2EIJ C;  2YKZ A;  2ZD9 A;  2LFD A;  3EH1 A;  3ZSU A;  4JRZ A;  2EIN C;  4EBK A;  5FZT A;  4G7H F;  3AQB A;  1NFO A;  2LK4 A;  3GEE A;  5CI9 A;  1N1C A;  4OD4 A;  3U9M A;  4CSA A;  1A7D A;  1DOV A;  3DMD A;  2L6G A;  4CBE A;  3ZDL A;  1APC A;  4JW1 A;  2EIM C;  4CS9 A;  3NYL A;  2YLI A;  5BQG A;  2A0B A;  1Z23 A;  3WOD F;  1Z63 A;  5DS4 A;  1JPN A;  1Z7Q c;  1JAF A;  1TWA A;  3E70 C;  3MFN A;  4KNW A;  2GWW A;  1V74 B;  3IQ5 A;  2BL2 A;  3O39 A;  3RFY A;  3VYW A;  1EA8 A;  2PP4 A;  4BJ1 A;  2R7X A;  3FAP B;  1ZW3 A;  2IOQ A;  2WVO A;  4K1O A;  1LE4 A;  4IRU A;  2Y39 A;  2Q9B A;  4QDL A;  3KMI A;  4MVO A;  4WGZ A;  3TJ5 A;  1OKK A;  1OXB A;  2D5R B;  2FAP B;  1M2V A;  2R7O A;  3I5P A;  3LUT B;  3JCU Q;  3UR3 C;  4DRI B;  1YA7 O;  3G4Z A;  256B A;  3VM6 A;  2AP3 A;  3LEO A;  1KU2 A;  1OW6 A;  1YDI A;  2A69 F;  3AG2 C;  4XLP F;  4G7Z F;  1CGO A;  3S28 A;  1M57 C;  1OCR C;  4CIH A;  2KJG A;  3H65 A;  2MHR A;  4DOZ A;  2TMV P;  1RKE A;  1FAP B;  5COM A;  1MMD A;  2Y3D A;  2VC9 A;  2NPU A;  4J30 B;  5F5F A;  2YHS A;  3LNR A;  1AUE A;  4ZLD A;  3ZG1 A;  3JTL O;  4G78 A;  4I1M A;  4NQF A;  3NYJ A;  4LDR A;  4FAP B;  3B0P A;  4NTA A;  3WG7 C;  1FMW A;  3ZTM A;  2XLW A;  3UMI A;  3QTH A;  4DBQ A;  1U6H A;  2OU6 A;  2CCY A;  3HNK A;  4NTF A;  3V5Y A;  4OIP F;  3B0V C;  4EHP A;  3UMK A;  2X0C A;  5A6J A;  3FXH A;  4LLC A;  1BZ4 A;  4NC3 A;  1D1B A;  1D0Z A;  1Q0F A;  5A6B A;  1T5O A;  3V7O A;  4F4B A;  1HE9 A;  1G5Z A;  3EFO A;  3SZR A;  1ZVZ A;  5L0C A;  2YEV A;  3J06 A;  2Q9A A;  2WVQ A;  4DVY P;  4KNV A;  3EG9 A;  4BJT A;  3DXJ F;  4XQ1 A;  3W4Y A;  5L0I A;  2VAS A;  3FDQ A;  3F46 A;  2AU5 A;  2P6V A;  4LDK A;  1Q0K A;  2D4U A;  2Q9C A;  4J7T A;  1SMY F;  3C7J A;  1VYK A;  1NFN A;  1ORJ A;  2PX0 A;  4MQ9 F;  2H8A A;  3AGT A;  4G0H A;  1LI5 A;  4HFF B;  1V4A A;  2XLH A;  4RD9 A;  1VMA A;  5B1B C;  3U8V A;  2DGJ A;  3X1O A;  1BDJ B;  4U5F E;  3ZWI A;  4DJ9 A;  2OJE D;  2J7P A;  1DOW A;  2YRF A;  3LLI A;  3H2U A;  3SNH A;  3U5S A;  4YT5 A;  4JJG A;  1LS4 A;  2CGE A;  1NBB A;  1LE2 A;  2YLG A;  2L81 A;  5TJ5 E;  1LM3 B;  2KNH A;  4E0I A;  2KW3 C;  2UUH A;  3B71 A;  3O6X A;  1MMA A;  1YZA A;  3SYN A;  1ORS C;  2OG2 A;  2R7Q A;  4MVR A;  1RMV A;  1TWC A;  2F22 A;  4WAB A;  4YK5 A;  2HFI A;  2EIK C;  2OOC A;  1H9G A;  3HNL A;  5EHH A;  5T3T A;  4U5E E;  3ASN C;  1FFT C;  1T6Q A;  1AVO B;  2HV6 A;  4C7O B;  4YL0 A;  2R7V A;  4M63 A;  2H7B A;  2L7A A;  5COF A;  3SXZ A;  3V5Z A;  2LSE A;  3FHD A;  3KYI A;  3RH3 A;  4YWQ A;  1FNT c;  1LS1 A;  2HV7 A;  3FMS A;  1L7C A;  1V55 C;  2NUP B;  4HFK B;  4L6R A;  4BJ6 A;  3U2M A;  5JUA A;  5KYN A;  2P1A A;  2W45 A;  1D1C A;  3GEI A;  1ST6 A;  1NSG B;  1PV3 A;  5EGY A;  2Q3T A;  2L9J A;  4W8P A;  5AC5 A;  1G4W R;  2R02 A;  2VCA A;  3C8G A;  3T4R A;  4EIY A;  2J0W A;  2NUT B;  2B0H A;  1E84 A;  4IWB A;  4EUK B;  2Y3B A;  3EGD A;  4PR9 A;  4YT8 A;  4ANJ A;  5DS6 A;  4Q4Z F;  2XXA B;  2VCC A;  4XEF A;  2WZG A;  2P0N A;  2Z15 A;  4JJF A;  2XL4 A;  4K0D A;  1TWH A;  3K6B A;  4U5C E;  1K40 A;  3FAJ A;  2LP4 A;  1OR2 A;  2J9V A;  1SR2 A;  3KL4 A;  5B1A C;  3VRC A;  3LEV A;  5A69 A;  2R7U A;  2A6E F;  1OW7 A;  1HMO A;  2G3V A;  3QW0 A;  5JLI A;  1JOG A;  2EPO A;  2QNL A;  1LIH A;  3JT1 A;  3PMR A;  1HW2 A;  1HW1 A;  1SZI A;  2A68 F;  3K7D A;  5KYU B;  3MYF A;  4MW3 A;  1TFK B;  1QPU A;  2DYS C;  2YVK A;  3DKA A;  1QLE C;  2J45 A;  3IEE A;  3L34 A;  3M79 A;  3US6 A;  4GEH A;  4N6H A;  4YT4 A;  3X2Q C;  3T9O A;  4JCZ A;  3ZQV A;  1TQG A;  1E2X A;  5JS5 A;  1RKE B;  1A7V A;  4MS2 A;  2HJM A;  1AEP A;  1ZHX A;  2LQG A;  2OKU A;  2LIG A;  4IB4 A;  5COG A;  1GM5 A;  1NLX A;  2ZXO A;  4J7Y A;  1D1A A;  1LPE A;  2V26 A;  4N06 A;  2OEX A;  4I1O B;  1VOM A;  4U5D E;  2IBF A;  2YLD A;  4LAC B;  4E17 A;  1WAS A;  4Z9H A;  2PF4 E;  4MTO A;  4IGG A;  2IXP A;  4JE9 A;  4UDV A;  4ER9 A;  4HE8 D;  3GOD A;  1U0B B;  3H2V A;  4PAC A;  5JSL A;  1FR0 A;  4JTC B;  1MMN A;  2WB7 A;  2J0X A;  3K33 A;  4XPX A;  4DRH B;  1VYI A;  1VB5 A;  2CNW D;  4FX5 A;  3RKO F;  3TOL A;  2Q00 A;  3MBG A;  2ASR A;  3MX3 A;  3DM9 B;  3GM2 A;  3LES A;  2Y3G A;  4U5G A;  3K1I A;  1OR3 A;  2Q4F A;  4AE4 A;  1EQ1 A;  1C02 A;  4MND A;  3QZC A;  2KK1 A;  3U0C A;  1EI7 A;  5D92 A;  1Q0M A;  1QQ3 A;  1OCZ C;  2QLA A;  5E2Q A;  5BQI A;  1K04 A;  2R7W A;  3POV A;  5CIV A;  1JPJ A;  1HE1 A;  2GFH A;  1U89 A;  1H9T A;  3BEH A;  2XLM A;  3G50 A;  3N2Z B;  5AGF A;  4C3E A;  1BR4 A;  1PD0 A;  4LLE A;  2GA0 A;  3DE9 A;  3GWN A;  3KH2 A;  5F28 E;  1MND A;  2HSB A;  5L0J A;  1JMW A;  3A11 A;  3V5X A;  3DAG A;  4Q7C A;  5BUO A;  2ZXR A;  3EHM A;  4MTF A;  3ZIB A;  4KC9 A;  4PFO A;  3AG3 C;  4YL1 A;  1WOL A;  4AL0 A;  3HNI A;  4ULW A;  1LI7 A;  1VLT A;  2XL8 A;  5L3Q A;  2HZ8 A;  2RD9 A;  5KYY B;  1E83 A;  3U2L A;  1IZM A;  5KYX B;  1M2O A;  4C3B A;  4ONS A;  2IM8 A;  1C03 A;  1RJ9 B;  4W8K A;  3K1I C;  2JD3 A;  1OCC C;  3OA1 A;  3ZC4 A;  3EGX B;  2ICW G;  2VCB A;  5FCL A;  4E7S A;  2VH3 A;  3EZH A;  3UGO A;  2BE5 F;  1YYX A;  1NZE A;  1S7Z A;  1XZP A;  2G62 A;  4XPY A;  5JP7 A;  3NDB B;  3RQF A;  3ATP A;  3S84 A;  3PDM P;  3AGU A;  1RCP A;  2EPL X;  2R25 A;  1Z6A A;  3HKK A;  3O10 A;  1I4Z A;  3EJN A;  4MTG A;  5EK0 A;  4IJJ A;  1IW7 F;  3MYI A;  5AC4 A;  3ECS A;  2QY9 A;  3QVY A;  2NG1 A;  3KPH A;  5JRA A;  3DE8 A;  1G8X A;  1TKN A;  4IAQ A;  4CDY A;  4MVM A;  5E3C A;  5B3I A;  1VTM P;  5D91 A;  2J46 A;  3HJC A;  3NRH A;  3SXY A;  4QI2 A;  4GQH A;  4NTB A;  2GAQ A;  1ZHW A;  2MYS A;  4OIN F;  4YT2 A;  1VK5 A;  3IQC A;  4PJJ A;  4ULV A;  3IQ6 A;  1JRA A;  2R7T A;  1Z5Z A;  2Q7R A;  1OKK D;  1YA9 A;  1R5I D;  3TJ6 A;  1Q0G A;  2Y3H A;  3S29 A;  3AG4 C;  2W4M A;  1M56 C;  1XWJ A;  3NMK A;  1PCX A;  2JX0 A;  3DWW A;  4J32 B;  3TD7 A;  2J8W A;  3T6J A;  4CJG A;  4XLN F;  4Q5S F;  4X0R A;  4Z9J A;  1ZHT A;  1RXQ A;  4A4A A;  3O55 A;  3RVY A;  4AK9 A;  3FOO A;  2X51 A;  5IY5 C;  1MMG A;  3BRJ A;  1CPR A;  1NG1 A;  1L3P A;  4JC7 A;  4N4W A;  5DVW A;  1D0Y A;  3U3F A;  2R05 A;  4ZLC A;  2V3C C;  1J8M F;  1YJG A;  1T6U A;  1ZZP A;  2YQY A;  2C04 A;  3SP1 A;  4XEV A;  1ZHZ A;  3JYY A;  3CZ6 A;  4JKV A;  3UNG C;  5BQH A;  2J9W A;  1G4U S;  1ZW2 A;  1ZYR F;  3TK0 A;  2A0U A;  2E87 A;  2R7S A;  2XRH A;  3JSZ A;  4YN0 B;  3LNM B;  3NKD A;  4XWJ A;  1LVK A;  1KTM A;  1LKX A;  2YWA A;  3EZI A;  2BC5 A;  3EQL F;  3JZ0 A;  3NKE A;  3M1C B;  3RQG A;  2OQM A;  3SXK A;  3U3B A;  5A6B D;  3AG1 C;  3TUL A;  4LDQ A;  5CI8 A;  1SF8 A;  1Q0D A;  4PK4 A;  3ZQY A;  3DI5 A;  2PX3 A;  3JRM O;  1UFB A;  3MLG A;  4YJW A;  5T1D B;  3EH2 A;  5A6K A;  3VF0 A;  2AVK A;  3IQT A;  4NY3 A;  4KBL A;  3M4C A;  4P9T A;  1OCO C;  2H7V C;  4KI2 A;  2H7O A;  3OEO A;  2KYH A;  4P9F A;  2HSQ A;  1T01 A;  3G4X A;  3NMJ A;  4HEA J;  4RDA A;  3TQO A;  1HY5 A;  2P7V A;  5L3V A;  3I5Q A;  1M2V B;  5L0F A;  3C8Z A;  3S90 A;  3F47 A;  4JEB A;  4PJN A;  2YL7 A;  5DQT A;  1BR2 A;  5JVE A;  3AOU A;  4CS7 A;  3K1H A;  4O6Y A;  2J7P D;  3Q6N A;  2L6H A;  4C7O A;  3UMH A;  2LFF A;  4IAR A;  4AX2 A;  4C3D A;  1I4Y A;  1Z3I X;  2YL3 A;  2NSF A;  1YZC A;  2PFD A;  4WGY A;  3RVZ A;  2KGO A;  2HS5 A;  5KYU A;  2NUP A;  2M4E A;  4D4X A;  5K0I A;  1WWP A;  5KYY A;  2C03 A;  4XTK A;  3TOM A;  4BJ5 A;  1K05 A;  2DYR C;  5DS5 A;  2CW0 F;  1WGW A;  2W9Y A;  3AQC A;  1YYJ A;  3GEH A;  3QW1 A;  4JEA A;  4OIR F;  2I8B A;  2XS1 A;  2M64 A;  3ABK C;  4JZA A;  1Y4C A;  3JSE O;  3GM3 A;  3QVZ A;  2NUT A;  3T6G B;  3W8I A;  3ZTZ A;  3JRT A;  2G3K A;  1A0B A;  3HLZ A;  4MVQ A;  3T6B A;  4EWC A;  2P61 A;  1O3U A;  4O7G A;  3W2V A;  2Y69 C;  4JUR I;  1MQV A;  2XXA A;  1B68 A;  1F1M A;  1PD1 A;  3EFO B;  1QKR A;  2YZS A;  4GYT A;  1J8Y F;  2QTV A;  1ORY A;  3EG9 B;  1GQA A;  1R4T A;  5GPG B;  2A1D D;  4JIO A;  2EIL C;  3C8G D;  3DD7 A;  2J9U A;  3RIP A;  3B29 A;  4EBB A;  5L0H A;  4OIQ F;  3WAQ A;  1NU7 D;  4MVU A;  4A2N B;  3PHF 2;  5DLJ A;  4MVS A;  2HJ3 A;  4BJ5 C;  4CJO A;  4U5B E;  5B3S C;  4FES A;  3U8P A;  3W2W A;  5JT4 A;  4OIO F;  5A6A A;  1W2W A;  1I5N A;  4NCQ A;  4I3M A;  1H6G A;  3CAX A;  3ASO C;  1YAR O;  2UUI A;  2XSE A;  3DM5 A;  3GOR A;  4JCH A;  5L0G A;  2OCC C;  4MW8 A;  3GAN A;  4IAO A;  1E85 A;  4B6I A;  3Q7L A;  3RF3 A;  4CSA C;  5KYW B;  1TR2 A;  4XPW A;  2PBE A;  3ITF A;  4PFP A;  2FGY A;  4CS9 C;  2DB4 A;  3R7C A;  1C17 M;  4K7B A;  2NSG A;  2WZF A;  1GS9 A;  2AWY A;  3L1M A;  1D0X A;  4MVZ A;  4G7O F;  2GDC A;  1ZHY A;  2FFH A;  2QUP A;  3N0T A;  2AWC A;  2XLD A;  1Y6D A;  4H4K C;  4E18 A;  2CDQ A;  3M4B A;  3LS1 A;  2RSE B;  4RBN A;  1S05 A;  4XEK A;  3HTK C;  3Q7G A;  4AL1 A;  4CX9 A;  4E0H A;  1A41 A;  4Z9I A;  3A9C A;  2QE9 A;  2XM4 A;  3I4U A;  3KKB A;  4EBJ A;  5E33 A;  1CGM E;  3R2P A;  1QVX A;  2KC3 A;  4O6M A;  1O5H A;  1TWG A;  4I44 A;  2LCH A;  4QI0 A;  1V54 C;  2YL1 A;  3RQE A;  2WZL A;  2IXN A;  3EHN A;  3L8I A;  4WJ0 A;  3C8G B;  3RW0 A;  2XLV A;  2B0J A;  3Q6M A;  4JTD B;  4U9E A;  1HMD A;  3NMI A;  3N24 A;  1ZU4 A;  5E3A A;  3C63 A;  4FWV A;  3ZVR A;  4DVZ A;  3EGD B;  2LD6 A;  3KYJ A;  4BEJ A;  3HNJ A;  3FOP A;  3L8J A;  1TFO B;  2L6F A;  3IPM O;  3DZA A;  2CYD A;  2KSF A;  3C62 A;  4CIP A;  2HMZ A;  5DQZ A;  5KYX A;  2O9X A;  4CDV A;  2EPN A;  3S9O A;  1RJ9 A;  3EPV A;  2WVN A;  1GGQ A;  3CSK A;  4CDA A;  2YL0 A;  1M6T A;  2KQ9 A;  2HMQ A;  3EGX A;  1ZU5 A;  3OWT A;  2HUJ A;  2IXO A;  4JVS A;  1CGN A;  3WHN A;  3CQZ A;  4P6I C;  4DBR A;  4BPM A;  2HKV A;  2XLE A;  1NU9 C;  2XS8 A;  1BBH A;  1O87 A;  1T9K A;  1VLS A;  4CS8 A;  3DJU B;  3S27 A;  3GM1 A;  2ZXW C;  3QMK A;  5L0D A;  2R03 A;  5KYW A;  1UG7 A;  3AJM A;  4EKW A;  1QSP A;  2XL6 A;  1YAU O;  3B9Q A;  1CPQ A;  1YLM A;  2CNW A;  2ZXP A;  3CEX A;  1H7I A;  4DXW A;  3ABM C;  2W4B A;  5F5H A;  1WTY A;  2XM0 A;  1JR8 A;  1A7E A;  1OW8 A;  2J9B A;  4YL3 A;  3M15 A;  4O6N A;  3K66 A;  1FFH A;  3C18 A;  3W8H A;  2ZPA A;  1FMV A;  3LS0 A;  2ETS A;  1E86 A;  1OQC A;  3UGP A;  4JTA B;  3RYL A;  3E9V A;  1KNY A;  4BEM J;  1T6I A;  4H54 A;  3GWL A;  4E7Z A;  3NYM A;  3JYH A;  4CS8 C;  2EPM X;  3IHU A;  1YVI A;  3VAY A;  4DRJ B;  5HV9 A;  1EKY A;  1WAT A;  3PCV A;  4D4N A;  4N6C A;  5T3W A;  4AE4 B;  3LAY A;  3SEO A;  4R32 A;  2PNO A;  2MWQ A;  4LER A;  3S0X A;  2VB6 A; 
#chains in the Genus database with same CATH homology
 2WL8 A;  5HSW A;  3NG1 A;  3LJB A;  4PJM A;  1FTS A;  4U5H A;  4BG0 A;  1MNE A;  4PJL A;  2IXM A;  4OD5 A;  4BJ6 C;  3L0I A;  1QZX A;  3DAF A;  2IYL D;  1BR1 A;  4O79 A;  3DJN B;  3ABL C;  3LLK A;  2A6H F;  3B0U X;  3FVY A;  3ZSU A;  2EIJ C;  3EH1 A;  2EIN C;  4G7H F;  3AQB A;  5CI9 A;  1N1C A;  4OD4 A;  4CSA A;  3DMD A;  4CBE A;  4JW1 A;  2EIM C;  4CS9 A;  3NYL A;  1Z23 A;  3WOD F;  1Z63 A;  5DS4 A;  1JPN A;  1TWA A;  3E70 C;  4KNW A;  3O39 A;  3RFY A;  3VYW A;  2PP4 A;  4BJ1 A;  2R7X A;  2IOQ A;  2WVO A;  4QDL A;  4IRU A;  2Y39 A;  2Q9B A;  3KMI A;  1OKK A;  2D5R B;  2R7O A;  3I5P A;  1M2V A;  3UR3 C;  3JCU Q;  1KU2 A;  2A69 F;  3AG2 C;  4XLP F;  4G7Z F;  3S28 A;  1M57 C;  1OCR C;  4CIH A;  2KJG A;  3H65 A;  4DOZ A;  1MMD A;  2Y3D A;  4J30 B;  5F5F A;  4ZLD A;  2YHS A;  3LNR A;  3ZG1 A;  4I1M A;  3NYJ A;  3B0P A;  3WG7 C;  1FMW A;  3UMI A;  4DBQ A;  4OIP F;  3B0V C;  3UMK A;  4LLC A;  1D1B A;  1D0Z A;  3V7O A;  4F4B A;  3SZR A;  3EFO A;  2YEV A;  2Q9A A;  2WVQ A;  4DVY P;  4KNV A;  3EG9 A;  4BJT A;  3DXJ F;  2VAS A;  3FDQ A;  3F46 A;  2P6V A;  2Q9C A;  1SMY F;  1VYK A;  2PX0 A;  4MQ9 F;  4HFF B;  4G0H A;  5B1B C;  4RD9 A;  1VMA A;  2DGJ A;  3X1O A;  4U5F E;  2J7P A;  3LLI A;  3SNH A;  4YT5 A;  4JJG A;  2CGE A;  2L81 A;  2KNH A;  2KW3 C;  3O6X A;  1MMA A;  3SYN A;  2OG2 A;  2R7Q A;  1TWC A;  2EIK C;  5EHH A;  5T3T A;  4U5E E;  3ASN C;  1FFT C;  2HV6 A;  4C7O B;  2R7V A;  4M63 A;  2H7B A;  2LSE A;  3FHD A;  3RH3 A;  4YWQ A;  1LS1 A;  2HV7 A;  5KYU B;  1V55 C;  2NUP B;  4HFK B;  5KYN A;  5KYY B;  4BJ6 A;  2W45 A;  1D1C A;  1ST6 A;  5EGY A;  2Q3T A;  2L9J A;  3T4R A;  2J0W A;  2NUT B;  4IWB A;  2Y3B A;  3EGD A;  4YT8 A;  5DS6 A;  4Q4Z F;  2XXA B;  2WZG A;  4JJF A;  2Z15 A;  2XL4 A;  4K0D A;  1TWH A;  3K6B A;  4U5C E;  3FAJ A;  2J9V A;  3KL4 A;  5B1A C;  3LEV A;  2R7U A;  2A6E F;  2G3V A;  3JT1 A;  3PMR A;  3K7D A;  1SZI A;  2A68 F;  2DYS C;  3IEE A;  1QLE C;  2J45 A;  3L34 A;  4GEH A;  4YT4 A;  3X2Q C;  1ZHX A;  2ZXO A;  1D1A A;  2V26 A;  4N06 A;  4I1O B;  1VOM A;  4U5D E;  4LAC B;  2PF4 E;  2IXP A;  4HE8 D;  3GOD A;  1MMN A;  3K33 A;  2WB7 A;  2J0X A;  1VYI A;  2CNW D;  4FX5 A;  3RKO F;  2R7R A;  3MX3 A;  4U5G A;  4ANJ A;  3DM9 B;  3LES A;  2Y3G A;  4AE4 A;  4MND A;  3QZC A;  5D92 A;  3POV A;  1OCZ C;  5E2Q A;  2R7W A;  1JPJ A;  2GFH A;  3N2Z B;  4C3E A;  1BR4 A;  1PD0 A;  4LLE A;  3KH2 A;  1MND A;  3DAG A;  4Q7C A;  5BUO A;  2ZXR A;  3EHM A;  3ZIB A;  4KC9 A;  4PFO A;  3AG3 C;  4ULW A;  5L3Q A;  1IZM A;  5KYX B;  1M2O A;  4C3B A;  1RJ9 B;  4W8K A;  3K1I C;  2JD3 A;  1OCC C;  3OA1 A;  3ZC4 A;  3EGX B;  5FCL A;  4E7S A;  2VH3 A;  3EZH A;  3UGO A;  2BE5 F;  1NZE A;  1S7Z A;  2G62 A;  3NDB B;  5KYW B;  1Z6A A;  3EJN A;  4IJJ A;  1IW7 F;  3ECS A;  2QY9 A;  2NG1 A;  1G8X A;  1TKN A;  5E3C A;  5D91 A;  2J46 A;  3HJC A;  3NRH A;  4QI2 A;  2MYS A;  1ZHW A;  4OIN F;  4YT2 A;  1VK5 A;  4PJJ A;  2R7T A;  1Z5Z A;  1OKK D;  2Y3H A;  3S29 A;  3AG4 C;  2W4M A;  1M56 C;  1PCX A;  4J32 B;  3TD7 A;  3T6J A;  4XLN F;  4Q5S F;  4X0R A;  1ZHT A;  4AK9 A;  2X51 A;  5IY5 C;  1MMG A;  1NG1 A;  5DVW A;  2V3C C;  1D0Y A;  4ZLC A;  1J8M F;  3SP1 A;  2C04 A;  1ZHZ A;  3CZ6 A;  3UNG C;  2J9W A;  1ZYR F;  2E87 A;  2R7S A;  2XRH A;  3JSZ A;  4YN0 B;  3NKD A;  4XWJ A;  1LVK A;  1LKX A;  3EZI A;  3EQL F;  3NKE A;  3M1C B;  3AG1 C;  5CI8 A;  1SF8 A;  4PK4 A;  2PX3 A;  3MLG A;  4YJW A;  5T1D B;  3EH2 A;  4NY3 A;  4KBL A;  1OCO C;  2H7V C;  4KI2 A;  2H7O A;  3OEO A;  5L3V A;  4HEA J;  4RDA A;  2P7V A;  3I5Q A;  1M2V B;  3F47 A;  4PJN A;  5DQT A;  1BR2 A;  4CS7 A;  3K1H A;  4O6Y A;  2J7P D;  3Q6N A;  4C7O A;  3UMH A;  4AX2 A;  4C3D A;  1Z3I X;  2PFD A;  2KGO A;  5KYU A;  5KYY A;  2NUP A;  2M4E A;  2C03 A;  4XTK A;  4BJ5 A;  5DS5 A;  2DYR C;  2CW0 F;  1WGW A;  2W9Y A;  3AQC A;  4OIR F;  2I8B A;  4JZA A;  3ABK C;  2NUT A;  3W8I A;  3JRT A;  2G3K A;  3HLZ A;  3T6B A;  4EWC A;  4O7G A;  3W2V A;  2Y69 C;  4JUR I;  2XXA A;  1PD1 A;  3EFO B;  2YZS A;  4GYT A;  1J8Y F;  2QTV A;  3EG9 B;  2A1D D;  2EIL C;  3DD7 A;  4EBB A;  2J9U A;  3RIP A;  4OIQ F;  1NU7 D;  4A2N B;  3PHF 2;  5DLJ A;  4BJ5 C;  4U5B E;  5B3S C;  4FES A;  3W2W A;  4OIO F;  1W2W A;  4I3M A;  3ASO C;  2XSE A;  3DM5 A;  4JCH A;  2OCC C;  3GAN A;  4IAO A;  4B6I A;  3Q7L A;  4CSA C;  1TR2 A;  3ITF A;  4PFP A;  2FGY A;  4CS9 C;  4K7B A;  2WZF A;  1D0X A;  4G7O F;  1ZHY A;  2FFH A;  3N0T A;  4H4K C;  2CDQ A;  3LS1 A;  4RBN A;  3HTK C;  3Q7G A;  3KKB A;  3I4U A;  5E33 A;  4O6M A;  1O5H A;  1TWG A;  4I44 A;  4QI0 A;  1V54 C;  2WZL A;  2IXN A;  3EHN A;  4WJ0 A;  2B0J A;  3Q6M A;  3N24 A;  1ZU4 A;  5E3A A;  4FWV A;  3ZVR A;  3EGD B;  4BEJ A;  3DZA A;  5DQZ A;  5KYX A;  2O9X A;  1RJ9 A;  3EPV A;  2WVN A;  3CSK A;  4DVZ A;  3EGX A;  4JVS A;  2KQ9 A;  3OWT A;  1ZU5 A;  2IXO A;  3CQZ A;  4P6I C;  1NU9 C;  1O87 A;  4CS8 A;  3DJU B;  3S27 A;  2ZXW C;  3QMK A;  5KYW A;  3B9Q A;  2CNW A;  2ZXP A;  3ABM C;  2W4B A;  5F5H A;  4O6N A;  3K66 A;  1FFH A;  3W8H A;  2ZPA A;  1FMV A;  3LS0 A;  3UGP A;  3RYL A;  3E9V A;  4E7Z A;  3NYM A;  3JYH A;  4CS8 C;  3VAY A;  5T3W A;  4AE4 B;  3LAY A;  3SEO A;  4DBR A;  2MWQ A;  4LER A;  3S0X A;  2VB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...