2MWQA

Solution structure of psbq from spinacia oleracea
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
149
structure length
149
Chain Sequence
b'EARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxygen-evolving enhancer protein 3, chloroplastic
publication title Solution NMR and molecular dynamics reveal a persistent alpha helix within the dynamic region of PsbQ from photosystem II of higher plants.
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Plant protein
total genus 50
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2014-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2mwqA01
3LS0A 2MWQA 1NZEA 3RFYA 3JCUQ 1VYKA 3ZSUA 3LS1A
chains in the Genus database with same CATH superfamily
1Z6AA 3HNLA 2YHSA 1V55C 1BR4A 1H9GA 2XLEA 3AQCA 4MVZA 5EK0A 5L0CA 4OIOF 1D0ZA 3KYIA 3LNMB 1FMVA 1OW8A 3ABKC 1S05A 3F46A 2AWYA 3FHDA 3NMJA 3QVYA 4EUKB 4Q4ZF 2FFHA 1HMOA 3ZVRA 4E7ZA 2ETSA 3BEHA 4NTAA 4ZLDA 1FTSA 3EH1A 1Y4CA 4IAOA 2YLIA 3L8JA 2AP3A 5E3AA 5L3VA 3B9QA 3AOUA 4DOZA 1C02A 3IQCA 2HZ8A 4YJWA 4G7OF 4U5HA 2YL0A 1L7CA 4U5EE 3NDBB 4GYTA 3AQBA 3WAQA 1TQGA 2LFFA 2OOCA 4K0DA 4EKWA 4MQ9F 2VH3A 3TULA 1Y6DA 2A69F 3RVYA 4JCHA 1RKCA 2EIJC 3HNJA 1WWPA 3V5YA 5KYUB 2R7RA 1RKEB 3ITFA 5B1AC 2KSFA 1Z5ZA 2L81A 3X2QC 3EFOA 1YA7O 2HMZA 3C8GB 2OCCC 2L7AA 5K0IA 3PCVA 3GEIA 3LEVA 4PK4A 5COMA 3T4RA 3Q6MA 2J7PD 4JW1A 4CDAA 1CPQA 4A2NB 1OCOC 2IOQA 2RD9A 3SZRA 4AX2A 1A41A 1VMAA 2XM4A 3QW1A 4JTDB 5D92A 2A0UA 1JOGA 1H6GA 4IAQA 2XLDA 5CI9A 2V3CC 2IXNA 3U8VA 4YWQA 3L0IA 4JE9A 4JVSA 2PP4A 1A7VA 5D91A 2QY9A 4CS8A 4E18A 4XLPF 3B0VC 1SR2A 4XEKA 3U8PA 3OA1A 3IEEA 3RVZA 2X0CA 3ZSUA 3DAGA 1BDJB 4XWJA 2Z15A 1OXBA 2WZFA 2XRHA 4AE4B 1JRAA 2VCAA 2Y69C 3ZTZA 1E84A 2CGEA 2OQMA 3T6JA 2EPLX 2P1AA 2A1DD 4IGGA 3NYJA 1JPNA 2LK4A 2ZXPA 3JZ0A 4NC3A 4NTFA 3UMHA 2TMVP 3JSZA 4F4BA 2P7VA 5KYXA 1AUEA 2R7WA 3ASNC 2WZLA 4KBLA 4KNWA 4B6IA 3V7OA 1CGME 3EG9B 3ZIBA 3L34A 1YLMA 3LJBA 4O7GA 1G5ZA 4MNDA 1O3UA 1YAUO 4R32A 3RF3A 4WABA 3BRJA 5CIVA 2HJ3A 3UGOA 1M2VB 4XPXA 5KYYA 5F5HA 1I4ZA 2A68F 2LSEA 5HSWA 2EPNA 1Z7Qc 3I4UA 2KJGA 3TJ5A 4MW8A 4DRIB 4EIYA 5JT4A 2YLDA 4P6IC 2Q00A 3NKEA 3LEOA 1G4WR 3RQEA 4XEFA 1LM3B 3RYLA 1QQ3A 4QDLA 1Z23A 3Q7LA 3GEHA 3WHNA 1IZMA 1PD1A 2EIKC 2H7OA 4RDAA 2HKVA 5FZTA 2W4MA 1JPJA 2OEVA 2LQGA 3GM1A 2L6FA 4IJJA 2OKUA 1YYXA 3IQ5A 3LAYA 3X1OA 4DRHB 4U5CE 3KYJA 4HFFB 3S9OA 2L9JA 4MVUA 1FFTC 1NZEA 4J30B 1PCXA 4O79A 2I15A 3EFOB 2RSEB 3U3BA 1G4US 2D4UA 4C3EA 4XEVA 3AG3C 3EZHA 3ATPA 4ER9A 4YN0B 2EPKX 3JT1A 2J7PA 3GORA 2LP4A 4J7YA 4MVMA 2MHRA 4NCQA 5B1BC 1ZHTA 4WGYA 3ZQYA 2R03A 4OIPF 1YJGA 2LCHA 2XSEA 3PMRA 1TWHA 4IB4A 2EIMC 3SNHA 3TD7A 4ANJA 1BZ4A 5F5FA 3B0UX 3VF0A 1LI5A 4CIPA 4YL3A 2ICWG 2BL2A 3I5PA 2V26A 3LUTB 2Y3HA 2JD3A 3U2LA 3B29A 4YT4A 1OXKA 3DJUB 3K7DA 3M79A 3KMIA 1KTMA 2EPOA 1ST6A 2XLVA 4XTKA 1T01A 3T6BA 2IXOA 1NFOA 3M15A 3T9OA 1VLSA 2P0NA 3Q7GA 1OR2A 3ZWIA 3NRHA 4LACB 4XPWA 2Q9AA 1B68A 1E83A 1SZIA 1E86A 4P9TA 2J9VA 2WL8A 3AG4C 3EJNA 3NYMA 4CSAA 4DBRA 4AL0A 4U5GA 3WODF 2R7XA 4MVOA 3L1MA 3AGTA 4QI0A 3O39A 3VM6A 2EILC 3EH2A 3U0CA 2I8BA 2AVKA 1K05A 4JCZA 3ZTMA 3IHUA 3RH3A 1TFOB 2AWCA 4IRUA 5BQGA 2NSGA 1MMDA 2YWAA 3KPHA 3W2WA 4AK9A 1JMWA 2R02A 2W45A 4W8PA 1KNYA 3JSEO 2YL3A 1CGOA 2WVQA 2CCYA 2KGOA 3UMKA 1QZXA 3VYWA 2QE9A 1HMDA 1LPEA 2D5RB 1WOLA 2HV7A 2WZGA 3B0PA 5KYUA 4YT8A 4EHPA 2L6HA 1UG7A 2NUTA 4JJGA 2MYSA 5GPGB 4U5DE 3HKKA 2JX0A 2Y39A 3FAJA 4N4WA 4NY3A 4U9EA 1RMVA 3S29A 5A6BD 1GS9A 1SMYF 1M57C 3DJNB 1Z63A 1DOVA 4MW3A 2L6GA 5AC4A 1OW7A 1ORJA 3LLKA 3GODA 2YRFA 3B71A 1OR3A 5JLIA 3DM9B 1MNDA 1APCA 3DWWA 3S27A 3SXKA 4JJFA 2Y3BA 1TWCA 3W8HA 3N2ZB 4MS2A 2O9XA 3A11A 5KYWB 4JC7A 1D1AA 3MYIA 4WGZA 1XZPA 4YT5A 5L0JA 3J06A 3ABMC 3HNIA 1Q0GA 2G3KA 3DD7A 3CQZA 3S0XA 1JAFA 1YA9A 4LLCA 4XPYA 4DRJB 3M4CA 3EHNA 3HJCA 1Q0MA 3U9MA 3WG7C 4E17A 2J45A 4D4NA 4OD5A 2A6HF 3POVA 1XZQA 2CNWD 2CYDA 1YDIA 2FGYA 2XLHA 5DQTA 4UDVA 2HFIA 2GAQA 2JPUA 1LE4A 1RXQA 4EBBA 4MTGA 2XXAA 1LS1A 2QTVA 3V5ZA 4FX5A 1U6HA 2KYHA 4LERA 1R4TA 3JTLO 4J32B 4DXWA 3TJ6A 1CGNA 3DZAA 1K04A 1DOWA 4IWBA 2NUPB 1QKRA 3M4BA 4PJNA 5DLJA 1U0BB 3FXHA 4QI2A 3HLZA 2XLOA 2Y3GA 4U5FE 2H8AA 3O6XA 1GGQA 1W2WA 1M6TA 5JP7A 3EZIA 3FVYA 1O87A 3LS1A 1NBBA 4M63A 1LIHA 3SEOA 1NU9C 2NSFA 2XS8A 3ZC4A 2DYSC 3Q6NA 2DB4A 3EGDA 1K40A 3UR3C 1BBHA 4JEAA 5IY5C 3R2PA 1I4YA 5BQIA 3HNKA 5L0DA 1J8MF 1VYKA 1HY5A 1M56C 4OINF 3W4YA 3G4XA 5L3QA 3GEEA 2UUHA 256BA 2R7TA 1HW1A 4E7SA 5DS5A 2H7VC 1WGWA 2DI3A 1ZU4A 4X0RA 3U2MA 4E0IA 4BJ6C 1SYQA 1U89A 2OU6A 3K33A 2Q3TA 4A4AA 5A6BA 5EHHA 2LFDA 3NKDA 2KNHA 4N6CA 5AGFA 3K1IC 2VCBA 4CS9A 2C03A 1JR8A 4ONSA 4GEHA 1VYIA 3U5SA 1BR2A 2QNLA 2PX3A 2XLMA 1F1MA 1T5OA 4JEBA 2J9UA 3QVZA 4PFPA 2HUJA 3MLGA 1C03A 1D1CA 1KU2A 1QLEC 3LNRA 1A0BA 3QW0A 4KNVA 4Q7CA 2R9RB 3IQ6A 3L8IA 4Q5SF 4FESA 3UGPA 2G62A 2J46A 4CS9C 4RBNA 2IBFA 2WB7A 1G8XA 3QTHA 3AG1C 3C62A 3HTKC 1TWAA 5JSLA 2W9YA 2AU5A 4ULVA 1T6IA 1ORSC 1ZHXA 2EINC 2XS1A 4OD4A 2Q9BA 5A6KA 4N6HA 1Z3IX 5DS6A 1C17M 4PR9A 1CPRA 3MX3A 4RD9A 2IM8A 3S28A 1FMWA 3DMDA 5DQZA 4C3DA 1EKYA 1MMAA 2BC5A 1OKKD 4I44A 1IW7F 1BR1A 4E0HA 3AJMA 2A0BA 1TWGA 2CNWA 2YQYA 3E9VA 4CS7A 2ASRA 2GFHA 4DJ9A 2R7VA 3S90A 2CW0F 4C7OA 2BE5F 4AL1A 4LLEA 4DVZA 4WJ0A 3EGXA 5KYXB 4N06A 4CDVA 1QVXA 4ZLCA 4J7TA 1TKNA 4I1MA 1ZHWA 2HSQA 3EPVA 1MMNA 4U5BE 1YVIA 1QSPA 3ZG1A 4YK5A 1NSGB 3FDQA 2R7SA 3N0TA 3DM5A 5L0GA 4I1OB 1J8YF 5CI8A 1EQ1A 1V54C 3CAXA 4Z9HA 2OJQA 2ZPAA 5KYYB 3KKBA 2YEVA 1H7IA 3QMKA 5B3IA 4O6YA 3C18A 3OEOA 5B3SC 2PBEA 1OCCC 2WVNA 3S84A 3EG9A 1ZZPA 3IPMO 1UFBA 2Q9CA 4CJGA 3T6GB 3VRCA 1GQAA 4JTAB 1E2XA 3C7JA 1LI7A 1Q0KA 2YL1A 1M2VA 3DKAA 3MBGA 4PJMA 3EGDB 2B0JA 1RCPA 2DGJA 4OIQF 2NG1A 2OJED 3C8ZA 1A7DA 1GM5A 4LDKA 1VLTA 1NG1A 2GWWA 4LDQA 4BJ5C 3N24A 5JS5A 3AGUA 5FCLA 2PF4E 4HE8D 4EWCA 5T1DB 4JZAA 1LKXA 4L6RA 3RFYA 3RW0A 4CDYA 3SXMA 4I3MA 1HW2A 2YL7A 2P6VA 5A6AA 1YZCA 3ASOC 3JRTA 3UMIA 2J8WA 1EA8A 1Q0FA 2YKZA 3C8GD 4JRZA 1ORYA 1D1BA 2ZXWC 4MTOA 3W8IA 1ZHYA 1A7EA 4NQFA 1R5ID 3LLIA 2ZXRA 2FAPB 2R7UA 2PNOA 3LS0A 4JIOA 1OW6A 3G4ZA 4XLNF 4YL0A 2GDCA 4MVQA 3ZQVA 3SYNA 1NLXA 1ZW3A 4G0HA 2UUIA 2J0WA 5HV9A 1FR0A 5E3CA 5T3WA 3DE9A 2VB6A 2XL6A 5A69A 3EHMA 4H54A 5L0IA 2OEXA 2E87A 3ZDLA 3H2UA 1T6QA 3JRMO 2J9WA 2VASA 3ABLC 3TOMA 1RJ9A 3KH2A 2R05A 3A9CA 4BJ6A 2XL8A 1OKKA 2PX0A 3IQTA 4GQHA 2QUPA 1N1CA 2KK1A 5COFA 1I5NA 3TOLA 3FOOA 2DYRC 1YYJA 2P61A 3V5XA 1VK5A 2HV6A 4EBJA 3FOPA 4O6NA 4W8KA 4YL1A 1D0XA 3NMIA 3DE8A 3JCUQ 4C7OB 3NMKA 3SXZA 1QPUA 2ZXOA 4DVYP 1FNTc 3VAYA 3QZCA 3EGXB 3F47A 2M64A 4D4XA 2A6EF 2PFDA 3GWLA 1EI7A 2OG2A 1YARO 1OCRC 2VCCA 1LS4A 1TR2A 1WATA 1ZHZA 1VB5A 1WASA 4PFOA 5E33A 5F28E 4FWVA 4ULWA 2H7BA 3W2VA 4MVSA 1VOMA 2MWQA 2B0HA 3JYHA 1MNEA 4CS8C 4K7BA 4BPMA 3K1IA 5L0HA 4EBKA 1ZYRF 3U3FA 3OWTA 1T9KA 5AC5A 2NPUA 2KW3C 3AG2C 1HE1A 4Z9IA 4JKVA 5DS4A 2NUTB 2XLWA 1OQCA 4PJJA 4BJTA 2YZSA 4G7HF 1ZVZA 1E85A 2C04A 3FAPB 3E70C 1SF8A 1V4AA 3ECSA 3GM3A 1Q0DA 2KQ9A 4CIHA 5EGYA 3RQFA 4G7ZF 1LVKA 2R25A 1T6UA 5KYNA 3KL4A 2GA0A 2XM0A 3PHF2 4CX9A 4P9FA 4MTFA 4IARA 3RIPA 2LD6A 3LESA 4JTCB 5DVWA 1OCZC 3PDMP 4K1OA 1HE9A 1AEPA 1XWJA 3DAFA 1O5HA 2R7OA 2CDQA 3R7CA 1RKEA 3CEXA 3EQLF 3MYFA 5BUOA 4FAPB 1D0YA 3C8GA 3GM2A 2KC3A 1MMGA 3K6BA 2HS5A 4PACA 3JYYA 3I5QA 4G78A 3H2VA 5BQHA 3RKOF 2ZD9A 3NG1A 3UNGC 1H9TA 4U9DA 3M1CB 1M2OA 4BEMJ 1TFKB 2F22A 5KYWA 1FAPB 3CSKA 3C63A 4CJOA 3DXJF 1WTYA 4BJ1A 2YVKA 3TK0A 4H4KC 5E2QA 3SXYA 4LDRA 2Y3DA 3SP1A 4JURI 1AVOB 2J9BA 3MFNA 5T3TA 3NYLA 1YZAA 5A6JA 3US6A 3GWNA 3TQOA 2G3VA 3O55A 2LIGA 4BEJA 2XL4A 1RJ9B 2X51A 5JRAA 4AE4A 1L3PA 1NU7D 5JVEA 1V74B 2XXAB 2IXPA 2EPMX 4HFKB 5L0FA 1PV3A 1MQVA 2HMQA 4HEAJ 5TJ5E 4KI2A 1ZU5A 3O10A 2HSBA 4CBEA 2WVOA 4KC9A 4YT2A 2HJMA 3GANA 3H65A 2YLGA 1LE2A 3K1HA 2IYLD 3G50A 3FMSA 4DBQA 2IXMA 4XQ1A 1WN0A 3DI5A 2R7QA 3K66A 1PD0A 4OIRF 2J0XA 1VTMP 4MVRA 2VC9A 4O6MA 4BJ5A 3U9JA 4PJLA 2QLAA 4BG0A 1ZW2A 2W4BA 2Q4FA 3CZ6A 1FFHA 5COGA 2Q7RA 2NUPA 1S7ZA 5JUAA 3RQGA 4C3BA 4CSAC 1NFNA 2M4EA 4NTBA 4Z9JA
chains in the Genus database with same CATH topology
1Z6AA 2YHSA 1V55C 1BR4A 3AQCA 4OIOF 1D0ZA 1FMVA 3F46A 3ABKC 3FHDA 4CSAC 4Q4ZF 2FFHA 3ZVRA 4E7ZA 4ZLDA 1FTSA 3EH1A 4IAOA 5E3AA 5L3VA 3B9QA 4DOZA 4G7OF 4YJWA 4U5HA 4U5EE 3NDBB 4GYTA 3AQBA 4K0DA 4MQ9F 2VH3A 2A69F 4JCHA 2EIJC 2R7RA 5KYUB 3ITFA 5B1AC 1Z5ZA 2L81A 3X2QC 3EFOA 2OCCC 3LEVA 4PK4A 3T4RA 3Q6MA 2J7PD 4JW1A 4A2NB 1OCOC 2IOQA 3SZRA 4AX2A 1VMAA 5D92A 5CI9A 2IXNA 4YWQA 3L0IA 4JVSA 2PP4A 5D91A 2QY9A 4CS8A 4XLPF 3B0VC 3OA1A 3IEEA 3ZSUA 3DAGA 4XWJA 2Z15A 2XRHA 2WZFA 4AE4B 2Y69C 2CGEA 3T6JA 2A1DD 3NYJA 1JPNA 2ZXPA 3UMHA 3JSZA 4F4BA 2P7VA 5KYXA 3ASNC 2WZLA 4KBLA 4KNWA 4B6IA 3V7OA 3EG9B 3ZIBA 3L34A 3LJBA 4O7GA 4MNDA 3UGOA 1M2VB 5KYYA 5F5HA 2A68F 2LSEA 5HSWA 3I4UA 2KJGA 4P6IC 3NKEA 3RYLA 4QDLA 1Z23A 3Q7LA 1IZMA 1PD1A 2EIKC 2H7OA 4RDAA 2W4MA 1JPJA 4IJJA 3LAYA 3X1OA 4U5CE 4HFFB 2L9JA 1FFTC 1NZEA 4J30B 1PCXA 4O79A 3EFOB 4C3EA 3AG3C 3EZHA 4YN0B 3JT1A 2J7PA 5B1BC 1ZHTA 4OIPF 2XSEA 3TD7A 3PMRA 4ANJA 1TWHA 3SNHA 2EIMC 5F5FA 3B0UX 4AK9A 3I5PA 2V26A 4YT4A 2Y3HA 2JD3A 3DJUB 3K7DA 3KMIA 1ST6A 4XTKA 3T6BA 2IXOA 3Q7GA 3NRHA 4LACB 2Q9AA 1SZIA 2J9VA 2WL8A 3AG4C 3EJNA 3NYMA 4CSAA 4DBRA 4U5GA 3WODF 2R7XA 4QI0A 3O39A 2EILC 3EH2A 2I8BA 3RH3A 4IRUA 1MMDA 3W2WA 2W45A 2WVQA 2KGOA 3UMKA 1QZXA 3VYWA 2WZGA 2HV7A 2D5RB 3B0PA 4YT8A 2NUTA 4JJGA 2MYSA 4U5DE 2Y39A 3FAJA 4NY3A 3S29A 1SMYF 1M57C 3DJNB 1Z63A 3LLKA 3GODA 3DM9B 1MNDA 3S27A 4JJFA 2Y3BA 1TWCA 3W8HA 3N2ZB 2O9XA 5KYWB 1D1AA 4YT5A 3ABMC 2G3KA 3DD7A 3CQZA 3S0XA 4LLCA 3EHNA 3HJCA 3WG7C 2J45A 4OD5A 2A6HF 3POVA 2CNWD 2FGYA 5DQTA 4EBBA 2XXAA 1LS1A 2QTVA 4FX5A 4LERA 4J32B 2V3CC 3DZAA 4IWBA 5DLJA 2NUPB 4PJNA 4QI2A 3HLZA 2Y3GA 4U5FE 3O6XA 1W2WA 3FVYA 3EZIA 3LS1A 1O87A 4M63A 3SEOA 3ZC4A 1NU9C 2DYSC 3Q6NA 3EGDA 3UR3C 5IY5C 1J8MF 1VYKA 1M56C 4OINF 5L3QA 2R7TA 4E7SA 5DS5A 2H7VC 1WGWA 1ZU4A 4X0RA 4BJ6C 5EHHA 3K33A 2Q3TA 3NKDA 2KNHA 4CS9A 3K1IC 2C03A 4GEHA 1VYIA 1BR2A 2PX3A 2J9UA 4PFPA 3MLGA 5KYUA 1D1CA 1KU2A 1QLEC 3LNRA 4KNVA 4Q7CA 4Q5SF 4FESA 3UGPA 2G62A 2J46A 4CS9C 4RBNA 2WB7A 1G8XA 3AG1C 3HTKC 1TWAA 2W9YA 4OD4A 1ZHXA 2EINC 2Q9BA 1Z3IX 5DS6A 4RD9A 3MX3A 3S28A 5DQZA 1FMWA 3DMDA 4C3DA 1MMAA 1OKKD 4I44A 1BR1A 1IW7F 1TWGA 2CNWA 3E9VA 4CS7A 2GFHA 2R7VA 2CW0F 4C7OA 2BE5F 4LLEA 4DVZA 4WJ0A 3EGXA 5KYXB 4N06A 4ZLCA 1TKNA 4I1MA 1ZHWA 3EPVA 1MMNA 4U5BE 3ZG1A 3FDQA 2R7SA 3N0TA 3DM5A 4I1OB 1J8YF 5CI8A 1V54C 2ZPAA 5KYYB 3KKBA 2YEVA 3QMKA 4O6YA 3OEOA 5B3SC 1OCCC 2WVNA 3EG9A 2Q9CA 1M2VA 4PJMA 3EGDB 2B0JA 2DGJA 4OIQF 2NG1A 1NG1A 4BJ5C 3N24A 5FCLA 2PF4E 4HE8D 4EWCA 5T1DB 4JZAA 1LKXA 3RFYA 4I3MA 2P6VA 3JRTA 3ASOC 3UMIA 3W8IA 1D1BA 2ZXWC 1ZHYA 3LLIA 2ZXRA 2R7UA 3LS0A 4XLNF 3SYNA 4G0HA 2J0WA 5E3CA 5T3WA 2VB6A 3EHMA 2E87A 2J9WA 2VASA 3ABLC 1RJ9A 3KH2A 1OKKA 2PX0A 1N1CA 2DYRC 1VK5A 2HV6A 4O6NA 4W8KA 1D0XA 4C7OB 3JCUQ 2ZXOA 4DVYP 3VAYA 3QZCA 3EGXB 3F47A 2A6EF 2PFDA 2OG2A 1OCRC 1TR2A 1ZHZA 5E33A 3W2VA 4PFOA 4BJ6A 2R7WA 4FWVA 4ULWA 2H7BA 1VOMA 2MWQA 3JYHA 4CS8C 1MNEA 4K7BA 1ZYRF 3OWTA 2KW3C 3AG2C 5DS4A 2NUTB 4BJTA 4PJJA 2YZSA 4G7HF 2C04A 3E70C 1SF8A 3ECSA 2KQ9A 4CIHA 5EGYA 4G7ZF 1LVKA 5KYNA 3KL4A 3PHF2 3RIPA 3LESA 5DVWA 1OCZC 3DAFA 1O5HA 2R7OA 2CDQA 3EQLF 5BUOA 1D0YA 1MMGA 3K6BA 3I5QA 3RKOF 3NG1A 3UNGC 3M1CB 1M2OA 5KYWA 3CSKA 3DXJF 4BJ1A 4H4KC 5E2QA 2Y3DA 3SP1A 4JURI 5T3TA 3NYLA 2G3VA 4BEJA 2XL4A 1RJ9B 2X51A 4AE4A 1NU7D 2XXAB 2IXPA 4HFKB 4HEAJ 4KI2A 1ZU5A 4CBEA 2WVOA 4KC9A 4YT2A 3GANA 3H65A 3K1HA 2IYLD 4DBQA 2IXMA 2R7QA 3K66A 1PD0A 4OIRF 2J0XA 4O6MA 4BJ5A 4PJLA 4BG0A 2W4BA 3CZ6A 1FFHA 2NUPA 1S7ZA 4C3BA 2M4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LS0 A;  2MWQ A;  1NZE A;  3RFY A;  3JCU Q;  1VYK A;  3ZSU A;  3LS1 A; 
#chains in the Genus database with same CATH topology
 1Z6A A;  3HNL A;  2YHS A;  1V55 C;  1BR4 A;  1H9G A;  2XLE A;  3AQC A;  4MVZ A;  5EK0 A;  5L0C A;  4OIO F;  1D0Z A;  3KYI A;  3LNM B;  1FMV A;  1OW8 A;  3ABK C;  1S05 A;  3F46 A;  2AWY A;  3FHD A;  3NMJ A;  3QVY A;  4EUK B;  4Q4Z F;  2FFH A;  1HMO A;  3ZVR A;  4E7Z A;  2ETS A;  3BEH A;  4NTA A;  4ZLD A;  1FTS A;  3EH1 A;  1Y4C A;  4IAO A;  2YLI A;  3L8J A;  2AP3 A;  5E3A A;  5L3V A;  3B9Q A;  3AOU A;  4DOZ A;  1C02 A;  3IQC A;  2HZ8 A;  4YJW A;  4G7O F;  4U5H A;  2YL0 A;  1L7C A;  4U5E E;  3NDB B;  4GYT A;  3AQB A;  3WAQ A;  1TQG A;  2LFF A;  2OOC A;  4K0D A;  4EKW A;  4MQ9 F;  2VH3 A;  3TUL A;  1Y6D A;  2A69 F;  3RVY A;  4JCH A;  1RKC A;  2EIJ C;  3HNJ A;  1WWP A;  3V5Y A;  5KYU B;  2R7R A;  1RKE B;  3ITF A;  5B1A C;  2KSF A;  1Z5Z A;  2L81 A;  3X2Q C;  3EFO A;  1YA7 O;  2HMZ A;  3C8G B;  2OCC C;  2L7A A;  5K0I A;  3PCV A;  3GEI A;  3LEV A;  4PK4 A;  5COM A;  3T4R A;  3Q6M A;  2J7P D;  4JW1 A;  4CDA A;  1CPQ A;  4A2N B;  1OCO C;  2IOQ A;  2RD9 A;  3SZR A;  4AX2 A;  1A41 A;  1VMA A;  2XM4 A;  3QW1 A;  4JTD B;  5D92 A;  2A0U A;  1JOG A;  1H6G A;  4IAQ A;  2XLD A;  5CI9 A;  2V3C C;  2IXN A;  3U8V A;  4YWQ A;  3L0I A;  4JE9 A;  4JVS A;  2PP4 A;  1A7V A;  5D91 A;  2QY9 A;  4CS8 A;  4E18 A;  4XLP F;  3B0V C;  1SR2 A;  4XEK A;  3U8P A;  3OA1 A;  3IEE A;  3RVZ A;  2X0C A;  3ZSU A;  3DAG A;  1BDJ B;  4XWJ A;  2Z15 A;  1OXB A;  2WZF A;  2XRH A;  4AE4 B;  1JRA A;  2VCA A;  2Y69 C;  3ZTZ A;  1E84 A;  2CGE A;  2OQM A;  3T6J A;  2EPL X;  2P1A A;  2A1D D;  4IGG A;  3NYJ A;  1JPN A;  2LK4 A;  2ZXP A;  3JZ0 A;  4NC3 A;  4NTF A;  3UMH A;  2TMV P;  3JSZ A;  4F4B A;  2P7V A;  5KYX A;  1AUE A;  2R7W A;  3ASN C;  2WZL A;  4KBL A;  4KNW A;  4B6I A;  3V7O A;  1CGM E;  3EG9 B;  3ZIB A;  3L34 A;  1YLM A;  3LJB A;  4O7G A;  1G5Z A;  4MND A;  1O3U A;  1YAU O;  4R32 A;  3RF3 A;  4WAB A;  3BRJ A;  5CIV A;  2HJ3 A;  3UGO A;  1M2V B;  4XPX A;  5KYY A;  5F5H A;  1I4Z A;  2A68 F;  2LSE A;  5HSW A;  2EPN A;  1Z7Q c;  3I4U A;  2KJG A;  3TJ5 A;  4MW8 A;  4DRI B;  4EIY A;  5JT4 A;  2YLD A;  4P6I C;  2Q00 A;  3NKE A;  3LEO A;  1G4W R;  3RQE A;  4XEF A;  1LM3 B;  3RYL A;  1QQ3 A;  4QDL A;  1Z23 A;  3Q7L A;  3GEH A;  3WHN A;  1IZM A;  1PD1 A;  2EIK C;  2H7O A;  4RDA A;  2HKV A;  5FZT A;  2W4M A;  1JPJ A;  2OEV A;  2LQG A;  3GM1 A;  2L6F A;  4IJJ A;  2OKU A;  1YYX A;  3IQ5 A;  3LAY A;  3X1O A;  4DRH B;  4U5C E;  3KYJ A;  4HFF B;  3S9O A;  2L9J A;  4MVU A;  1FFT C;  1NZE A;  4J30 B;  1PCX A;  4O79 A;  2I15 A;  3EFO B;  2RSE B;  3U3B A;  1G4U S;  2D4U A;  4C3E A;  4XEV A;  3AG3 C;  3EZH A;  3ATP A;  4ER9 A;  4YN0 B;  2EPK X;  3JT1 A;  2J7P A;  3GOR A;  2LP4 A;  4J7Y A;  4MVM A;  2MHR A;  4NCQ A;  5B1B C;  1ZHT A;  4WGY A;  3ZQY A;  2R03 A;  4OIP F;  1YJG A;  2LCH A;  2XSE A;  3PMR A;  1TWH A;  4IB4 A;  2EIM C;  3SNH A;  3TD7 A;  4ANJ A;  1BZ4 A;  5F5F A;  3B0U X;  3VF0 A;  1LI5 A;  4CIP A;  4YL3 A;  2ICW G;  2BL2 A;  3I5P A;  2V26 A;  3LUT B;  2Y3H A;  2JD3 A;  3U2L A;  3B29 A;  4YT4 A;  1OXK A;  3DJU B;  3K7D A;  3M79 A;  3KMI A;  1KTM A;  2EPO A;  1ST6 A;  2XLV A;  4XTK A;  1T01 A;  3T6B A;  2IXO A;  1NFO A;  3M15 A;  3T9O A;  1VLS A;  2P0N A;  3Q7G A;  1OR2 A;  3ZWI A;  3NRH A;  4LAC B;  4XPW A;  2Q9A A;  1B68 A;  1E83 A;  1SZI A;  1E86 A;  4P9T A;  2J9V A;  2WL8 A;  3AG4 C;  3EJN A;  3NYM A;  4CSA A;  4DBR A;  4AL0 A;  4U5G A;  3WOD F;  2R7X A;  4MVO A;  3L1M A;  3AGT A;  4QI0 A;  3O39 A;  3VM6 A;  2EIL C;  3EH2 A;  3U0C A;  2I8B A;  2AVK A;  1K05 A;  4JCZ A;  3ZTM A;  3IHU A;  3RH3 A;  1TFO B;  2AWC A;  4IRU A;  5BQG A;  2NSG A;  1MMD A;  2YWA A;  3KPH A;  3W2W A;  4AK9 A;  1JMW A;  2R02 A;  2W45 A;  4W8P A;  1KNY A;  3JSE O;  2YL3 A;  1CGO A;  2WVQ A;  2CCY A;  2KGO A;  3UMK A;  1QZX A;  3VYW A;  2QE9 A;  1HMD A;  1LPE A;  2D5R B;  1WOL A;  2HV7 A;  2WZG A;  3B0P A;  5KYU A;  4YT8 A;  4EHP A;  2L6H A;  1UG7 A;  2NUT A;  4JJG A;  2MYS A;  5GPG B;  4U5D E;  3HKK A;  2JX0 A;  2Y39 A;  3FAJ A;  4N4W A;  4NY3 A;  4U9E A;  1RMV A;  3S29 A;  5A6B D;  1GS9 A;  1SMY F;  1M57 C;  3DJN B;  1Z63 A;  1DOV A;  4MW3 A;  2L6G A;  5AC4 A;  1OW7 A;  1ORJ A;  3LLK A;  3GOD A;  2YRF A;  3B71 A;  1OR3 A;  5JLI A;  3DM9 B;  1MND A;  1APC A;  3DWW A;  3S27 A;  3SXK A;  4JJF A;  2Y3B A;  1TWC A;  3W8H A;  3N2Z B;  4MS2 A;  2O9X A;  3A11 A;  5KYW B;  4JC7 A;  1D1A A;  3MYI A;  4WGZ A;  1XZP A;  4YT5 A;  5L0J A;  3J06 A;  3ABM C;  3HNI A;  1Q0G A;  2G3K A;  3DD7 A;  3CQZ A;  3S0X A;  1JAF A;  1YA9 A;  4LLC A;  4XPY A;  4DRJ B;  3M4C A;  3EHN A;  3HJC A;  1Q0M A;  3U9M A;  3WG7 C;  4E17 A;  2J45 A;  4D4N A;  4OD5 A;  2A6H F;  3POV A;  1XZQ A;  2CNW D;  2CYD A;  1YDI A;  2FGY A;  2XLH A;  5DQT A;  4UDV A;  2HFI A;  2GAQ A;  2JPU A;  1LE4 A;  1RXQ A;  4EBB A;  4MTG A;  2XXA A;  1LS1 A;  2QTV A;  3V5Z A;  4FX5 A;  1U6H A;  2KYH A;  4LER A;  1R4T A;  3JTL O;  4J32 B;  4DXW A;  3TJ6 A;  1CGN A;  3DZA A;  1K04 A;  1DOW A;  4IWB A;  2NUP B;  1QKR A;  3M4B A;  4PJN A;  5DLJ A;  1U0B B;  3FXH A;  4QI2 A;  3HLZ A;  2XLO A;  2Y3G A;  4U5F E;  2H8A A;  3O6X A;  1GGQ A;  1W2W A;  1M6T A;  5JP7 A;  3EZI A;  3FVY A;  1O87 A;  3LS1 A;  1NBB A;  4M63 A;  1LIH A;  3SEO A;  1NU9 C;  2NSF A;  2XS8 A;  3ZC4 A;  2DYS C;  3Q6N A;  2DB4 A;  3EGD A;  1K40 A;  3UR3 C;  1BBH A;  4JEA A;  5IY5 C;  3R2P A;  1I4Y A;  5BQI A;  3HNK A;  5L0D A;  1J8M F;  1VYK A;  1HY5 A;  1M56 C;  4OIN F;  3W4Y A;  3G4X A;  5L3Q A;  3GEE A;  2UUH A;  256B A;  2R7T A;  1HW1 A;  4E7S A;  5DS5 A;  2H7V C;  1WGW A;  2DI3 A;  1ZU4 A;  4X0R A;  3U2M A;  4E0I A;  4BJ6 C;  1SYQ A;  1U89 A;  2OU6 A;  3K33 A;  2Q3T A;  4A4A A;  5A6B A;  5EHH A;  2LFD A;  3NKD A;  2KNH A;  4N6C A;  5AGF A;  3K1I C;  2VCB A;  4CS9 A;  2C03 A;  1JR8 A;  4ONS A;  4GEH A;  1VYI A;  3U5S A;  1BR2 A;  2QNL A;  2PX3 A;  2XLM A;  1F1M A;  1T5O A;  4JEB A;  2J9U A;  3QVZ A;  4PFP A;  2HUJ A;  3MLG A;  1C03 A;  1D1C A;  1KU2 A;  1QLE C;  3LNR A;  1A0B A;  3QW0 A;  4KNV A;  4Q7C A;  2R9R B;  3IQ6 A;  3L8I A;  4Q5S F;  4FES A;  3UGP A;  2G62 A;  2J46 A;  4CS9 C;  4RBN A;  2IBF A;  2WB7 A;  1G8X A;  3QTH A;  3AG1 C;  3C62 A;  3HTK C;  1TWA A;  5JSL A;  2W9Y A;  2AU5 A;  4ULV A;  1T6I A;  1ORS C;  1ZHX A;  2EIN C;  2XS1 A;  4OD4 A;  2Q9B A;  5A6K A;  4N6H A;  1Z3I X;  5DS6 A;  1C17 M;  4PR9 A;  1CPR A;  3MX3 A;  4RD9 A;  2IM8 A;  3S28 A;  1FMW A;  3DMD A;  5DQZ A;  4C3D A;  1EKY A;  1MMA A;  2BC5 A;  1OKK D;  4I44 A;  1IW7 F;  1BR1 A;  4E0H A;  3AJM A;  2A0B A;  1TWG A;  2CNW A;  2YQY A;  3E9V A;  4CS7 A;  2ASR A;  2GFH A;  4DJ9 A;  2R7V A;  3S90 A;  2CW0 F;  4C7O A;  2BE5 F;  4AL1 A;  4LLE A;  4DVZ A;  4WJ0 A;  3EGX A;  5KYX B;  4N06 A;  4CDV A;  1QVX A;  4ZLC A;  4J7T A;  1TKN A;  4I1M A;  1ZHW A;  2HSQ A;  3EPV A;  1MMN A;  4U5B E;  1YVI A;  1QSP A;  3ZG1 A;  4YK5 A;  1NSG B;  3FDQ A;  2R7S A;  3N0T A;  3DM5 A;  5L0G A;  4I1O B;  1J8Y F;  5CI8 A;  1EQ1 A;  1V54 C;  3CAX A;  4Z9H A;  2OJQ A;  2ZPA A;  5KYY B;  3KKB A;  2YEV A;  1H7I A;  3QMK A;  5B3I A;  4O6Y A;  3C18 A;  3OEO A;  5B3S C;  2PBE A;  1OCC C;  2WVN A;  3S84 A;  3EG9 A;  1ZZP A;  3IPM O;  1UFB A;  2Q9C A;  4CJG A;  3T6G B;  3VRC A;  1GQA A;  4JTA B;  1E2X A;  3C7J A;  1LI7 A;  1Q0K A;  2YL1 A;  1M2V A;  3DKA A;  3MBG A;  4PJM A;  3EGD B;  2B0J A;  1RCP A;  2DGJ A;  4OIQ F;  2NG1 A;  2OJE D;  3C8Z A;  1A7D A;  1GM5 A;  4LDK A;  1VLT A;  1NG1 A;  2GWW A;  4LDQ A;  4BJ5 C;  3N24 A;  5JS5 A;  3AGU A;  5FCL A;  2PF4 E;  4HE8 D;  4EWC A;  5T1D B;  4JZA A;  1LKX A;  4L6R A;  3RFY A;  3RW0 A;  4CDY A;  3SXM A;  4I3M A;  1HW2 A;  2YL7 A;  2P6V A;  5A6A A;  1YZC A;  3ASO C;  3JRT A;  3UMI A;  2J8W A;  1EA8 A;  1Q0F A;  2YKZ A;  3C8G D;  4JRZ A;  1ORY A;  1D1B A;  2ZXW C;  4MTO A;  3W8I A;  1ZHY A;  1A7E A;  4NQF A;  1R5I D;  3LLI A;  2ZXR A;  2FAP B;  2R7U A;  2PNO A;  3LS0 A;  4JIO A;  1OW6 A;  3G4Z A;  4XLN F;  4YL0 A;  2GDC A;  4MVQ A;  3ZQV A;  3SYN A;  1NLX A;  1ZW3 A;  4G0H A;  2UUI A;  2J0W A;  5HV9 A;  1FR0 A;  5E3C A;  5T3W A;  3DE9 A;  2VB6 A;  2XL6 A;  5A69 A;  3EHM A;  4H54 A;  5L0I A;  2OEX A;  2E87 A;  3ZDL A;  3H2U A;  1T6Q A;  3JRM O;  2J9W A;  2VAS A;  3ABL C;  3TOM A;  1RJ9 A;  3KH2 A;  2R05 A;  3A9C A;  4BJ6 A;  2XL8 A;  1OKK A;  2PX0 A;  3IQT A;  4GQH A;  2QUP A;  1N1C A;  2KK1 A;  5COF A;  1I5N A;  3TOL A;  3FOO A;  2DYR C;  1YYJ A;  2P61 A;  3V5X A;  1VK5 A;  2HV6 A;  4EBJ A;  3FOP A;  4O6N A;  4W8K A;  4YL1 A;  1D0X A;  3NMI A;  3DE8 A;  3JCU Q;  4C7O B;  3NMK A;  3SXZ A;  1QPU A;  2ZXO A;  4DVY P;  1FNT c;  3VAY A;  3QZC A;  3EGX B;  3F47 A;  2M64 A;  4D4X A;  2A6E F;  2PFD A;  3GWL A;  1EI7 A;  2OG2 A;  1YAR O;  1OCR C;  2VCC A;  1LS4 A;  1TR2 A;  1WAT A;  1ZHZ A;  1VB5 A;  1WAS A;  4PFO A;  5E33 A;  5F28 E;  4FWV A;  4ULW A;  2H7B A;  3W2V A;  4MVS A;  1VOM A;  2MWQ A;  2B0H A;  3JYH A;  1MNE A;  4CS8 C;  4K7B A;  4BPM A;  3K1I A;  5L0H A;  4EBK A;  1ZYR F;  3U3F A;  3OWT A;  1T9K A;  5AC5 A;  2NPU A;  2KW3 C;  3AG2 C;  1HE1 A;  4Z9I A;  4JKV A;  5DS4 A;  2NUT B;  2XLW A;  1OQC A;  4PJJ A;  4BJT A;  2YZS A;  4G7H F;  1ZVZ A;  1E85 A;  2C04 A;  3FAP B;  3E70 C;  1SF8 A;  1V4A A;  3ECS A;  3GM3 A;  1Q0D A;  2KQ9 A;  4CIH A;  5EGY A;  3RQF A;  4G7Z F;  1LVK A;  2R25 A;  1T6U A;  5KYN A;  3KL4 A;  2GA0 A;  2XM0 A;  3PHF 2;  4CX9 A;  4P9F A;  4MTF A;  4IAR A;  3RIP A;  2LD6 A;  3LES A;  4JTC B;  5DVW A;  1OCZ C;  3PDM P;  4K1O A;  1HE9 A;  1AEP A;  1XWJ A;  3DAF A;  1O5H A;  2R7O A;  2CDQ A;  3R7C A;  1RKE A;  3CEX A;  3EQL F;  3MYF A;  5BUO A;  4FAP B;  1D0Y A;  3C8G A;  3GM2 A;  2KC3 A;  1MMG A;  3K6B A;  2HS5 A;  4PAC A;  3JYY A;  3I5Q A;  4G78 A;  3H2V A;  5BQH A;  3RKO F;  2ZD9 A;  3NG1 A;  3UNG C;  1H9T A;  4U9D A;  3M1C B;  1M2O A;  4BEM J;  1TFK B;  2F22 A;  5KYW A;  1FAP B;  3CSK A;  3C63 A;  4CJO A;  3DXJ F;  1WTY A;  4BJ1 A;  2YVK A;  3TK0 A;  4H4K C;  5E2Q A;  3SXY A;  4LDR A;  2Y3D A;  3SP1 A;  4JUR I;  1AVO B;  2J9B A;  3MFN A;  5T3T A;  3NYL A;  1YZA A;  5A6J A;  3US6 A;  3GWN A;  3TQO A;  2G3V A;  3O55 A;  2LIG A;  4BEJ A;  2XL4 A;  1RJ9 B;  2X51 A;  5JRA A;  4AE4 A;  1L3P A;  1NU7 D;  5JVE A;  1V74 B;  2XXA B;  2IXP A;  2EPM X;  4HFK B;  5L0F A;  1PV3 A;  1MQV A;  2HMQ A;  4HEA J;  5TJ5 E;  4KI2 A;  1ZU5 A;  3O10 A;  2HSB A;  4CBE A;  2WVO A;  4KC9 A;  4YT2 A;  2HJM A;  3GAN A;  3H65 A;  2YLG A;  1LE2 A;  3K1H A;  2IYL D;  3G50 A;  3FMS A;  4DBQ A;  2IXM A;  4XQ1 A;  1WN0 A;  3DI5 A;  2R7Q A;  3K66 A;  1PD0 A;  4OIR F;  2J0X A;  1VTM P;  4MVR A;  2VC9 A;  4O6M A;  4BJ5 A;  3U9J A;  4PJL A;  2QLA A;  4BG0 A;  1ZW2 A;  2W4B A;  2Q4F A;  3CZ6 A;  1FFH A;  5COG A;  2Q7R A;  2NUP A;  1S7Z A;  5JUA A;  3RQG A;  4C3B A;  4CSA C;  1NFN A;  2M4E A;  4NTB A;  4Z9J A; 
#chains in the Genus database with same CATH homology
 1Z6A A;  2YHS A;  1V55 C;  1BR4 A;  3AQC A;  4OIO F;  1D0Z A;  1FMV A;  3F46 A;  3ABK C;  3FHD A;  4CSA C;  4Q4Z F;  2FFH A;  3ZVR A;  4E7Z A;  4ZLD A;  1FTS A;  3EH1 A;  4IAO A;  5E3A A;  5L3V A;  3B9Q A;  4DOZ A;  4G7O F;  4YJW A;  4U5H A;  4U5E E;  3NDB B;  4GYT A;  3AQB A;  4K0D A;  4MQ9 F;  2VH3 A;  2A69 F;  4JCH A;  2EIJ C;  2R7R A;  5KYU B;  3ITF A;  5B1A C;  1Z5Z A;  2L81 A;  3X2Q C;  3EFO A;  2OCC C;  3LEV A;  4PK4 A;  3T4R A;  3Q6M A;  2J7P D;  4JW1 A;  4A2N B;  1OCO C;  2IOQ A;  3SZR A;  4AX2 A;  1VMA A;  5D92 A;  5CI9 A;  2IXN A;  4YWQ A;  3L0I A;  4JVS A;  2PP4 A;  5D91 A;  2QY9 A;  4CS8 A;  4XLP F;  3B0V C;  3OA1 A;  3IEE A;  3ZSU A;  3DAG A;  4XWJ A;  2Z15 A;  2XRH A;  2WZF A;  4AE4 B;  2Y69 C;  2CGE A;  3T6J A;  2A1D D;  3NYJ A;  1JPN A;  2ZXP A;  3UMH A;  3JSZ A;  4F4B A;  2P7V A;  5KYX A;  3ASN C;  2WZL A;  4KBL A;  4KNW A;  4B6I A;  3V7O A;  3EG9 B;  3ZIB A;  3L34 A;  3LJB A;  4O7G A;  4MND A;  3UGO A;  1M2V B;  5KYY A;  5F5H A;  2A68 F;  2LSE A;  5HSW A;  3I4U A;  2KJG A;  4P6I C;  3NKE A;  3RYL A;  4QDL A;  1Z23 A;  3Q7L A;  1IZM A;  1PD1 A;  2EIK C;  2H7O A;  4RDA A;  2W4M A;  1JPJ A;  4IJJ A;  3LAY A;  3X1O A;  4U5C E;  4HFF B;  2L9J A;  1FFT C;  1NZE A;  4J30 B;  1PCX A;  4O79 A;  3EFO B;  4C3E A;  3AG3 C;  3EZH A;  4YN0 B;  3JT1 A;  2J7P A;  5B1B C;  1ZHT A;  4OIP F;  2XSE A;  3TD7 A;  3PMR A;  4ANJ A;  1TWH A;  3SNH A;  2EIM C;  5F5F A;  3B0U X;  4AK9 A;  3I5P A;  2V26 A;  4YT4 A;  2Y3H A;  2JD3 A;  3DJU B;  3K7D A;  3KMI A;  1ST6 A;  4XTK A;  3T6B A;  2IXO A;  3Q7G A;  3NRH A;  4LAC B;  2Q9A A;  1SZI A;  2J9V A;  2WL8 A;  3AG4 C;  3EJN A;  3NYM A;  4CSA A;  4DBR A;  4U5G A;  3WOD F;  2R7X A;  4QI0 A;  3O39 A;  2EIL C;  3EH2 A;  2I8B A;  3RH3 A;  4IRU A;  1MMD A;  3W2W A;  2W45 A;  2WVQ A;  2KGO A;  3UMK A;  1QZX A;  3VYW A;  2WZG A;  2HV7 A;  2D5R B;  3B0P A;  4YT8 A;  2NUT A;  4JJG A;  2MYS A;  4U5D E;  2Y39 A;  3FAJ A;  4NY3 A;  3S29 A;  1SMY F;  1M57 C;  3DJN B;  1Z63 A;  3LLK A;  3GOD A;  3DM9 B;  1MND A;  3S27 A;  4JJF A;  2Y3B A;  1TWC A;  3W8H A;  3N2Z B;  2O9X A;  5KYW B;  1D1A A;  4YT5 A;  3ABM C;  2G3K A;  3DD7 A;  3CQZ A;  3S0X A;  4LLC A;  3EHN A;  3HJC A;  3WG7 C;  2J45 A;  4OD5 A;  2A6H F;  3POV A;  2CNW D;  2FGY A;  5DQT A;  4EBB A;  2XXA A;  1LS1 A;  2QTV A;  4FX5 A;  4LER A;  4J32 B;  2V3C C;  3DZA A;  4IWB A;  5DLJ A;  2NUP B;  4PJN A;  4QI2 A;  3HLZ A;  2Y3G A;  4U5F E;  3O6X A;  1W2W A;  3FVY A;  3EZI A;  3LS1 A;  1O87 A;  4M63 A;  3SEO A;  3ZC4 A;  1NU9 C;  2DYS C;  3Q6N A;  3EGD A;  3UR3 C;  5IY5 C;  1J8M F;  1VYK A;  1M56 C;  4OIN F;  5L3Q A;  2R7T A;  4E7S A;  5DS5 A;  2H7V C;  1WGW A;  1ZU4 A;  4X0R A;  4BJ6 C;  5EHH A;  3K33 A;  2Q3T A;  3NKD A;  2KNH A;  4CS9 A;  3K1I C;  2C03 A;  4GEH A;  1VYI A;  1BR2 A;  2PX3 A;  2J9U A;  4PFP A;  3MLG A;  5KYU A;  1D1C A;  1KU2 A;  1QLE C;  3LNR A;  4KNV A;  4Q7C A;  4Q5S F;  4FES A;  3UGP A;  2G62 A;  2J46 A;  4CS9 C;  4RBN A;  2WB7 A;  1G8X A;  3AG1 C;  3HTK C;  1TWA A;  2W9Y A;  4OD4 A;  1ZHX A;  2EIN C;  2Q9B A;  1Z3I X;  5DS6 A;  4RD9 A;  3MX3 A;  3S28 A;  5DQZ A;  1FMW A;  3DMD A;  4C3D A;  1MMA A;  1OKK D;  4I44 A;  1BR1 A;  1IW7 F;  1TWG A;  2CNW A;  3E9V A;  4CS7 A;  2GFH A;  2R7V A;  2CW0 F;  4C7O A;  2BE5 F;  4LLE A;  4DVZ A;  4WJ0 A;  3EGX A;  5KYX B;  4N06 A;  4ZLC A;  1TKN A;  4I1M A;  1ZHW A;  3EPV A;  1MMN A;  4U5B E;  3ZG1 A;  3FDQ A;  2R7S A;  3N0T A;  3DM5 A;  4I1O B;  1J8Y F;  5CI8 A;  1V54 C;  2ZPA A;  5KYY B;  3KKB A;  2YEV A;  3QMK A;  4O6Y A;  3OEO A;  5B3S C;  1OCC C;  2WVN A;  3EG9 A;  2Q9C A;  1M2V A;  4PJM A;  3EGD B;  2B0J A;  2DGJ A;  4OIQ F;  2NG1 A;  1NG1 A;  4BJ5 C;  3N24 A;  5FCL A;  2PF4 E;  4HE8 D;  4EWC A;  5T1D B;  4JZA A;  1LKX A;  3RFY A;  4I3M A;  2P6V A;  3JRT A;  3ASO C;  3UMI A;  3W8I A;  1D1B A;  2ZXW C;  1ZHY A;  3LLI A;  2ZXR A;  2R7U A;  3LS0 A;  4XLN F;  3SYN A;  4G0H A;  2J0W A;  5E3C A;  5T3W A;  2VB6 A;  3EHM A;  2E87 A;  2J9W A;  2VAS A;  3ABL C;  1RJ9 A;  3KH2 A;  1OKK A;  2PX0 A;  1N1C A;  2DYR C;  1VK5 A;  2HV6 A;  4O6N A;  4W8K A;  1D0X A;  4C7O B;  3JCU Q;  2ZXO A;  4DVY P;  3VAY A;  3QZC A;  3EGX B;  3F47 A;  2A6E F;  2PFD A;  2OG2 A;  1OCR C;  1TR2 A;  1ZHZ A;  5E33 A;  3W2V A;  4PFO A;  4BJ6 A;  2R7W A;  4FWV A;  4ULW A;  2H7B A;  1VOM A;  2MWQ A;  3JYH A;  4CS8 C;  1MNE A;  4K7B A;  1ZYR F;  3OWT A;  2KW3 C;  3AG2 C;  5DS4 A;  2NUT B;  4BJT A;  4PJJ A;  2YZS A;  4G7H F;  2C04 A;  3E70 C;  1SF8 A;  3ECS A;  2KQ9 A;  4CIH A;  5EGY A;  4G7Z F;  1LVK A;  5KYN A;  3KL4 A;  3PHF 2;  3RIP A;  3LES A;  5DVW A;  1OCZ C;  3DAF A;  1O5H A;  2R7O A;  2CDQ A;  3EQL F;  5BUO A;  1D0Y A;  1MMG A;  3K6B A;  3I5Q A;  3RKO F;  3NG1 A;  3UNG C;  3M1C B;  1M2O A;  5KYW A;  3CSK A;  3DXJ F;  4BJ1 A;  4H4K C;  5E2Q A;  2Y3D A;  3SP1 A;  4JUR I;  5T3T A;  3NYL A;  2G3V A;  4BEJ A;  2XL4 A;  1RJ9 B;  2X51 A;  4AE4 A;  1NU7 D;  2XXA B;  2IXP A;  4HFK B;  4HEA J;  4KI2 A;  1ZU5 A;  4CBE A;  2WVO A;  4KC9 A;  4YT2 A;  3GAN A;  3H65 A;  3K1H A;  2IYL D;  4DBQ A;  2IXM A;  2R7Q A;  3K66 A;  1PD0 A;  4OIR F;  2J0X A;  4O6M A;  4BJ5 A;  4PJL A;  4BG0 A;  2W4B A;  3CZ6 A;  1FFH A;  2NUP A;  1S7Z A;  4C3B A;  2M4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...