2MWSB

Structure of the complex of ubiquitin and the ubiquitin-like (ubl) domain of ddi1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
79
structure length
79
Chain Sequence
b'DLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
molecule tags Protein transport
source organism Homo sapiens
publication title DNA-Damage-Inducible 1 Protein (Ddi1) Contains an Uncharacteristic Ubiquitin-like Domain that Binds Ubiquitin.
pubmed doi rcsb
total genus 13
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2014-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mwsB00
3S2AA 4LJPB 2DZMA 3KVFB 4HWIB 4FN2A 3NY5A 3IVFA 4FA6A 2DYOA 2WX0A 2JT4B 4EZKA 3WAOA 2PE9A 3L17A 1L7YA 3DVNV 3TIXA 4EZJA 2KFJA 5JHBA 5DPTA 2KKCA 4XX5A 1I42A 4GSWA 3JVZX 3R3MA 3WA0A 4AOFA 3TJPA 3IFWB 4DDID 1WGRA 1P98A 2O2VA 2KTRA 4FJVB 3ML8A 2CHWA 3PVLA 1UBIA 2WWZA 4FBJB 2KK8A 2NVUI 3H7PA 4W9IA 3V6CB 3PTFC 2C7HA 3ZNHB 1TTNA 3PSEB 1Q0WB 2CU1A 4II3B 4BKTA 3DVGX 3ZNZB 2RSUA 2KFKA 2YLMA 2K39A 1V81A 2JXXA 3T9LA 1SE9A 4PYUA 3NZSA 2GMIC 4K7UA 1WZ3A 4KVGB 1RLFA 1XD3B 2CHXA 2R2OA 4MGZE 2DX5B 2WX1A 4MEMA 2ZPYA 4NQLB 4NY0A 3A9JA 1WM2A 3RYTA 4TQ0A 5E6NA 2LGYA 4NAWA 5C1ZA 1X1MA 4K81A 2BWES 2IY1B 4B6WA 5C23A 5G2NA 1VD2A 2JZZA 3CMMB 3RZFA 2FUHB 2N1WA 1WXSA 4JL9A 1F9JA 4GIVA 4HVBA 4RMAA 4F7ZA 3SDLC 3KYDD 4IM0A 1YJ1A 4HCPB 2KJRA 2EMTA 3GOEA 2K8BA 4FLHA 3A1QA 2Z0EB 4GU2A 1YD8U 3SU8X 2O6VD 3UQBA 3ZRFA 2ZZPB 2NPTB 5GMVA 2M17A 4ZRKA 2LXAA 3NS8A 1ZGUB 3L0WB 4FJZA 1H8CA 3EECA 2KDBA 3L08A 3N32A 1H4RA 4HDOA 1XT9B 2L7RA 2UWQA 2MBHA 3PZDA 3VUWA 1WMHB 3A1QB 3ZDMC 2XK5A 3WAPA 1IP9A 4ICUA 1WYWB 2JVCA 2LRWA 2KFKB 2V1YA 3VUYA 4DK5A 4PS7A 2IY0B 3MHSD 4EKUA 4IC7B 1CMXB 2PJHA 1G6JA 3DDCB 4KDIC 4HLEA 2NCNA 1EUVB 4P7IA 2GBKA 1WY8A 2N9PC 2PE6B 2D2QA 4RM8A 4BVUC 2MLBA 2BGFA 2KWVB 3LJ3A 2B3AA 4ZRIA 1IPGA 3OLMD 1J8CA 1OGWA 2L05A 2KMCA 2BYFA 1VCBA 2DENB 1WGHA 1J19A 2AL3A 3OJ4B 5J18A 1KLVA 3L10B 3N30A 2KTRB 4K7SA 3VFKA 4DWFA 4JGHB 2L0FA 3HIZA 2KC1A 3L16A 2QHOA 1P0RA 3VUXA 4EFOA 5J17A 1LQBA 1WR6E 2KDIA 4BOZB 2FCQA 1YX5B 2RPQA 4TQ1A 2OOBB 3A4RA 3I3TB 2DAJA 3VQIA 1WXVA 2BYVE 5D6JB 4BOSC 4MGIE 2ZNVC 2KN5A 2MX2A 4W9EA 3HK0A 1YQBA 2RD0A 1OTRB 2G45B 1KOTA 3NOBA 4FULA 5JH5C 2BF8B 4KSKC 4E3CA 1WGDA 4WWPA 3QAQA 3M3JA 4W9CA 4IWPA 1RFAA 3ZLZA 2KX3A 1RRBA 4ANUA 1V80A 2EKEC 2MRPA 2NBWB 4G50A 3AI5A 4BKSA 1V86A 3VH4B 3DQVA 3K9OB 1WGYA 2IO0B 3ZTCA 4ICVA 4LDTD 3DCGA 4WQOB 1ISNA 2LWPA 4NJ6A 5DPSA 1Z2MA 1WF9A 2ZCBA 5HKHA 2M0XA 1WR1A 4EOYA 2MW5A 2D3GA 1P9DU 3QK0A 4MH0E 1GJZA 4KDLB 4BBNC 1WE6A 3A33B 2AL6A 3PRMB 3ZDTA 3P2BA 4EZLA 1GC7A 2HJ8A 4N9F4 3QJZA 4DHZE 4KSLC 1RAXA 2LD9A 1EF1A 1UELA 2JF5A 1LXDA 1WJNA 3DBHI 4GMVA 1UD7A 1Y8RC 2C5LC 2JZ3B 4NAWB 4GOCA 4HCNB 4ASWC 2XEWA 2KQSA 2K8HA 4MGKE 2M1MA 3LDZE 5IAAC 3JYUA 3APDA 2KD0A 4PS8A 1WX8A 4G3XB 3VVWB 2MP2A 2FCNA 2LZ6A 1WX7A 2JY6A 4XC2A 4W9HA 3WALA 3L54A 2V3SA 2W9NA 2MWSB 2NPTA 2XBBC 4FHKA 4M0WB 2CHZA 2MQJA 4BFRA 4ZRJA 4X57B 3WAMA 3VAWA 2M4NA 2KLGA 4GDLB 3RULA 3TMPB 4XZ4A 1TGZB 2D07B 3W1SC 1WXAA 4ZDVA 1M94A 2IYDB 3APCA 1GC6A 1E7UA 2ZVOA 4AJWA 4MSQB 2A4ZA 1HE8A 3QQ8B 3AULA 4II2B 3U30A 1JRUA 2K1FA 4IWQA 2ZNVB 3V62A 2IBIB 1YIWA 2N9EB 4HDQA 4I6NB 2HD5B 1XQQA 3R7RA 4WWOA 1V49A 3ZRCA 2IZVB 2AWTA 4A20A 1S1QB 1WGGA 2LVOA 3OJ3A 4M8NA 2L0TA 2DZJA 2CS4A 2FCMA 3K9PB 3MJWA 3VTWA 3ZW3A 2PPHA 3RD2A 3ZNID 1D3ZA 2MBQA 1BT0A 4FJYA 3BINA 4E71A 2FCSA 1GUAB 4HXDA 4MELA 4F8CB 1OEYA 2GBMA 4GGQA 4IW0A 4FADA 1V2YA 1R4MI 3DBRI 3HM6X 3DPDA 4GDKA 3M62B 3VDZA 2I1JA 2MSED 5AZGA 5AZFA 2KANA 3VTVA 2KWUB 3H9DA 2BWFA 3QCAA 3L13A 3ZKJC 1WJ4A 3V61A 4KIKA 4W9GA 1WI0A 4ZYNA 2BKFA 1ZW7A 2KXJA 3PS6A 4EUTA 4AP4C 1WE7A 1WJUA 3PHXB 2L00B 3KUDB 4JLCA 3W1SA 2KJ6A 2DYMA 2KVRA 5KHOA 3RUIB 5DPWA 2M8SA 2KDFB 1E90A 3QHTA 3B08A 2BPSA 1U4AA 2KOXA 3PV1A 4WWNA 1P3QU 2KWCA 1PQSA 2DZIA 2KQ7A 2LGXA 3SHQA 4DDGD 5DPRA 1GG3A 3VTUA 2ZEQA 4YL8A 4AJYB 2Z0DB 3PGEA 3VHTC 4HPLB 2ZPNA 2MBBB 3IG3A 3KYCD 1WJ6A 2LRUA 3DVNU 5AZHA 3R7QA 3KW5B 5CHWA 3UF8A 3X0WA 3QARA 3UQAA 2DZKA 3EFUA 1E8XA 2NR2A 4NPNA 1V5OA 2ZCCA 1WH3A 5EDSA 2N7EA 4LDTB 5KHQA 2KHWB 4B9KA 1LFDA 3D32A 1E8YA 2MBOA 2ZJDA 4WJOA 2J7QB 4E74A 3NZUA 3QX1A 1P1AA 4F1SA 1V6EA 5E6PA 3GZNI 3KUCB 1WX9A 3NHEB 4DHJB 1S3SG 3H1UA 3H7PB 3SD5A 3QC8B 1C1YB 4MSMB 2FIFA 4MM3A 2YVCA 1KM7A 4W9FA 5E6OA 1SIFA 4I6LB 1Q1OA 2KNBA 1T0YA 4IG7B 4NJ7A 3PHWB 3UIPB 3VXWA 2HTHA 5FR6A 5LXIB 3WANA 2NBVB 3PRZA 4BKGA 2R2QA 4MJSA 3RCZA 1OEYJ 4NQKE 2DAFA 4GN1A 1TZ1A 1Z5SB 1MG8A 2N4FA 4CO7A 1K8RB 3QA8A 2KJHB 3QWZB 5CX3A 3PRPB 2REXA 3Q3FA 4KZ0A 2L3ZA 1QZEA 1WIAA 2VRRB 2Y5BB 3UGBB 2D10A 3BY4B 4GXBA 5JZEB 2G4DB 2D11A 3PT2B 4FHJA 2FIDA 1FXTB 5LLIA 3MTNB 4IM2A 3HHMA 3H7SA 3PLUA 4GDKB 4LJOB 5G55A 3TBLD 2N1VA 2BKRB 3ALBA 3DBLI 3CSTA 4K7WA 5LXHA 4CHKA 1WZ0A 4A3PA 2IO2B 2AEHA 1NI2A 1SGHA 4KIKB 2K25A 2NS5A 2LASA 3C0RB 3WIMA 5AEKB 3R66C 4G0NB 4ANVA 3EHVA 2V4LA 2IO1B 2GBRA 3TCAA 2KC2A 5DCNA 4GB9A 2RGFA 4JIOU 1Q5WB 2FAZA 2LVPA 3APFA 3B1LX 4W9LA 2C7NB 2K8CA 4WJPA 3U8ZA 5D7GA 4AUQC 1R4NI 3JSVA 5BO4B 1E5WA 2AYOB 2EMSA 4I6PA 2O2VB 3DBSA 4TV3A 1E8ZA 1IYFA 1UZXB 1A5RA 2LJ5A 3UIOB 1J0GA 5TR5A 3VH3B 4WJQA 3M63B 4B95A 3N3KB 3M95A 3UINB 3TL5A 3CSFA 3PLVA 2MA9B 2JRIB 2L76A 3A9KB 3IHPC 3QIJA 4W9KA 3ZIMA 5J2RA 2J0MA 3PPAA 4PS3A 1ZKHA 1L2NA 5D94A 3ZO5B 2G3QB 2I1KA 1NBFC 2L8JA 3A9JB 1WFYA 3JW0X 4CYEA 5D2MB 2DYBA 3H6NA 2HE7A 5IA7A 1WMHA 4KZCA 1AARA 1I35A 3ZTDA 4DHJD 4RM9A 3U7DA 1EF5A 2PEAA 4AWJA 1C3TA 1GNUA 2CR5A 4OVUA 2BYEA 4GDLA 4BKSD 2LXCA 2MBEA 3HM3A 4LCDE 3ENEA 3ZNGC 4DBGA 1V5TA 1WXMA 1WRDB 2ASQA 1UH6A 2G4SA 2O6VB 4ANWA 4OVVA 5CHVC 2CKHB 1NDDA 5L95C 2K6DB 2JPHA 2GBNA 2C60A 1EO6A 4A3OA 2KMAA 1UGMA 4DXAB 4M8MA 1KJTA 3JSVB 4JQWC 3B0AA 5JHAA 3ML9A 4W9JA 2NBUA 3ZVVA 2GOWA 4K1RB 3AXCA 3RZWC 2Z59B 4KV2A 2KLCA 3Q3JA 2J0KA 4ANXA 3V60A 3RT3B 2GBJA 3EC8A 2FNJB 3OAWA 4W9DA 2JUOA 3IBEA 4HK2A 4NNJB 3A9KA 4WJNA 2LVQA 3A4SC 1LM8B 4TKNA 1WM3A 4URKA 3ONSA 1V9JA 3DVGY 2N9XA 2LUEA 4G11A 3X23A 2KX0A 4HPMB 4PYZA 2IO3B 1OQYA 3W1YA 2LGDA 2KTFA 4DHZB 2N7DA 2C7MB 4HJKA 2DHZA 2RR9A 4IWOA 4J6IA 3KUZA 1E8WA 4TUUA 2KDEB 1UBQA 2J0JA 3T8MA 2KZRA 5L83A 2UYZB 3O65B 2A5UA 3V6EB 3ZUNA 3AU5A 3KH0A 5CTRC 3CF6E 4IUMB 4BBNF 2MP2B 2O6VA 1TBEA 2XK5B 2K6QA 2WDTB 3PREA 4EEWA 2OJRA 3ECIA 1E7VA 2C9WB 2WYQA 2MCNB 4IM3A 1YX6B 2ZVNA 3DOWA 5CHFA 2JWZA 3AU4A 2KO3A 4WAAA 2LI5A 4MGYE 4MJSB 2JRHA 4MDKE
chains in the Genus database with same CATH superfamily
5BMIA 3KVFB 4HWIB 1PUTA 3FILB 4EZKA 1ESFA 3DVNV 2EKIA 3I9V1 5G5HA 4ARCA 3WA0A 3FKYA 3PVLA 4HROA 2NVUI 4GLSC 2CU1A 4II3B 5IKCM 4M02A 2JX5A 1VR9A 4PYUA 3NZSA 2J4XA 2R2OA 2WX1A 2BBCA 4TQ0A 3BVZA 3T3OA 2KT7A 3WCQA 4B6WA 2JZZA 4YTPB 2FUHB 4HVBA 1I4XA 2KJRA 4L1BA 4YSXB 3A1QA 1ET6A 3ZJTA 3NVZA 4L23A 2V9HA 1ZE3D 2WU2B 4LNFA 1VLBA 2M17A 1ZGUB 2ICIA 4FJZA 2KDBA 1FD6A 3N32A 2MHJA 2L7RA 2MBHA 2ON8A 2ONQA 4ZHPA 3ZDMC 4MACA 2LRWA 2QIEB 2LGIA 4EKUA 1QILA 2D2QA 1K50A 2KWVB 1GPXA 3LJ3A 1PGAA 1RM6C 5MPOA 3U2SC 5J18A 3C19A 3GZNB 4K7SA 3I5JC 2CJNA 3L16A 5J17A 1WR6E 4LNIA 1HZ5A 2OOBB 3A4RA 3I3TB 1JRPA 2DAJA 1FNVA 2MX2A 1KOTA 2D3AA 4E3CA 4LNNA 4WWPA 2IDYA 3M3JA 3MC0B 4IWPA 3RNEC 5AUKA 1HTQA 1OQRA 2KX3A 1V80A 1FRDA 1IBXA 2AQ3B 1BUIC 1V86A 3DQVA 1WGYA 3P4PB 4ICVA 4LDTD 2QEJC 3ZXVA 3DCGA 1UWXA 2ZCBA 1T0SC 3QK0A 1GJZA 2M0AA 1N5XA 4KDLB 4BBNC 3A33B 3KWLA 4EZLA 4N9F4 1RAXA 1UELA 4NAWB 3I63C 3AB5A 3SR6A 3AEGB 1YOVB 1N63A 2KQSA 2M1MA 1SSNA 3JYUA 2GB1A 2KD0A 4PS8A 1QOBA 2LZ6A 1WX7A 1RWSA 4W9HA 3WALA 2XBBC 4AQ7A 2MJEA 2WDVB 4NJCA 4ZRJA 2V3NA 1F52A 3VAWA 2Y3AA 1TGZB 2D07B 1M94A 2IYDB 2VH2A 2DWQA 2ZVOA 3AULA 4II2B 1JRUA 3AMZA 4IWQA 3HVDA 4WURA 4USAA 1XQQA 3R7RA 3ZRCA 2IZVB 1T0RC 4C4VB 2L0TA 2DZJA 2FCMA 2PPHA 1BT0A 2L1AA 4US8A 2LJIA 2TSSA 3AE5B 1R4MI 2LFIA 1YN4A 3M62B 2I1JA 3Q8CA 3VTVA 3V61A 2KXJA 1ZW7A 2YEPF 3PS6A 4P16A 2IPKD 4JLCA 1E7PB 3KUDB 3W1SA 1NI3A 1EWCA 4N59A 2M8SA 2VH1A 2KDFB 3ZJVA 1E90A 1Q10A 3QHTA 2BPSA 1U4AA 2KOXA 3BYYB 3PV1A 4DXGA 2DZIA 2UU7A 1QOGA 3VTUA 3MJ5A 3PGEA 3ZJUA 2ZPNA 2MBBB 3IG3A 3KW5B 1E8XA 2NR2A 3W5VB 2ZCCA 2WXFA 4M00A 2N7EA 2Z8LA 5KHQA 2KHWB 4B9KA 2MBOA 2E6XA 3TUOA 1MJDA 3NZUA 3QX1A 4F1SA 1V6EA 3KUCB 1WX9A 4XDCA 3AH7A 1C1YB 4MSMB 1SIFA 3DWMA 5LXIB 2NBVB 1KFYB 2R61A 2ZW1A 1RYJA 2ZW0A 3RN9C 2DAFA 4GN1A 1Z5SB 2KACA 2REXA 1FO4A 2VRRB 2Y5BB 3BY4B 4GXBA 4FHJA 1FXTB 3EUB2 1D5XC 3HHMA 3Q8BA 2J53A 3TBLD 1PFDA 2BKRB 1ZDXA 1YMHE 3NRZA 4PK1A 2IO2B 2WHIA 3NVWA 3R66C 1NEKB 4KX6B 2SEBD 2PVOD 2V4LA 3Q8AA 2RGFA 4JIOU 2WXKA 1Q5WB 4AS1A 3APFA 2C7NB 4WJPA 4AUQC 3RNAC 2PW9A 3AE4B 2O2VB 1FCCC 3DBSA 5EE9A 1IYFA 3AECB 2LJ5A 3AE7B 3M63B 1D5ZC 1PYWD 2QJLA 3M95A 3N3KB 3Q69A 2XNAC 4OVZA 2MA9B 3A9KB 3QIJA 3ZIMA 4W9KA 4A8XC 2RDBC 3P4QB 1SJHD 1JQ4A 5H92C 2DYBA 3H6NA 5IA7A 1XLQA 2WXJA 4XGAB 3ZTDA 1EU4A 2WXGA 4ZRPA 1CZPA 4DBGA 1V5TA 1WRDB 3N1XC 2V0GA 1NYRA 2G4SA 1IGDA 4RGOS 5L95C 1VDVA 2K6DB 2GBNA 2JPHA 1EO6A 1M4VA 2KMAA 4YXDB 4DXAB 4WAFA 1I4PA 3TEWA 3B0AA 5JHAA 2GOWA 3RZWC 2J0KA 3V60A 3RT3B 3IBEA 4HK2A 1UGJA 3A9KA 4OW0A 2BQQA 3OG5A 1LO5D 1WM3A 2IGDA 2WDQB 2W54A 4HPMB 3EA6A 4TSSA 3B9JA 2IO3B 2KTFA 2LGDA 2C7MB 4IWOA 1FCLA 1E8WA 4NZLB 2UYZB 3V6EB 1IUEA 3ZUNA 3KH0A 1XLPA 5I4DA 2XK5B 2K6QA 4EEWA 2OJRA 1JW9D 5H8YE 3AU4A 2LI5A 1L0XB 5D6JB 2JRHA 1E6EB 4LJPB 4DXFA 4C56C 2DZMA 2NMQA 2V4IB 2JT4B 4LTUA 3WAOA 3KQ4A 2PMVA 3NZ3A 2KKCA 1I42A 4AOFA 3TJPA 3SFDB 3IFWB 2OEDA 1WGRA 1P98A 2O2VA 4FJVB 2MJDA 3VR8B 1B9RA 2KK8A 5BYRA 3IXSA 3PSEB 2WP9B 2WDRB 3DVGX 2RSUA 1KTKA 2YLMA 2WGSA 3TSSA 3T9LA 2AQ2B 1ZXHA 1KLGD 4K7UA 1RLFA 1XD3B 2B76B 2CHXA 4MGZE 5LNK1 4NQLB 1V1PA 3RYTA 4R3DA 5E6NA 2LGYA 5C1ZA 2V3PA 2EELA 3RPFC 2N1WA 1F9JA 4RMAA 3SDLC 3KYDD 1YJ1A 1TT5B 4HCPB 1JWAD 2EMTA 3GOEA 2K8BA 4FLHA 2Z0EB 1YD8U 3SU8X 2O6VD 3ZRFA 3U52E 3ZQ4A 4FXCA 3NS8A 1H8CA 3L08A 1H4RA 4M01A 3V3XA 3PZDA 2LEKA 1KLUD 2XK5A 3WAPA 3J9CA 1I4GA 3MHSD 4IC7B 1G6JA 2LGSA 4P6VF 4C80A 1EUVB 5G5GA 4P7IA 2GBKA 1WY8A 1QLBB 2N9PC 1FNWA 4BVUC 2BGFA 2B3AA 4HRSA 1IPGA 4WIPA 3BVGA 1TZOA 1J8CA 1OGWA 2L05A 2DENB 1L5PA 3OJ4B 1KLVA 3L10B 4DWFA 4JGHB 3HIZA 2KC1A 4KKIA 2L32A 2KDIA 1LGRA 3MHZA 4TQ1A 1FM0D 3FAHA 2BYVE 2BTEA 3PZ7A 3DWGC 4BOSC 1YQBA 1OTRB 2G45B 3W2DA 1YN3A 3NOBA 2BF8B 4KSKC 3V05A 1ACCA 3QAQA 4W9CA 2FE8A 3ZLZA 1R4NB 4ANUA 2EKEC 2MRPA 2OHFA 4G50A 3AI5A 3P4SB 4BKSA 1MHXA 3VH4B 2IO0B 3ZTCA 3IT6B 4WQOB 2LWPA 4MH8A 4NJ6A 5DPSA 1QOAA 1WF9A 1HQRD 3BK1A 4EOYA 2MW5A 1P9DU 2BYTA 4REZA 2YEPB 3PRMB 3U4EG 2H89B 3QJZA 1EWYC 1EF1A 4GMVA 3DBHI 1LXDA 3VFKA 3VQIA 3GS2A 4GOCA 1P7FA 2INPE 1TJEA 4MGKE 3ZYYX 3VVWB 4G3XB 1GB1A 2V3SA 5AUIA 1XEEA 1HXYD 2NPTA 4FHKA 3WAMA 1PGXA 2M4NA 2KLGA 3BIID 4XZ4A 3W1SC 1WXAA 3R2IA 1L0YB 1E10A 4XDDA 1GC6A 2A4ZA 3U30A 2ZNVB 1YIWA 2N9EB 1L6UA 2HD5B 1HZ6A 1MHHE 3RNBC 1V49A 4ITKA 4HKZE 1S1QB 2LVOA 2CS4A 3MJWA 3ZW3A 3RD2A 2KVZA 2QMTA 1E9MA 4FJYA 3HVZA 2NTTA 2GRIA 4JE3B 3LYYA 4MELA 5BMGA 1XLNA 3Q3OC 2HTME 3HM6X 3RI7C 2L83A 2MSED 2KANA 1YJJA 2KWUB 2BWFA 1HEZE 3Q3NC 4W9GA 2LHEA 2L52A 2BKFA 4EUTA 3ZGZA 1P7EA 2L00B 5KHOA 1A70A 3GB1A 4WWNA 1P3QU 2IGHA 1PQSA 2KQ7A 1YNTE 1CJEA 2X8XX 4DDGD 5DPRA 1MVKA 3KYCD 1F0ZA 2RDGA 3C8YA 4HPPA 2HDEA 1AWDA 5EDSA 1C4AA 1LFDA 2ZJDA 2N9KA 2IGGA 3GZNI 3NHEB 3Q6BA 3H7PB 4W9FA 1N5WA 4I6LB 3LXFA 2KNBA 4IG7B 3UIPB 1C76A 1OFFA 2HTHA 1UWMA 2K5PA 3PRZA 2KQ4X 4D2KA 4MJSA 3GE3C 1V97A 4NQKE 1GB4A 4XE0A 1KRHA 1TS5A 1K8RB 3QA8A 2W82A 3QWZB 3PRPB 1J7BA 2CJOA 2L3ZA 1QZEA 1WIAA 3FC4A 4HJGE 3UGBB 3PT2B 4LK0M 3DHGC 4IM2A 4LJOB 3H7SA 2N1VA 1BXTA 5D3IB 3CSTA 1WZ0A 3DBLB 4HEA1 2KDMA 2AEHA 1VZ6A 1T0QC 2E3TA 3R8BA 5AEKB 1SJED 3AV8A 3NVYA 4G0NB 3EHVA 2WXRA 2Q5WD 2FAZA 4W9LA 4YTMB 3JSVA 5BO4B 4US9A 1E5WA 1FXIA 1E8ZA 1A5RA 3BYTB 1MPEA 4WJQA 4B95A 3IHPC 2J0MA 3PPAA 1ZKHA 5D94A 3ZO5B 4IDIA 4B0EA 2L8JA 3A9JB 3AEAB 5D2MB 4CQNA 2HE7A 2WXOA 1WMHA 4QAYA 4YSZB 1L4ZB 2JU6X 4DHJD 2PEAA 1XO3A 4AWJA 2CR5A 4BKSD 2MBEA 3HM3A 3ENEA 1ZUD2 2ACZB 1F2RI 2O6VB 1NYQA 3HRDD 5CHVC 4A3OA 2W3RA 4M8MA 1KJTA 3JSVB 3AE6B 4JQWC 4C4VA 4ZYSA 3ZVVA 1KH0A 3OAWA 2FNJB 2XN9C 5IOIA 3A4SC 2MJ3A 2WQYB 4JWSC 4TKNA 3ONSA 2LUEA 4P1CC 3TEYA 2N7JA 4DHZB 2N7DA 2RR9A 4J6IA 5JXVA 3KUZA 4TUUA 2KDEB 4XWTA 3T8MA 2D3CA 5L83A 1TY2A 3O65B 1WWTA 1L4DB 1SEBD 4BBNF 4IUMB 2MP2B 1E7VA 2WYQA 2AX5A 1AW7A 4M0WA 2JWZA 1DOXA 1GAQB 4IOIE 4MGYE 4MJSB 3TEXA 5IO9A 4FA6A 3VRBB 1WGKA 3URYA 1XCQL 2PE9A 2BW2A 3AE8B 3TIXA 5JHBA 2BS4B 1ZP0B 3I57A 3JVZX 4DDID 3ML8A 2CHWA 1UBIA 3AEFB 4FBJB 3H7PA 1ZPSA 3V6CB 2C7HA 3ZNHB 1Q0WB 2KYWA 2JYEA 2JZPA 3AEEB 1WZ3A 4RNAA 4MEMA 4UDUC 3EFCA 1X1MA 4K81A 4YSYB 5C23A 5G2NA 4WWMA 4A9AA 4JL9A 4GIVA 4F7ZA 1I4RA 4GU2A 3AEBB 2ZZPB 2NPTB 3ETRA 5GMVA 2LXAA 3L0WB 4LNOA 4O1NA 4HDOA 3AM9A 2UWQA 3VUWA 5BYSA 1WMHB 4A55A 3A1QB 3O13A 1WYWB 5IP4D 1Y56A 2KFKB 2V1YA 4DK5A 4PS7A 1CMXB 2PJHA 3DDCB 4KDIC 1XF5L 2NCNA 4HLEA 1YQ4B 1T6BX 2PE6B 3BK2A 2SAKA 3DBHB 4RM8A 2G1EA 4ZRIA 3OLMD 2N9LA 2KMCA 2BYFA 1VCBA 1N6ZA 1J19A 3N1ZC 3N30A 4LLGM 4RFBA 2L0FA 1JWSD 1XXGA 1YX5B 3U7ZA 2RPQA 4YWGG 2OJWA 3SFEB 1SE3A 4MGIE 4W9EA 4YT0B 3HK0A 2RD0A 5JH5C 3B2GA 2QILA 1RFAA 1RRBA 3IAS1 3W9CB 1D4BA 2NBWB 2JWUA 5HI1A 1MI0A 3N1YC 4XYCA 1Z2MA 5HKHA 1WR1A 1XCTL 2D3GA 4MH0E 3P2BA 5T8IA 2LD9A 3KLSX 2JF5A 1WJNA 1UD7A 2C5LC 2JZ3B 4Q2JA 4OZBA 1F2RC 1FPYA 1TY0A 2LUMA 2K8HA 5IAAC 3APDA 1WX8A 4XC2A 4ARIA 2MWSB 4BFRA 1FFUA 4J3OD 2RDHA 4H2AA 1ZDVA 3RULA 2JXTA 3TMPB 2WXPA 2W3SA 4ZDVA 3APCA 1UUPA 1D6EC 4S17A 1E7UA 4MSQB 1HE8A 2IBIB 4HDQA 2WS3B 3Q8FA 1N62A 2AWTA 2CU3A 2KWDA 3DHHC 2VZKD 3BINA 1GUAB 4F8CB 4GGQA 4IW0A 4ZOHC 3IAM1 2M19A 3DBRI 1L0VB 3VDZA 3H9DA 3L13A 1WJ4A 1WI0A 4ZYNA 1DOYA 2HJ1A 4AP4C 1WE7A 3E56A 1WJUA 2KVRA 3RUIB 1TS4A 4IKGA 5DPWA 2X38A 2J42A 5HFYA 2LGXA 3SHQA 1MFWA 2ZEQA 4AJYB 2Z0DB 3VHTC 2WXLA 1T3QA 3X0WA 3DVNU 1F1HA 4LNKA 1QOFA 5CHWA 3UF8A 4N6EB 1YN5A 3UQAA 2DZKA 3EFUA 2PTLA 4NPNA 1V5OA 1UNSA 3GP7A 1E8YA 1HA5A 4WJOA 2I2YA 4DHJB 1V1OA 1QKZA 3QC8B 2FIFA 1KM7A 1Q1OA 4NJ7A 3PHWB 3RNFC 3NUHB 5FR6A 3WANA 4BKGA 2R2QA 1FMAD 3RCZA 3BWUD 1OEYJ 1R4MB 2KMMA 3VRAB 1TZ1A 5CX3A 2PIAA 4OZAA 3Q3FA 4KZ0A 5JZEB 2G4DB 5LLIA 2J52A 3PLUA 3ZXRA 3P1MA 4GDKB 5BYQA 3ALBA 4JWUC 2FUG1 5HHDG 5LXHA 4DQOC 4A3PA 1SGHA 3EGRA 2NS5A 2LASA 3WIMA 2BB6A 1OQQA 1JWMD 1FFVA 4OHJA 5GXGB 3AE3B 2LVPA 3B1LX 3PO0A 2AYOB 4TV3A 4ZHOA 1SE4A 1UZXB 3UIOB 1E0ZA 4P1BC 5TR5A 3VH3B 2Y5PA 3AE9B 2JQRB 3RFZB 3R2TA 1ZXIA 2JRIB 2L76A 2MH7A 1VJKA 1L2NA 3Q2AC 1CQVA 4RH6A 4CYEA 4KZCA 1I35A 3AE1B 4MM3B 1B1ZA 4RM9A 1EF5A 1I4QA 1FXAA 4RF0A 1C3TA 4OVUA 2BYEA 1PGBA 2LXCA 4LCDE 3ZNGC 3NS1A 1WXMA 1UH6A 1C4CA 1C78A 1JWBD 1UGMA 4KGRA 1IBXB 3ML9A 2NBUA 3AXCA 2KLCA 3Q3JA 2K9XA 1QT9A 3KWVA 2JYTA 3RNGC 1VRAB 2GBJA 4W9DA 2LMCA 2LVQA 4URKA 2AQ1B 2N9XA 1JALA 4G11A 4PYZA 3W1YA 3BZDB 2M56B 3RMKC 4HJKA 4ACFA 2DLBA 2J0JA 4RF1A 1RFKA 4S0RA 3AE2B 2BS2B 2A5UA 3AU5A 1TBEA 2WDTB 3PREA 3ECIA 3OWEB 2MCNB 4IM3A 1YX6B 3DOWA 5FKAC 2KO3A 4WAAA 4MDKE 3S2AA 1K52A 4MT5A 4FN2A 3NY5A 3IVFA 2DYOA 2WX0A 3LB8C 1TIFA 3L17A 1L7YA 4EZJA 2KFJA 1FEHA 5DPTA 4XX5A 4GSWA 3R3MA 5EE3A 2KTRA 1CK1A 2WWZA 4W9IA 1XLOA 3PTFC 1TTNA 4BKTA 3ZNZB 2KFKA 1TKEA 2K39A 4BZAA 1V81A 2JXXA 2WU5B 4EE2A 4PT5A 1SE9A 2GMIC 4KVGB 2DX5B 3PZ8A 2GLSA 2K0PA 4C00A 2ZPYA 4NY0A 3A9JA 1WM2A 1SF0A 4NAWA 4RGMA 2NTSA 4C7ZA 4OZCA 1DYQA 2BWES 2IY1B 1VD2A 3CMMB 3RZFA 1FIQA 1N60A 2INNE 3N20C 1WXSA 1TKGA 4BAXA 4IM0A 3H8HA 2N0SB 2WXMA 3P4RB 2BS3B 3UQBA 1YJIA 4TMAB 3B2FA 1UF0A 4ZRKA 2BB5A 1K53A 3EECA 1XT9B 2QSDA 1IP9A 4ICUA 2JVCA 1WSPA 3VUYA 3P42A 2IY0B 1IGCA 1JCKB 3IT4B 2QDFA 1MG4A 3Q14C 3FILA 5HG2A 1ET9A 2MLBA 1EU3A 1SBBB 2VZKB 4WQMA 4HKQA 2WLBA 1WGHA 2AL3A 1SE2A 1C9FA 2KTRB 3NG0A 1TKYA 2PLPA 2QHOA 1P0RA 1JMLA 3VUXA 4EFOA 1LQBA 4BOZB 2FCQA 1C77A 5FK9C 2DBYA 1WXVA 2WNMA 4A90A 4KKJA 1SXTA 2KN5A 2ZNVC 4K3CA 5EE1A 1D5MC 4FULA 2K22A 1WGDA 1I7HA 1KF6B 2RMMA 2KAJA 3T3NA 3K9OB 4C7YA 3DHIC 1ISNA 4ZRQA 2M0XA 2D3BA 3Q8EA 2PVGC 1WE6A 3ZDTA 2AL6A 4B0MA 1GC7A 2HJ8A 3AEDB 3L4PA 4DHZE 4KSLC 3CWIA 1Y8RC 1SIJA 3ABVB 4HCNB 4ASWC 1J7AA 2XEWA 4A6QA 2MEKA 3LDZE 2QCZA 2MP2A 2FCNA 2JY6A 3N9YC 2JSVX 3L54A 2RPVA 2W9NA 4M0WB 1F77A 2LHDA 2CHZA 2MQJA 4X57B 4GDLB 5C2TB 4AJWA 3QQ8B 5D3DA 2K1FA 3V62A 4I6NB 2BVCA 4WWOA 2WXIA 4A20A 1I4HA 1WGGA 3OJ3A 3VTWA 4M8NA 1JWUD 3K9PB 2WXHA 3ZNID 2MBQA 1D3ZA 1DOIA 2W55A 4E71A 2FCSA 4HXDA 1OEYA 2WXNA 3NJTA 4JPSA 2GBMA 4FADA 1NVID 3DBRB 1PDXA 1V2YA 3DPDA 4GDKA 4L2YA 5AZFA 5AZGA 4NAMA 3QCAA 3ZKJC 1WRIA 4KIKA 4KGSA 2GI9A 2DNFA 5TSSA 2IJ0A 1N61A 1WYGA 3PHXB 2KJ6A 2DYMA 2FBWB 4RGTA 1FNUA 3B08A 5IN7A 2KWCA 3E9SA 2D5GA 1STEA 3VR9B 1GG3A 1EM7A 4YL8A 4RGNA 2K3UA 4HPLB 1WJ6A 2LRUA 5AZHA 3R7QA 3QARA 5BMHA 1BMLC 1ENFA 1WH3A 1QF6A 4LDTB 3D32A 4RCOA 2J7QB 1V8CA 4E74A 1P1AA 5E6PA 4N58A 1S3SG 1L6VA 3H1UA 3SD5A 5EE0A 4MM3A 2YVCA 5E6OA 3VXWA 1T0YA 3P63A 2BT6A 1K51A 3MC9A 1J7CA 3NVVA 3SEBA 1MG8A 2N4FA 4CO7A 2KJHB 2WXQA 2D10A 2D11A 2FIDA 3BVMA 3MTNB 5G55A 5C3JB 2Y5CA 2INDC 2I38A 3DBLI 4K7WA 1TS3A 3AN1A 4CHKA 1SB3C 1AYFA 1WXQA 2PKOA 3RNCC 1NI2A 5FR3A 1NENB 4KIKB 2K25A 4YTNB 3C0RB 1AN8A 4ANVA 2IO1B 2GBRA 3TCAA 2KC2A 5DCNA 4GB9A 4XWWA 1C4PA 2K8CA 3U8ZA 5D7GA 1R4NI 3UI3A 2EMSA 4I6PA 1J0GA 3UINB 3TL5A 3CSFA 3PLVA 5J2RA 1YQ3B 1QQRA 4PS3A 1VZ8A 2G3QB 2I1KA 1NBFC 1V1PB 1WFYA 1TYGB 3JW0X 1AARA 3U7DA 2INCC 1TS2A 3MP9A 1GNUA 4GDLA 4KGTA 2ASQA 1ZOYB 4OVVA 2G9HD 5E6JA 4ANWA 1GOZA 2CKHB 1NDDA 1DGJA 2H88B 2C60A 3HUIA 1VZ7A 4W9JA 4K1RB 2Z59B 4KV2A 1R7SA 4ANXA 1JROA 3EC8A 2JUOA 4NNJB 4WJNA 3TEZA 1LM8B 1V9JA 3DVGY 4K3BA 3GE8C 3X23A 2KN4A 2KX0A 1HTOA 1T5XD 1OQYA 2DHZA 1ROEA 3W5UB 1UBQA 3Q3MC 4JX1C 2KZRA 1FRRA 2QC8A 5CTRC 3CF6E 2O6VA 3MFGA 3MC8A 2C9WB 1C79A 2ZVNA 3CIRB 5CHFA 4WH4A
chains in the Genus database with same CATH topology
3S2AA 4LJPB 2DZMA 3KVFB 4HWIB 4FN2A 3NY5A 3IVFA 4FA6A 2DYOA 2WX0A 2JT4B 4EZKA 3WAOA 2PE9A 3L17A 1L7YA 3DVNV 3TIXA 4EZJA 2KFJA 5JHBA 5DPTA 2KKCA 4XX5A 1I42A 4GSWA 3JVZX 3R3MA 3WA0A 4AOFA 3TJPA 3IFWB 4DDID 1WGRA 1P98A 2O2VA 2KTRA 4FJVB 3ML8A 2CHWA 3PVLA 1UBIA 2WWZA 4FBJB 2KK8A 2NVUI 3H7PA 4W9IA 3V6CB 3PTFC 2C7HA 3ZNHB 1TTNA 3PSEB 1Q0WB 2CU1A 4II3B 4BKTA 3DVGX 3ZNZB 2RSUA 2KFKA 2YLMA 2K39A 1V81A 2JXXA 3T9LA 1SE9A 4PYUA 3NZSA 2GMIC 4K7UA 1WZ3A 4KVGB 1RLFA 1XD3B 2CHXA 2R2OA 4MGZE 2DX5B 2WX1A 4MEMA 2ZPYA 4NQLB 4NY0A 3A9JA 1WM2A 3RYTA 4TQ0A 5E6NA 2LGYA 4NAWA 5C1ZA 1X1MA 4K81A 2BWES 2IY1B 4B6WA 5C23A 5G2NA 1VD2A 2JZZA 3CMMB 3RZFA 2FUHB 2N1WA 1WXSA 4JL9A 1F9JA 4GIVA 4HVBA 4RMAA 4F7ZA 3SDLC 3KYDD 4IM0A 1YJ1A 4HCPB 2KJRA 2EMTA 3GOEA 2K8BA 4FLHA 3A1QA 2Z0EB 4GU2A 1YD8U 3SU8X 2O6VD 3UQBA 3ZRFA 2ZZPB 2NPTB 5GMVA 2M17A 4ZRKA 2LXAA 3NS8A 1ZGUB 3L0WB 4FJZA 1H8CA 3EECA 2KDBA 3L08A 3N32A 1H4RA 4HDOA 1XT9B 2L7RA 2UWQA 2MBHA 3PZDA 3VUWA 1WMHB 3A1QB 3ZDMC 2XK5A 3WAPA 1IP9A 4ICUA 1WYWB 2JVCA 2LRWA 2KFKB 2V1YA 3VUYA 4DK5A 4PS7A 2IY0B 3MHSD 4EKUA 4IC7B 1CMXB 2PJHA 1G6JA 3DDCB 4KDIC 4HLEA 2NCNA 1EUVB 4P7IA 2GBKA 1WY8A 2N9PC 2PE6B 2D2QA 4RM8A 4BVUC 2MLBA 2BGFA 2KWVB 3LJ3A 2B3AA 4ZRIA 1IPGA 3OLMD 1J8CA 1OGWA 2L05A 2KMCA 2BYFA 1VCBA 2DENB 1WGHA 1J19A 2AL3A 3OJ4B 5J18A 1KLVA 3L10B 3N30A 2KTRB 4K7SA 3VFKA 4DWFA 4JGHB 2L0FA 3HIZA 2KC1A 3L16A 2QHOA 1P0RA 3VUXA 4EFOA 5J17A 1LQBA 1WR6E 2KDIA 4BOZB 2FCQA 1YX5B 2RPQA 4TQ1A 2OOBB 3A4RA 3I3TB 2DAJA 3VQIA 1WXVA 2BYVE 5D6JB 4BOSC 4MGIE 2ZNVC 2KN5A 2MX2A 4W9EA 3HK0A 1YQBA 2RD0A 1OTRB 2G45B 1KOTA 3NOBA 4FULA 5JH5C 2BF8B 4KSKC 4E3CA 1WGDA 4WWPA 3QAQA 3M3JA 4W9CA 4IWPA 1RFAA 3ZLZA 2KX3A 1RRBA 4ANUA 1V80A 2EKEC 2MRPA 2NBWB 4G50A 3AI5A 4BKSA 1V86A 3VH4B 3DQVA 3K9OB 1WGYA 2IO0B 3ZTCA 4ICVA 4LDTD 3DCGA 4WQOB 1ISNA 2LWPA 4NJ6A 5DPSA 1Z2MA 1WF9A 2ZCBA 5HKHA 2M0XA 1WR1A 4EOYA 2MW5A 2D3GA 1P9DU 3QK0A 4MH0E 1GJZA 4KDLB 4BBNC 1WE6A 3A33B 2AL6A 3PRMB 3ZDTA 3P2BA 4EZLA 1GC7A 2HJ8A 4N9F4 3QJZA 4DHZE 4KSLC 1RAXA 2LD9A 1EF1A 1UELA 2JF5A 1LXDA 1WJNA 3DBHI 4GMVA 1UD7A 1Y8RC 2C5LC 2JZ3B 4NAWB 4GOCA 4HCNB 4ASWC 2XEWA 2KQSA 2K8HA 4MGKE 2M1MA 3LDZE 5IAAC 3JYUA 3APDA 2KD0A 4PS8A 1WX8A 4G3XB 3VVWB 2MP2A 2FCNA 2LZ6A 1WX7A 2JY6A 4XC2A 4W9HA 3WALA 3L54A 2V3SA 2W9NA 2MWSB 2NPTA 2XBBC 4FHKA 4M0WB 2CHZA 2MQJA 4BFRA 4ZRJA 4X57B 3WAMA 3VAWA 2M4NA 2KLGA 4GDLB 3RULA 3TMPB 4XZ4A 1TGZB 2D07B 3W1SC 1WXAA 4ZDVA 1M94A 2IYDB 3APCA 1GC6A 1E7UA 2ZVOA 4AJWA 4MSQB 2A4ZA 1HE8A 3QQ8B 3AULA 4II2B 3U30A 1JRUA 2K1FA 4IWQA 2ZNVB 3V62A 2IBIB 1YIWA 2N9EB 4HDQA 4I6NB 2HD5B 1XQQA 3R7RA 4WWOA 1V49A 3ZRCA 2IZVB 2AWTA 4A20A 1S1QB 1WGGA 2LVOA 3OJ3A 4M8NA 2L0TA 2DZJA 2CS4A 2FCMA 3K9PB 3MJWA 3VTWA 3ZW3A 2PPHA 3RD2A 3ZNID 1D3ZA 2MBQA 1BT0A 4FJYA 3BINA 4E71A 2FCSA 1GUAB 4HXDA 4MELA 4F8CB 1OEYA 2GBMA 4GGQA 4IW0A 4FADA 1V2YA 1R4MI 3DBRI 3HM6X 3DPDA 4GDKA 3M62B 3VDZA 2I1JA 2MSED 5AZGA 5AZFA 2KANA 3VTVA 2KWUB 3H9DA 2BWFA 3QCAA 3L13A 3ZKJC 1WJ4A 3V61A 4KIKA 4W9GA 1WI0A 4ZYNA 2BKFA 1ZW7A 2KXJA 3PS6A 4EUTA 4AP4C 1WE7A 1WJUA 3PHXB 2L00B 3KUDB 4JLCA 3W1SA 2KJ6A 2DYMA 2KVRA 5KHOA 3RUIB 5DPWA 2M8SA 2KDFB 1E90A 3QHTA 3B08A 2BPSA 1U4AA 2KOXA 3PV1A 4WWNA 1P3QU 2KWCA 1PQSA 2DZIA 2KQ7A 2LGXA 3SHQA 4DDGD 5DPRA 1GG3A 3VTUA 2ZEQA 4YL8A 4AJYB 2Z0DB 3PGEA 3VHTC 4HPLB 2ZPNA 2MBBB 3IG3A 3KYCD 1WJ6A 2LRUA 3DVNU 5AZHA 3R7QA 3KW5B 5CHWA 3UF8A 3X0WA 3QARA 3UQAA 2DZKA 3EFUA 1E8XA 2NR2A 4NPNA 1V5OA 2ZCCA 1WH3A 5EDSA 2N7EA 4LDTB 5KHQA 2KHWB 4B9KA 1LFDA 3D32A 1E8YA 2MBOA 2ZJDA 4WJOA 2J7QB 4E74A 3NZUA 3QX1A 1P1AA 4F1SA 1V6EA 5E6PA 3GZNI 3KUCB 1WX9A 3NHEB 4DHJB 1S3SG 3H1UA 3H7PB 3SD5A 3QC8B 1C1YB 4MSMB 2FIFA 4MM3A 2YVCA 1KM7A 4W9FA 5E6OA 1SIFA 4I6LB 1Q1OA 2KNBA 1T0YA 4IG7B 4NJ7A 3PHWB 3UIPB 3VXWA 2HTHA 5FR6A 5LXIB 3WANA 2NBVB 3PRZA 4BKGA 2R2QA 4MJSA 3RCZA 1OEYJ 4NQKE 2DAFA 4GN1A 1TZ1A 1Z5SB 1MG8A 2N4FA 4CO7A 1K8RB 3QA8A 2KJHB 3QWZB 5CX3A 3PRPB 2REXA 3Q3FA 4KZ0A 2L3ZA 1QZEA 1WIAA 2VRRB 2Y5BB 3UGBB 2D10A 3BY4B 4GXBA 5JZEB 2G4DB 2D11A 3PT2B 4FHJA 2FIDA 1FXTB 5LLIA 3MTNB 4IM2A 3HHMA 3H7SA 3PLUA 4GDKB 4LJOB 5G55A 3TBLD 2N1VA 2BKRB 3ALBA 3DBLI 3CSTA 4K7WA 5LXHA 4CHKA 1WZ0A 4A3PA 2IO2B 2AEHA 1NI2A 1SGHA 4KIKB 2K25A 2NS5A 2LASA 3C0RB 3WIMA 5AEKB 3R66C 4G0NB 4ANVA 3EHVA 2V4LA 2IO1B 2GBRA 3TCAA 2KC2A 5DCNA 4GB9A 2RGFA 4JIOU 1Q5WB 2FAZA 2LVPA 3APFA 3B1LX 4W9LA 2C7NB 2K8CA 4WJPA 3U8ZA 5D7GA 4AUQC 1R4NI 3JSVA 5BO4B 1E5WA 2AYOB 2EMSA 4I6PA 2O2VB 3DBSA 4TV3A 1E8ZA 1IYFA 1UZXB 1A5RA 2LJ5A 3UIOB 1J0GA 5TR5A 3VH3B 4WJQA 3M63B 4B95A 3N3KB 3M95A 3UINB 3TL5A 3CSFA 3PLVA 2MA9B 2JRIB 2L76A 3A9KB 3IHPC 3QIJA 4W9KA 3ZIMA 5J2RA 2J0MA 3PPAA 4PS3A 1ZKHA 1L2NA 5D94A 3ZO5B 2G3QB 2I1KA 1NBFC 2L8JA 3A9JB 1WFYA 3JW0X 4CYEA 5D2MB 2DYBA 3H6NA 2HE7A 5IA7A 1WMHA 4KZCA 1AARA 1I35A 3ZTDA 4DHJD 4RM9A 3U7DA 1EF5A 2PEAA 4AWJA 1C3TA 1GNUA 2CR5A 4OVUA 2BYEA 4GDLA 4BKSD 2LXCA 2MBEA 3HM3A 4LCDE 3ENEA 3ZNGC 4DBGA 1V5TA 1WXMA 1WRDB 2ASQA 1UH6A 2G4SA 2O6VB 4ANWA 4OVVA 5CHVC 2CKHB 1NDDA 5L95C 2K6DB 2JPHA 2GBNA 2C60A 1EO6A 4A3OA 2KMAA 1UGMA 4DXAB 4M8MA 1KJTA 3JSVB 4JQWC 3B0AA 5JHAA 3ML9A 4W9JA 2NBUA 3ZVVA 2GOWA 4K1RB 3AXCA 3RZWC 2Z59B 4KV2A 2KLCA 3Q3JA 2J0KA 4ANXA 3V60A 3RT3B 2GBJA 3EC8A 2FNJB 3OAWA 4W9DA 2JUOA 3IBEA 4HK2A 4NNJB 3A9KA 4WJNA 2LVQA 3A4SC 1LM8B 4TKNA 1WM3A 4URKA 3ONSA 1V9JA 3DVGY 2N9XA 2LUEA 4G11A 3X23A 2KX0A 4HPMB 4PYZA 2IO3B 1OQYA 3W1YA 2LGDA 2KTFA 4DHZB 2N7DA 2C7MB 4HJKA 2DHZA 2RR9A 4IWOA 4J6IA 3KUZA 1E8WA 4TUUA 2KDEB 1UBQA 2J0JA 3T8MA 2KZRA 5L83A 2UYZB 3O65B 2A5UA 3V6EB 3ZUNA 3AU5A 3KH0A 5CTRC 3CF6E 4IUMB 4BBNF 2MP2B 2O6VA 1TBEA 2XK5B 2K6QA 2WDTB 3PREA 4EEWA 2OJRA 3ECIA 1E7VA 2C9WB 2WYQA 2MCNB 4IM3A 1YX6B 2ZVNA 3DOWA 5CHFA 2JWZA 3AU4A 2KO3A 4WAAA 2LI5A 4MGYE 4MJSB 2JRHA 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2A A;  4LJP B;  2DZM A;  3KVF B;  4HWI B;  4FN2 A;  3NY5 A;  3IVF A;  4FA6 A;  2DYO A;  2WX0 A;  2JT4 B;  4EZK A;  3WAO A;  2PE9 A;  3L17 A;  1L7Y A;  3DVN V;  3TIX A;  4EZJ A;  2KFJ A;  5JHB A;  5DPT A;  2KKC A;  4XX5 A;  1I42 A;  4GSW A;  3JVZ X;  3R3M A;  3WA0 A;  4AOF A;  3TJP A;  3IFW B;  4DDI D;  1WGR A;  1P98 A;  2O2V A;  2KTR A;  4FJV B;  3ML8 A;  2CHW A;  3PVL A;  1UBI A;  2WWZ A;  4FBJ B;  2KK8 A;  2NVU I;  3H7P A;  4W9I A;  3V6C B;  3PTF C;  2C7H A;  3ZNH B;  1TTN A;  3PSE B;  1Q0W B;  2CU1 A;  4II3 B;  4BKT A;  3DVG X;  3ZNZ B;  2RSU A;  2KFK A;  2YLM A;  2K39 A;  1V81 A;  2JXX A;  3T9L A;  1SE9 A;  4PYU A;  3NZS A;  2GMI C;  4K7U A;  1WZ3 A;  4KVG B;  1RLF A;  1XD3 B;  2CHX A;  2R2O A;  4MGZ E;  2DX5 B;  2WX1 A;  4MEM A;  2ZPY A;  4NQL B;  4NY0 A;  3A9J A;  1WM2 A;  3RYT A;  4TQ0 A;  5E6N A;  2LGY A;  4NAW A;  5C1Z A;  1X1M A;  4K81 A;  2BWE S;  2IY1 B;  4B6W A;  5C23 A;  5G2N A;  1VD2 A;  2JZZ A;  3CMM B;  3RZF A;  2FUH B;  2N1W A;  1WXS A;  4JL9 A;  1F9J A;  4GIV A;  4HVB A;  4RMA A;  4F7Z A;  3SDL C;  3KYD D;  4IM0 A;  1YJ1 A;  4HCP B;  2KJR A;  2EMT A;  3GOE A;  2K8B A;  4FLH A;  3A1Q A;  2Z0E B;  4GU2 A;  1YD8 U;  3SU8 X;  2O6V D;  3UQB A;  3ZRF A;  2ZZP B;  2NPT B;  5GMV A;  2M17 A;  4ZRK A;  2LXA A;  3NS8 A;  1ZGU B;  3L0W B;  4FJZ A;  1H8C A;  3EEC A;  2KDB A;  3L08 A;  3N32 A;  1H4R A;  4HDO A;  1XT9 B;  2L7R A;  2UWQ A;  2MBH A;  3PZD A;  3VUW A;  1WMH B;  3A1Q B;  3ZDM C;  2XK5 A;  3WAP A;  1IP9 A;  4ICU A;  1WYW B;  2JVC A;  2LRW A;  2KFK B;  2V1Y A;  3VUY A;  4DK5 A;  4PS7 A;  2IY0 B;  3MHS D;  4EKU A;  4IC7 B;  1CMX B;  2PJH A;  1G6J A;  3DDC B;  4KDI C;  4HLE A;  2NCN A;  1EUV B;  4P7I A;  2GBK A;  1WY8 A;  2N9P C;  2PE6 B;  2D2Q A;  4RM8 A;  4BVU C;  2MLB A;  2BGF A;  2KWV B;  3LJ3 A;  2B3A A;  4ZRI A;  1IPG A;  3OLM D;  1J8C A;  1OGW A;  2L05 A;  2KMC A;  2BYF A;  1VCB A;  2DEN B;  1WGH A;  1J19 A;  2AL3 A;  3OJ4 B;  5J18 A;  1KLV A;  3L10 B;  3N30 A;  2KTR B;  4K7S A;  3VFK A;  4DWF A;  4JGH B;  2L0F A;  3HIZ A;  2KC1 A;  3L16 A;  2QHO A;  1P0R A;  3VUX A;  4EFO A;  5J17 A;  1LQB A;  1WR6 E;  2KDI A;  4BOZ B;  2FCQ A;  1YX5 B;  2RPQ A;  4TQ1 A;  2OOB B;  3A4R A;  3I3T B;  2DAJ A;  3VQI A;  1WXV A;  2BYV E;  5D6J B;  4BOS C;  4MGI E;  2ZNV C;  2KN5 A;  2MX2 A;  4W9E A;  3HK0 A;  1YQB A;  2RD0 A;  1OTR B;  2G45 B;  1KOT A;  3NOB A;  4FUL A;  5JH5 C;  2BF8 B;  4KSK C;  4E3C A;  1WGD A;  4WWP A;  3QAQ A;  3M3J A;  4W9C A;  4IWP A;  1RFA A;  3ZLZ A;  2KX3 A;  1RRB A;  4ANU A;  1V80 A;  2EKE C;  2MRP A;  2NBW B;  4G50 A;  3AI5 A;  4BKS A;  1V86 A;  3VH4 B;  3DQV A;  3K9O B;  1WGY A;  2IO0 B;  3ZTC A;  4ICV A;  4LDT D;  3DCG A;  4WQO B;  1ISN A;  2LWP A;  4NJ6 A;  5DPS A;  1Z2M A;  1WF9 A;  2ZCB A;  5HKH A;  2M0X A;  1WR1 A;  4EOY A;  2MW5 A;  2D3G A;  1P9D U;  3QK0 A;  4MH0 E;  1GJZ A;  4KDL B;  4BBN C;  1WE6 A;  3A33 B;  2AL6 A;  3PRM B;  3ZDT A;  3P2B A;  4EZL A;  1GC7 A;  2HJ8 A;  4N9F 4;  3QJZ A;  4DHZ E;  4KSL C;  1RAX A;  2LD9 A;  1EF1 A;  1UEL A;  2JF5 A;  1LXD A;  1WJN A;  3DBH I;  4GMV A;  1UD7 A;  1Y8R C;  2C5L C;  2JZ3 B;  4NAW B;  4GOC A;  4HCN B;  4ASW C;  2XEW A;  2KQS A;  2K8H A;  4MGK E;  2M1M A;  3LDZ E;  5IAA C;  3JYU A;  3APD A;  2KD0 A;  4PS8 A;  1WX8 A;  4G3X B;  3VVW B;  2MP2 A;  2FCN A;  2LZ6 A;  1WX7 A;  2JY6 A;  4XC2 A;  4W9H A;  3WAL A;  3L54 A;  2V3S A;  2W9N A;  2MWS B;  2NPT A;  2XBB C;  4FHK A;  4M0W B;  2CHZ A;  2MQJ A;  4BFR A;  4ZRJ A;  4X57 B;  3WAM A;  3VAW A;  2M4N A;  2KLG A;  4GDL B;  3RUL A;  3TMP B;  4XZ4 A;  1TGZ B;  2D07 B;  3W1S C;  1WXA A;  4ZDV A;  1M94 A;  2IYD B;  3APC A;  1GC6 A;  1E7U A;  2ZVO A;  4AJW A;  4MSQ B;  2A4Z A;  1HE8 A;  3QQ8 B;  3AUL A;  4II2 B;  3U30 A;  1JRU A;  2K1F A;  4IWQ A;  2ZNV B;  3V62 A;  2IBI B;  1YIW A;  2N9E B;  4HDQ A;  4I6N B;  2HD5 B;  1XQQ A;  3R7R A;  4WWO A;  1V49 A;  3ZRC A;  2IZV B;  2AWT A;  4A20 A;  1S1Q B;  1WGG A;  2LVO A;  3OJ3 A;  4M8N A;  2L0T A;  2DZJ A;  2CS4 A;  2FCM A;  3K9P B;  3MJW A;  3VTW A;  3ZW3 A;  2PPH A;  3RD2 A;  3ZNI D;  1D3Z A;  2MBQ A;  1BT0 A;  4FJY A;  3BIN A;  4E71 A;  2FCS A;  1GUA B;  4HXD A;  4MEL A;  4F8C B;  1OEY A;  2GBM A;  4GGQ A;  4IW0 A;  4FAD A;  1V2Y A;  1R4M I;  3DBR I;  3HM6 X;  3DPD A;  4GDK A;  3M62 B;  3VDZ A;  2I1J A;  2MSE D;  5AZG A;  5AZF A;  2KAN A;  3VTV A;  2KWU B;  3H9D A;  2BWF A;  3QCA A;  3L13 A;  3ZKJ C;  1WJ4 A;  3V61 A;  4KIK A;  4W9G A;  1WI0 A;  4ZYN A;  2BKF A;  1ZW7 A;  2KXJ A;  3PS6 A;  4EUT A;  4AP4 C;  1WE7 A;  1WJU A;  3PHX B;  2L00 B;  3KUD B;  4JLC A;  3W1S A;  2KJ6 A;  2DYM A;  2KVR A;  5KHO A;  3RUI B;  5DPW A;  2M8S A;  2KDF B;  1E90 A;  3QHT A;  3B08 A;  2BPS A;  1U4A A;  2KOX A;  3PV1 A;  4WWN A;  1P3Q U;  2KWC A;  1PQS A;  2DZI A;  2KQ7 A;  2LGX A;  3SHQ A;  4DDG D;  5DPR A;  1GG3 A;  3VTU A;  2ZEQ A;  4YL8 A;  4AJY B;  2Z0D B;  3PGE A;  3VHT C;  4HPL B;  2ZPN A;  2MBB B;  3IG3 A;  3KYC D;  1WJ6 A;  2LRU A;  3DVN U;  5AZH A;  3R7Q A;  3KW5 B;  5CHW A;  3UF8 A;  3X0W A;  3QAR A;  3UQA A;  2DZK A;  3EFU A;  1E8X A;  2NR2 A;  4NPN A;  1V5O A;  2ZCC A;  1WH3 A;  5EDS A;  2N7E A;  4LDT B;  5KHQ A;  2KHW B;  4B9K A;  1LFD A;  3D32 A;  1E8Y A;  2MBO A;  2ZJD A;  4WJO A;  2J7Q B;  4E74 A;  3NZU A;  3QX1 A;  1P1A A;  4F1S A;  1V6E A;  5E6P A;  3GZN I;  3KUC B;  1WX9 A;  3NHE B;  4DHJ B;  1S3S G;  3H1U A;  3H7P B;  3SD5 A;  3QC8 B;  1C1Y B;  4MSM B;  2FIF A;  4MM3 A;  2YVC A;  1KM7 A;  4W9F A;  5E6O A;  1SIF A;  4I6L B;  1Q1O A;  2KNB A;  1T0Y A;  4IG7 B;  4NJ7 A;  3PHW B;  3UIP B;  3VXW A;  2HTH A;  5FR6 A;  5LXI B;  3WAN A;  2NBV B;  3PRZ A;  4BKG A;  2R2Q A;  4MJS A;  3RCZ A;  1OEY J;  4NQK E;  2DAF A;  4GN1 A;  1TZ1 A;  1Z5S B;  1MG8 A;  2N4F A;  4CO7 A;  1K8R B;  3QA8 A;  2KJH B;  3QWZ B;  5CX3 A;  3PRP B;  2REX A;  3Q3F A;  4KZ0 A;  2L3Z A;  1QZE A;  1WIA A;  2VRR B;  2Y5B B;  3UGB B;  2D10 A;  3BY4 B;  4GXB A;  5JZE B;  2G4D B;  2D11 A;  3PT2 B;  4FHJ A;  2FID A;  1FXT B;  5LLI A;  3MTN B;  4IM2 A;  3HHM A;  3H7S A;  3PLU A;  4GDK B;  4LJO B;  5G55 A;  3TBL D;  2N1V A;  2BKR B;  3ALB A;  3DBL I;  3CST A;  4K7W A;  5LXH A;  4CHK A;  1WZ0 A;  4A3P A;  2IO2 B;  2AEH A;  1NI2 A;  1SGH A;  4KIK B;  2K25 A;  2NS5 A;  2LAS A;  3C0R B;  3WIM A;  5AEK B;  3R66 C;  4G0N B;  4ANV A;  3EHV A;  2V4L A;  2IO1 B;  2GBR A;  3TCA A;  2KC2 A;  5DCN A;  4GB9 A;  2RGF A;  4JIO U;  1Q5W B;  2FAZ A;  2LVP A;  3APF A;  3B1L X;  4W9L A;  2C7N B;  2K8C A;  4WJP A;  3U8Z A;  5D7G A;  4AUQ C;  1R4N I;  3JSV A;  5BO4 B;  1E5W A;  2AYO B;  2EMS A;  4I6P A;  2O2V B;  3DBS A;  4TV3 A;  1E8Z A;  1IYF A;  1UZX B;  1A5R A;  2LJ5 A;  3UIO B;  1J0G A;  5TR5 A;  3VH3 B;  4WJQ A;  3M63 B;  4B95 A;  3N3K B;  3M95 A;  3UIN B;  3TL5 A;  3CSF A;  3PLV A;  2MA9 B;  2JRI B;  2L76 A;  3A9K B;  3IHP C;  3QIJ A;  4W9K A;  3ZIM A;  5J2R A;  2J0M A;  3PPA A;  4PS3 A;  1ZKH A;  1L2N A;  5D94 A;  3ZO5 B;  2G3Q B;  2I1K A;  1NBF C;  2L8J A;  3A9J B;  1WFY A;  3JW0 X;  4CYE A;  5D2M B;  2DYB A;  3H6N A;  2HE7 A;  5IA7 A;  1WMH A;  4KZC A;  1AAR A;  1I35 A;  3ZTD A;  4DHJ D;  4RM9 A;  3U7D A;  1EF5 A;  2PEA A;  4AWJ A;  1C3T A;  1GNU A;  2CR5 A;  4OVU A;  2BYE A;  4GDL A;  4BKS D;  2LXC A;  2MBE A;  3HM3 A;  4LCD E;  3ENE A;  3ZNG C;  4DBG A;  1V5T A;  1WXM A;  1WRD B;  2ASQ A;  1UH6 A;  2G4S A;  2O6V B;  4ANW A;  4OVV A;  5CHV C;  2CKH B;  1NDD A;  5L95 C;  2K6D B;  2JPH A;  2GBN A;  2C60 A;  1EO6 A;  4A3O A;  2KMA A;  1UGM A;  4DXA B;  4M8M A;  1KJT A;  3JSV B;  4JQW C;  3B0A A;  5JHA A;  3ML9 A;  4W9J A;  2NBU A;  3ZVV A;  2GOW A;  4K1R B;  3AXC A;  3RZW C;  2Z59 B;  4KV2 A;  2KLC A;  3Q3J A;  2J0K A;  4ANX A;  3V60 A;  3RT3 B;  2GBJ A;  3EC8 A;  2FNJ B;  3OAW A;  4W9D A;  2JUO A;  3IBE A;  4HK2 A;  4NNJ B;  3A9K A;  4WJN A;  2LVQ A;  3A4S C;  1LM8 B;  4TKN A;  1WM3 A;  4URK A;  3ONS A;  1V9J A;  3DVG Y;  2N9X A;  2LUE A;  4G11 A;  3X23 A;  2KX0 A;  4HPM B;  4PYZ A;  2IO3 B;  1OQY A;  3W1Y A;  2LGD A;  2KTF A;  4DHZ B;  2N7D A;  2C7M B;  4HJK A;  2DHZ A;  2RR9 A;  4IWO A;  4J6I A;  3KUZ A;  1E8W A;  4TUU A;  2KDE B;  1UBQ A;  2J0J A;  3T8M A;  2KZR A;  5L83 A;  2UYZ B;  3O65 B;  2A5U A;  3V6E B;  3ZUN A;  3AU5 A;  3KH0 A;  5CTR C;  3CF6 E;  4IUM B;  4BBN F;  2MP2 B;  2O6V A;  1TBE A;  2XK5 B;  2K6Q A;  2WDT B;  3PRE A;  4EEW A;  2OJR A;  3ECI A;  1E7V A;  2C9W B;  2WYQ A;  2MCN B;  4IM3 A;  1YX6 B;  2ZVN A;  3DOW A;  5CHF A;  2JWZ A;  3AU4 A;  2KO3 A;  4WAA A;  2LI5 A;  4MGY E;  4MJS B;  2JRH A;  4MDK E; 
#chains in the Genus database with same CATH topology
 5BMI A;  3KVF B;  4HWI B;  1PUT A;  3FIL B;  4EZK A;  1ESF A;  3DVN V;  2EKI A;  3I9V 1;  5G5H A;  4ARC A;  3WA0 A;  3FKY A;  3PVL A;  4HRO A;  2NVU I;  4GLS C;  2CU1 A;  4II3 B;  5IKC M;  4M02 A;  2JX5 A;  1VR9 A;  4PYU A;  3NZS A;  2J4X A;  2R2O A;  2WX1 A;  2BBC A;  4TQ0 A;  3BVZ A;  3T3O A;  2KT7 A;  3WCQ A;  4B6W A;  2JZZ A;  4YTP B;  2FUH B;  4HVB A;  1I4X A;  2KJR A;  4L1B A;  4YSX B;  3A1Q A;  1ET6 A;  3ZJT A;  3NVZ A;  4L23 A;  2V9H A;  1ZE3 D;  2WU2 B;  4LNF A;  1VLB A;  2M17 A;  1ZGU B;  2ICI A;  4FJZ A;  2KDB A;  1FD6 A;  3N32 A;  2MHJ A;  2L7R A;  2MBH A;  2ON8 A;  2ONQ A;  4ZHP A;  3ZDM C;  4MAC A;  2LRW A;  2QIE B;  2LGI A;  4EKU A;  1QIL A;  2D2Q A;  1K50 A;  2KWV B;  1GPX A;  3LJ3 A;  1PGA A;  1RM6 C;  5MPO A;  3U2S C;  5J18 A;  3C19 A;  3GZN B;  4K7S A;  3I5J C;  2CJN A;  3L16 A;  5J17 A;  1WR6 E;  4LNI A;  1HZ5 A;  2OOB B;  3A4R A;  3I3T B;  1JRP A;  2DAJ A;  1FNV A;  2MX2 A;  1KOT A;  2D3A A;  4E3C A;  4LNN A;  4WWP A;  2IDY A;  3M3J A;  3MC0 B;  4IWP A;  3RNE C;  5AUK A;  1HTQ A;  1OQR A;  2KX3 A;  1V80 A;  1FRD A;  1IBX A;  2AQ3 B;  1BUI C;  1V86 A;  3DQV A;  1WGY A;  3P4P B;  4ICV A;  4LDT D;  2QEJ C;  3ZXV A;  3DCG A;  1UWX A;  2ZCB A;  1T0S C;  3QK0 A;  1GJZ A;  2M0A A;  1N5X A;  4KDL B;  4BBN C;  3A33 B;  3KWL A;  4EZL A;  4N9F 4;  1RAX A;  1UEL A;  4NAW B;  3I63 C;  3AB5 A;  3SR6 A;  3AEG B;  1YOV B;  1N63 A;  2KQS A;  2M1M A;  1SSN A;  3JYU A;  2GB1 A;  2KD0 A;  4PS8 A;  1QOB A;  2LZ6 A;  1WX7 A;  1RWS A;  4W9H A;  3WAL A;  2XBB C;  4AQ7 A;  2MJE A;  2WDV B;  4NJC A;  4ZRJ A;  2V3N A;  1F52 A;  3VAW A;  2Y3A A;  1TGZ B;  2D07 B;  1M94 A;  2IYD B;  2VH2 A;  2DWQ A;  2ZVO A;  3AUL A;  4II2 B;  1JRU A;  3AMZ A;  4IWQ A;  3HVD A;  4WUR A;  4USA A;  1XQQ A;  3R7R A;  3ZRC A;  2IZV B;  1T0R C;  4C4V B;  2L0T A;  2DZJ A;  2FCM A;  2PPH A;  1BT0 A;  2L1A A;  4US8 A;  2LJI A;  2TSS A;  3AE5 B;  1R4M I;  2LFI A;  1YN4 A;  3M62 B;  2I1J A;  3Q8C A;  3VTV A;  3V61 A;  2KXJ A;  1ZW7 A;  2YEP F;  3PS6 A;  4P16 A;  2IPK D;  4JLC A;  1E7P B;  3KUD B;  3W1S A;  1NI3 A;  1EWC A;  4N59 A;  2M8S A;  2VH1 A;  2KDF B;  3ZJV A;  1E90 A;  1Q10 A;  3QHT A;  2BPS A;  1U4A A;  2KOX A;  3BYY B;  3PV1 A;  4DXG A;  2DZI A;  2UU7 A;  1QOG A;  3VTU A;  3MJ5 A;  3PGE A;  3ZJU A;  2ZPN A;  2MBB B;  3IG3 A;  3KW5 B;  1E8X A;  2NR2 A;  3W5V B;  2ZCC A;  2WXF A;  4M00 A;  2N7E A;  2Z8L A;  5KHQ A;  2KHW B;  4B9K A;  2MBO A;  2E6X A;  3TUO A;  1MJD A;  3NZU A;  3QX1 A;  4F1S A;  1V6E A;  3KUC B;  1WX9 A;  4XDC A;  3AH7 A;  1C1Y B;  4MSM B;  1SIF A;  3DWM A;  5LXI B;  2NBV B;  1KFY B;  2R61 A;  2ZW1 A;  1RYJ A;  2ZW0 A;  3RN9 C;  2DAF A;  4GN1 A;  1Z5S B;  2KAC A;  2REX A;  1FO4 A;  2VRR B;  2Y5B B;  3BY4 B;  4GXB A;  4FHJ A;  1FXT B;  3EUB 2;  1D5X C;  3HHM A;  3Q8B A;  2J53 A;  3TBL D;  1PFD A;  2BKR B;  1ZDX A;  1YMH E;  3NRZ A;  4PK1 A;  2IO2 B;  2WHI A;  3NVW A;  3R66 C;  1NEK B;  4KX6 B;  2SEB D;  2PVO D;  2V4L A;  3Q8A A;  2RGF A;  4JIO U;  2WXK A;  1Q5W B;  4AS1 A;  3APF A;  2C7N B;  4WJP A;  4AUQ C;  3RNA C;  2PW9 A;  3AE4 B;  2O2V B;  1FCC C;  3DBS A;  5EE9 A;  1IYF A;  3AEC B;  2LJ5 A;  3AE7 B;  3M63 B;  1D5Z C;  1PYW D;  2QJL A;  3M95 A;  3N3K B;  3Q69 A;  2XNA C;  4OVZ A;  2MA9 B;  3A9K B;  3QIJ A;  3ZIM A;  4W9K A;  4A8X C;  2RDB C;  3P4Q B;  1SJH D;  1JQ4 A;  5H92 C;  2DYB A;  3H6N A;  5IA7 A;  1XLQ A;  2WXJ A;  4XGA B;  3ZTD A;  1EU4 A;  2WXG A;  4ZRP A;  1CZP A;  4DBG A;  1V5T A;  1WRD B;  3N1X C;  2V0G A;  1NYR A;  2G4S A;  1IGD A;  4RGO S;  5L95 C;  1VDV A;  2K6D B;  2GBN A;  2JPH A;  1EO6 A;  1M4V A;  2KMA A;  4YXD B;  4DXA B;  4WAF A;  1I4P A;  3TEW A;  3B0A A;  5JHA A;  2GOW A;  3RZW C;  2J0K A;  3V60 A;  3RT3 B;  3IBE A;  4HK2 A;  1UGJ A;  3A9K A;  4OW0 A;  2BQQ A;  3OG5 A;  1LO5 D;  1WM3 A;  2IGD A;  2WDQ B;  2W54 A;  4HPM B;  3EA6 A;  4TSS A;  3B9J A;  2IO3 B;  2KTF A;  2LGD A;  2C7M B;  4IWO A;  1FCL A;  1E8W A;  4NZL B;  2UYZ B;  3V6E B;  1IUE A;  3ZUN A;  3KH0 A;  1XLP A;  5I4D A;  2XK5 B;  2K6Q A;  4EEW A;  2OJR A;  1JW9 D;  5H8Y E;  3AU4 A;  2LI5 A;  1L0X B;  5D6J B;  2JRH A;  1E6E B;  4LJP B;  4DXF A;  4C56 C;  2DZM A;  2NMQ A;  2V4I B;  2JT4 B;  4LTU A;  3WAO A;  3KQ4 A;  2PMV A;  3NZ3 A;  2KKC A;  1I42 A;  4AOF A;  3TJP A;  3SFD B;  3IFW B;  2OED A;  1WGR A;  1P98 A;  2O2V A;  4FJV B;  2MJD A;  3VR8 B;  1B9R A;  2KK8 A;  5BYR A;  3IXS A;  3PSE B;  2WP9 B;  2WDR B;  3DVG X;  2RSU A;  1KTK A;  2YLM A;  2WGS A;  3TSS A;  3T9L A;  2AQ2 B;  1ZXH A;  1KLG D;  4K7U A;  1RLF A;  1XD3 B;  2B76 B;  2CHX A;  4MGZ E;  5LNK 1;  4NQL B;  1V1P A;  3RYT A;  4R3D A;  5E6N A;  2LGY A;  5C1Z A;  2V3P A;  2EEL A;  3RPF C;  2N1W A;  1F9J A;  4RMA A;  3SDL C;  3KYD D;  1YJ1 A;  1TT5 B;  4HCP B;  1JWA D;  2EMT A;  3GOE A;  2K8B A;  4FLH A;  2Z0E B;  1YD8 U;  3SU8 X;  2O6V D;  3ZRF A;  3U52 E;  3ZQ4 A;  4FXC A;  3NS8 A;  1H8C A;  3L08 A;  1H4R A;  4M01 A;  3V3X A;  3PZD A;  2LEK A;  1KLU D;  2XK5 A;  3WAP A;  3J9C A;  1I4G A;  3MHS D;  4IC7 B;  1G6J A;  2LGS A;  4P6V F;  4C80 A;  1EUV B;  5G5G A;  4P7I A;  2GBK A;  1WY8 A;  1QLB B;  2N9P C;  1FNW A;  4BVU C;  2BGF A;  2B3A A;  4HRS A;  1IPG A;  4WIP A;  3BVG A;  1TZO A;  1J8C A;  1OGW A;  2L05 A;  2DEN B;  1L5P A;  3OJ4 B;  1KLV A;  3L10 B;  4DWF A;  4JGH B;  3HIZ A;  2KC1 A;  4KKI A;  2L32 A;  2KDI A;  1LGR A;  3MHZ A;  4TQ1 A;  1FM0 D;  3FAH A;  2BYV E;  2BTE A;  3PZ7 A;  3DWG C;  4BOS C;  1YQB A;  1OTR B;  2G45 B;  3W2D A;  1YN3 A;  3NOB A;  2BF8 B;  4KSK C;  3V05 A;  1ACC A;  3QAQ A;  4W9C A;  2FE8 A;  3ZLZ A;  1R4N B;  4ANU A;  2EKE C;  2MRP A;  2OHF A;  4G50 A;  3AI5 A;  3P4S B;  4BKS A;  1MHX A;  3VH4 B;  2IO0 B;  3ZTC A;  3IT6 B;  4WQO B;  2LWP A;  4MH8 A;  4NJ6 A;  5DPS A;  1QOA A;  1WF9 A;  1HQR D;  3BK1 A;  4EOY A;  2MW5 A;  1P9D U;  2BYT A;  4REZ A;  2YEP B;  3PRM B;  3U4E G;  2H89 B;  3QJZ A;  1EWY C;  1EF1 A;  4GMV A;  3DBH I;  1LXD A;  3VFK A;  3VQI A;  3GS2 A;  4GOC A;  1P7F A;  2INP E;  1TJE A;  4MGK E;  3ZYY X;  3VVW B;  4G3X B;  1GB1 A;  2V3S A;  5AUI A;  1XEE A;  1HXY D;  2NPT A;  4FHK A;  3WAM A;  1PGX A;  2M4N A;  2KLG A;  3BII D;  4XZ4 A;  3W1S C;  1WXA A;  3R2I A;  1L0Y B;  1E10 A;  4XDD A;  1GC6 A;  2A4Z A;  3U30 A;  2ZNV B;  1YIW A;  2N9E B;  1L6U A;  2HD5 B;  1HZ6 A;  1MHH E;  3RNB C;  1V49 A;  4ITK A;  4HKZ E;  1S1Q B;  2LVO A;  2CS4 A;  3MJW A;  3ZW3 A;  3RD2 A;  2KVZ A;  2QMT A;  1E9M A;  4FJY A;  3HVZ A;  2NTT A;  2GRI A;  4JE3 B;  3LYY A;  4MEL A;  5BMG A;  1XLN A;  3Q3O C;  2HTM E;  3HM6 X;  3RI7 C;  2L83 A;  2MSE D;  2KAN A;  1YJJ A;  2KWU B;  2BWF A;  1HEZ E;  3Q3N C;  4W9G A;  2LHE A;  2L52 A;  2BKF A;  4EUT A;  3ZGZ A;  1P7E A;  2L00 B;  5KHO A;  1A70 A;  3GB1 A;  4WWN A;  1P3Q U;  2IGH A;  1PQS A;  2KQ7 A;  1YNT E;  1CJE A;  2X8X X;  4DDG D;  5DPR A;  1MVK A;  3KYC D;  1F0Z A;  2RDG A;  3C8Y A;  4HPP A;  2HDE A;  1AWD A;  5EDS A;  1C4A A;  1LFD A;  2ZJD A;  2N9K A;  2IGG A;  3GZN I;  3NHE B;  3Q6B A;  3H7P B;  4W9F A;  1N5W A;  4I6L B;  3LXF A;  2KNB A;  4IG7 B;  3UIP B;  1C76 A;  1OFF A;  2HTH A;  1UWM A;  2K5P A;  3PRZ A;  2KQ4 X;  4D2K A;  4MJS A;  3GE3 C;  1V97 A;  4NQK E;  1GB4 A;  4XE0 A;  1KRH A;  1TS5 A;  1K8R B;  3QA8 A;  2W82 A;  3QWZ B;  3PRP B;  1J7B A;  2CJO A;  2L3Z A;  1QZE A;  1WIA A;  3FC4 A;  4HJG E;  3UGB B;  3PT2 B;  4LK0 M;  3DHG C;  4IM2 A;  4LJO B;  3H7S A;  2N1V A;  1BXT A;  5D3I B;  3CST A;  1WZ0 A;  3DBL B;  4HEA 1;  2KDM A;  2AEH A;  1VZ6 A;  1T0Q C;  2E3T A;  3R8B A;  5AEK B;  1SJE D;  3AV8 A;  3NVY A;  4G0N B;  3EHV A;  2WXR A;  2Q5W D;  2FAZ A;  4W9L A;  4YTM B;  3JSV A;  5BO4 B;  4US9 A;  1E5W A;  1FXI A;  1E8Z A;  1A5R A;  3BYT B;  1MPE A;  4WJQ A;  4B95 A;  3IHP C;  2J0M A;  3PPA A;  1ZKH A;  5D94 A;  3ZO5 B;  4IDI A;  4B0E A;  2L8J A;  3A9J B;  3AEA B;  5D2M B;  4CQN A;  2HE7 A;  2WXO A;  1WMH A;  4QAY A;  4YSZ B;  1L4Z B;  2JU6 X;  4DHJ D;  2PEA A;  1XO3 A;  4AWJ A;  2CR5 A;  4BKS D;  2MBE A;  3HM3 A;  3ENE A;  1ZUD 2;  2ACZ B;  1F2R I;  2O6V B;  1NYQ A;  3HRD D;  5CHV C;  4A3O A;  2W3R A;  4M8M A;  1KJT A;  3JSV B;  3AE6 B;  4JQW C;  4C4V A;  4ZYS A;  3ZVV A;  1KH0 A;  3OAW A;  2FNJ B;  2XN9 C;  5IOI A;  3A4S C;  2MJ3 A;  2WQY B;  4JWS C;  4TKN A;  3ONS A;  2LUE A;  4P1C C;  3TEY A;  2N7J A;  4DHZ B;  2N7D A;  2RR9 A;  4J6I A;  5JXV A;  3KUZ A;  4TUU A;  2KDE B;  4XWT A;  3T8M A;  2D3C A;  5L83 A;  1TY2 A;  3O65 B;  1WWT A;  1L4D B;  1SEB D;  4BBN F;  4IUM B;  2MP2 B;  1E7V A;  2WYQ A;  2AX5 A;  1AW7 A;  4M0W A;  2JWZ A;  1DOX A;  1GAQ B;  4IOI E;  4MGY E;  4MJS B;  3TEX A;  5IO9 A;  4FA6 A;  3VRB B;  1WGK A;  3URY A;  1XCQ L;  2PE9 A;  2BW2 A;  3AE8 B;  3TIX A;  5JHB A;  2BS4 B;  1ZP0 B;  3I57 A;  3JVZ X;  4DDI D;  3ML8 A;  2CHW A;  1UBI A;  3AEF B;  4FBJ B;  3H7P A;  1ZPS A;  3V6C B;  2C7H A;  3ZNH B;  1Q0W B;  2KYW A;  2JYE A;  2JZP A;  3AEE B;  1WZ3 A;  4RNA A;  4MEM A;  4UDU C;  3EFC A;  1X1M A;  4K81 A;  4YSY B;  5C23 A;  5G2N A;  4WWM A;  4A9A A;  4JL9 A;  4GIV A;  4F7Z A;  1I4R A;  4GU2 A;  3AEB B;  2ZZP B;  2NPT B;  3ETR A;  5GMV A;  2LXA A;  3L0W B;  4LNO A;  4O1N A;  4HDO A;  3AM9 A;  2UWQ A;  3VUW A;  5BYS A;  1WMH B;  4A55 A;  3A1Q B;  3O13 A;  1WYW B;  5IP4 D;  1Y56 A;  2KFK B;  2V1Y A;  4DK5 A;  4PS7 A;  1CMX B;  2PJH A;  3DDC B;  4KDI C;  1XF5 L;  2NCN A;  4HLE A;  1YQ4 B;  1T6B X;  2PE6 B;  3BK2 A;  2SAK A;  3DBH B;  4RM8 A;  2G1E A;  4ZRI A;  3OLM D;  2N9L A;  2KMC A;  2BYF A;  1VCB A;  1N6Z A;  1J19 A;  3N1Z C;  3N30 A;  4LLG M;  4RFB A;  2L0F A;  1JWS D;  1XXG A;  1YX5 B;  3U7Z A;  2RPQ A;  4YWG G;  2OJW A;  3SFE B;  1SE3 A;  4MGI E;  4W9E A;  4YT0 B;  3HK0 A;  2RD0 A;  5JH5 C;  3B2G A;  2QIL A;  1RFA A;  1RRB A;  3IAS 1;  3W9C B;  1D4B A;  2NBW B;  2JWU A;  5HI1 A;  1MI0 A;  3N1Y C;  4XYC A;  1Z2M A;  5HKH A;  1WR1 A;  1XCT L;  2D3G A;  4MH0 E;  3P2B A;  5T8I A;  2LD9 A;  3KLS X;  2JF5 A;  1WJN A;  1UD7 A;  2C5L C;  2JZ3 B;  4Q2J A;  4OZB A;  1F2R C;  1FPY A;  1TY0 A;  2LUM A;  2K8H A;  5IAA C;  3APD A;  1WX8 A;  4XC2 A;  4ARI A;  2MWS B;  4BFR A;  1FFU A;  4J3O D;  2RDH A;  4H2A A;  1ZDV A;  3RUL A;  2JXT A;  3TMP B;  2WXP A;  2W3S A;  4ZDV A;  3APC A;  1UUP A;  1D6E C;  4S17 A;  1E7U A;  4MSQ B;  1HE8 A;  2IBI B;  4HDQ A;  2WS3 B;  3Q8F A;  1N62 A;  2AWT A;  2CU3 A;  2KWD A;  3DHH C;  2VZK D;  3BIN A;  1GUA B;  4F8C B;  4GGQ A;  4IW0 A;  4ZOH C;  3IAM 1;  2M19 A;  3DBR I;  1L0V B;  3VDZ A;  3H9D A;  3L13 A;  1WJ4 A;  1WI0 A;  4ZYN A;  1DOY A;  2HJ1 A;  4AP4 C;  1WE7 A;  3E56 A;  1WJU A;  2KVR A;  3RUI B;  1TS4 A;  4IKG A;  5DPW A;  2X38 A;  2J42 A;  5HFY A;  2LGX A;  3SHQ A;  1MFW A;  2ZEQ A;  4AJY B;  2Z0D B;  3VHT C;  2WXL A;  1T3Q A;  3X0W A;  3DVN U;  1F1H A;  4LNK A;  1QOF A;  5CHW A;  3UF8 A;  4N6E B;  1YN5 A;  3UQA A;  2DZK A;  3EFU A;  2PTL A;  4NPN A;  1V5O A;  1UNS A;  3GP7 A;  1E8Y A;  1HA5 A;  4WJO A;  2I2Y A;  4DHJ B;  1V1O A;  1QKZ A;  3QC8 B;  2FIF A;  1KM7 A;  1Q1O A;  4NJ7 A;  3PHW B;  3RNF C;  3NUH B;  5FR6 A;  3WAN A;  4BKG A;  2R2Q A;  1FMA D;  3RCZ A;  3BWU D;  1OEY J;  1R4M B;  2KMM A;  3VRA B;  1TZ1 A;  5CX3 A;  2PIA A;  4OZA A;  3Q3F A;  4KZ0 A;  5JZE B;  2G4D B;  5LLI A;  2J52 A;  3PLU A;  3ZXR A;  3P1M A;  4GDK B;  5BYQ A;  3ALB A;  4JWU C;  2FUG 1;  5HHD G;  5LXH A;  4DQO C;  4A3P A;  1SGH A;  3EGR A;  2NS5 A;  2LAS A;  3WIM A;  2BB6 A;  1OQQ A;  1JWM D;  1FFV A;  4OHJ A;  5GXG B;  3AE3 B;  2LVP A;  3B1L X;  3PO0 A;  2AYO B;  4TV3 A;  4ZHO A;  1SE4 A;  1UZX B;  3UIO B;  1E0Z A;  4P1B C;  5TR5 A;  3VH3 B;  2Y5P A;  3AE9 B;  2JQR B;  3RFZ B;  3R2T A;  1ZXI A;  2JRI B;  2L76 A;  2MH7 A;  1VJK A;  1L2N A;  3Q2A C;  1CQV A;  4RH6 A;  4CYE A;  4KZC A;  1I35 A;  3AE1 B;  4MM3 B;  1B1Z A;  4RM9 A;  1EF5 A;  1I4Q A;  1FXA A;  4RF0 A;  1C3T A;  4OVU A;  2BYE A;  1PGB A;  2LXC A;  4LCD E;  3ZNG C;  3NS1 A;  1WXM A;  1UH6 A;  1C4C A;  1C78 A;  1JWB D;  1UGM A;  4KGR A;  1IBX B;  3ML9 A;  2NBU A;  3AXC A;  2KLC A;  3Q3J A;  2K9X A;  1QT9 A;  3KWV A;  2JYT A;  3RNG C;  1VRA B;  2GBJ A;  4W9D A;  2LMC A;  2LVQ A;  4URK A;  2AQ1 B;  2N9X A;  1JAL A;  4G11 A;  4PYZ A;  3W1Y A;  3BZD B;  2M56 B;  3RMK C;  4HJK A;  4ACF A;  2DLB A;  2J0J A;  4RF1 A;  1RFK A;  4S0R A;  3AE2 B;  2BS2 B;  2A5U A;  3AU5 A;  1TBE A;  2WDT B;  3PRE A;  3ECI A;  3OWE B;  2MCN B;  4IM3 A;  1YX6 B;  3DOW A;  5FKA C;  2KO3 A;  4WAA A;  4MDK E;  3S2A A;  1K52 A;  4MT5 A;  4FN2 A;  3NY5 A;  3IVF A;  2DYO A;  2WX0 A;  3LB8 C;  1TIF A;  3L17 A;  1L7Y A;  4EZJ A;  2KFJ A;  1FEH A;  5DPT A;  4XX5 A;  4GSW A;  3R3M A;  5EE3 A;  2KTR A;  1CK1 A;  2WWZ A;  4W9I A;  1XLO A;  3PTF C;  1TTN A;  4BKT A;  3ZNZ B;  2KFK A;  1TKE A;  2K39 A;  4BZA A;  1V81 A;  2JXX A;  2WU5 B;  4EE2 A;  4PT5 A;  1SE9 A;  2GMI C;  4KVG B;  2DX5 B;  3PZ8 A;  2GLS A;  2K0P A;  4C00 A;  2ZPY A;  4NY0 A;  3A9J A;  1WM2 A;  1SF0 A;  4NAW A;  4RGM A;  2NTS A;  4C7Z A;  4OZC A;  1DYQ A;  2BWE S;  2IY1 B;  1VD2 A;  3CMM B;  3RZF A;  1FIQ A;  1N60 A;  2INN E;  3N20 C;  1WXS A;  1TKG A;  4BAX A;  4IM0 A;  3H8H A;  2N0S B;  2WXM A;  3P4R B;  2BS3 B;  3UQB A;  1YJI A;  4TMA B;  3B2F A;  1UF0 A;  4ZRK A;  2BB5 A;  1K53 A;  3EEC A;  1XT9 B;  2QSD A;  1IP9 A;  4ICU A;  2JVC A;  1WSP A;  3VUY A;  3P42 A;  2IY0 B;  1IGC A;  1JCK B;  3IT4 B;  2QDF A;  1MG4 A;  3Q14 C;  3FIL A;  5HG2 A;  1ET9 A;  2MLB A;  1EU3 A;  1SBB B;  2VZK B;  4WQM A;  4HKQ A;  2WLB A;  1WGH A;  2AL3 A;  1SE2 A;  1C9F A;  2KTR B;  3NG0 A;  1TKY A;  2PLP A;  2QHO A;  1P0R A;  1JML A;  3VUX A;  4EFO A;  1LQB A;  4BOZ B;  2FCQ A;  1C77 A;  5FK9 C;  2DBY A;  1WXV A;  2WNM A;  4A90 A;  4KKJ A;  1SXT A;  2KN5 A;  2ZNV C;  4K3C A;  5EE1 A;  1D5M C;  4FUL A;  2K22 A;  1WGD A;  1I7H A;  1KF6 B;  2RMM A;  2KAJ A;  3T3N A;  3K9O B;  4C7Y A;  3DHI C;  1ISN A;  4ZRQ A;  2M0X A;  2D3B A;  3Q8E A;  2PVG C;  1WE6 A;  3ZDT A;  2AL6 A;  4B0M A;  1GC7 A;  2HJ8 A;  3AED B;  3L4P A;  4DHZ E;  4KSL C;  3CWI A;  1Y8R C;  1SIJ A;  3ABV B;  4HCN B;  4ASW C;  1J7A A;  2XEW A;  4A6Q A;  2MEK A;  3LDZ E;  2QCZ A;  2MP2 A;  2FCN A;  2JY6 A;  3N9Y C;  2JSV X;  3L54 A;  2RPV A;  2W9N A;  4M0W B;  1F77 A;  2LHD A;  2CHZ A;  2MQJ A;  4X57 B;  4GDL B;  5C2T B;  4AJW A;  3QQ8 B;  5D3D A;  2K1F A;  3V62 A;  4I6N B;  2BVC A;  4WWO A;  2WXI A;  4A20 A;  1I4H A;  1WGG A;  3OJ3 A;  3VTW A;  4M8N A;  1JWU D;  3K9P B;  2WXH A;  3ZNI D;  2MBQ A;  1D3Z A;  1DOI A;  2W55 A;  4E71 A;  2FCS A;  4HXD A;  1OEY A;  2WXN A;  3NJT A;  4JPS A;  2GBM A;  4FAD A;  1NVI D;  3DBR B;  1PDX A;  1V2Y A;  3DPD A;  4GDK A;  4L2Y A;  5AZF A;  5AZG A;  4NAM A;  3QCA A;  3ZKJ C;  1WRI A;  4KIK A;  4KGS A;  2GI9 A;  2DNF A;  5TSS A;  2IJ0 A;  1N61 A;  1WYG A;  3PHX B;  2KJ6 A;  2DYM A;  2FBW B;  4RGT A;  1FNU A;  3B08 A;  5IN7 A;  2KWC A;  3E9S A;  2D5G A;  1STE A;  3VR9 B;  1GG3 A;  1EM7 A;  4YL8 A;  4RGN A;  2K3U A;  4HPL B;  1WJ6 A;  2LRU A;  5AZH A;  3R7Q A;  3QAR A;  5BMH A;  1BML C;  1ENF A;  1WH3 A;  1QF6 A;  4LDT B;  3D32 A;  4RCO A;  2J7Q B;  1V8C A;  4E74 A;  1P1A A;  5E6P A;  4N58 A;  1S3S G;  1L6V A;  3H1U A;  3SD5 A;  5EE0 A;  4MM3 A;  2YVC A;  5E6O A;  3VXW A;  1T0Y A;  3P63 A;  2BT6 A;  1K51 A;  3MC9 A;  1J7C A;  3NVV A;  3SEB A;  1MG8 A;  2N4F A;  4CO7 A;  2KJH B;  2WXQ A;  2D10 A;  2D11 A;  2FID A;  3BVM A;  3MTN B;  5G55 A;  5C3J B;  2Y5C A;  2IND C;  2I38 A;  3DBL I;  4K7W A;  1TS3 A;  3AN1 A;  4CHK A;  1SB3 C;  1AYF A;  1WXQ A;  2PKO A;  3RNC C;  1NI2 A;  5FR3 A;  1NEN B;  4KIK B;  2K25 A;  4YTN B;  3C0R B;  1AN8 A;  4ANV A;  2IO1 B;  2GBR A;  3TCA A;  2KC2 A;  5DCN A;  4GB9 A;  4XWW A;  1C4P A;  2K8C A;  3U8Z A;  5D7G A;  1R4N I;  3UI3 A;  2EMS A;  4I6P A;  1J0G A;  3UIN B;  3TL5 A;  3CSF A;  3PLV A;  5J2R A;  1YQ3 B;  1QQR A;  4PS3 A;  1VZ8 A;  2G3Q B;  2I1K A;  1NBF C;  1V1P B;  1WFY A;  1TYG B;  3JW0 X;  1AAR A;  3U7D A;  2INC C;  1TS2 A;  3MP9 A;  1GNU A;  4GDL A;  4KGT A;  2ASQ A;  1ZOY B;  4OVV A;  2G9H D;  5E6J A;  4ANW A;  1GOZ A;  2CKH B;  1NDD A;  1DGJ A;  2H88 B;  2C60 A;  3HUI A;  1VZ7 A;  4W9J A;  4K1R B;  2Z59 B;  4KV2 A;  1R7S A;  4ANX A;  1JRO A;  3EC8 A;  2JUO A;  4NNJ B;  4WJN A;  3TEZ A;  1LM8 B;  1V9J A;  3DVG Y;  4K3B A;  3GE8 C;  3X23 A;  2KN4 A;  2KX0 A;  1HTO A;  1T5X D;  1OQY A;  2DHZ A;  1ROE A;  3W5U B;  1UBQ A;  3Q3M C;  4JX1 C;  2KZR A;  1FRR A;  2QC8 A;  5CTR C;  3CF6 E;  2O6V A;  3MFG A;  3MC8 A;  2C9W B;  1C79 A;  2ZVN A;  3CIR B;  5CHF A;  4WH4 A; 
#chains in the Genus database with same CATH homology
 3S2A A;  4LJP B;  2DZM A;  3KVF B;  4HWI B;  4FN2 A;  3NY5 A;  3IVF A;  4FA6 A;  2DYO A;  2WX0 A;  2JT4 B;  4EZK A;  3WAO A;  2PE9 A;  3L17 A;  1L7Y A;  3DVN V;  3TIX A;  4EZJ A;  2KFJ A;  5JHB A;  5DPT A;  2KKC A;  4XX5 A;  1I42 A;  4GSW A;  3JVZ X;  3R3M A;  3WA0 A;  4AOF A;  3TJP A;  3IFW B;  4DDI D;  1WGR A;  1P98 A;  2O2V A;  2KTR A;  4FJV B;  3ML8 A;  2CHW A;  3PVL A;  1UBI A;  2WWZ A;  4FBJ B;  2KK8 A;  2NVU I;  3H7P A;  4W9I A;  3V6C B;  3PTF C;  2C7H A;  3ZNH B;  1TTN A;  3PSE B;  1Q0W B;  2CU1 A;  4II3 B;  4BKT A;  3DVG X;  3ZNZ B;  2RSU A;  2KFK A;  2YLM A;  2K39 A;  1V81 A;  2JXX A;  3T9L A;  1SE9 A;  4PYU A;  3NZS A;  2GMI C;  4K7U A;  1WZ3 A;  4KVG B;  1RLF A;  1XD3 B;  2CHX A;  2R2O A;  4MGZ E;  2DX5 B;  2WX1 A;  4MEM A;  2ZPY A;  4NQL B;  4NY0 A;  3A9J A;  1WM2 A;  3RYT A;  4TQ0 A;  5E6N A;  2LGY A;  4NAW A;  5C1Z A;  1X1M A;  4K81 A;  2BWE S;  2IY1 B;  4B6W A;  5C23 A;  5G2N A;  1VD2 A;  2JZZ A;  3CMM B;  3RZF A;  2FUH B;  2N1W A;  1WXS A;  4JL9 A;  1F9J A;  4GIV A;  4HVB A;  4RMA A;  4F7Z A;  3SDL C;  3KYD D;  4IM0 A;  1YJ1 A;  4HCP B;  2KJR A;  2EMT A;  3GOE A;  2K8B A;  4FLH A;  3A1Q A;  2Z0E B;  4GU2 A;  1YD8 U;  3SU8 X;  2O6V D;  3UQB A;  3ZRF A;  2ZZP B;  2NPT B;  5GMV A;  2M17 A;  4ZRK A;  2LXA A;  3NS8 A;  1ZGU B;  3L0W B;  4FJZ A;  1H8C A;  3EEC A;  2KDB A;  3L08 A;  3N32 A;  1H4R A;  4HDO A;  1XT9 B;  2L7R A;  2UWQ A;  2MBH A;  3PZD A;  3VUW A;  1WMH B;  3A1Q B;  3ZDM C;  2XK5 A;  3WAP A;  1IP9 A;  4ICU A;  1WYW B;  2JVC A;  2LRW A;  2KFK B;  2V1Y A;  3VUY A;  4DK5 A;  4PS7 A;  2IY0 B;  3MHS D;  4EKU A;  4IC7 B;  1CMX B;  2PJH A;  1G6J A;  3DDC B;  4KDI C;  4HLE A;  2NCN A;  1EUV B;  4P7I A;  2GBK A;  1WY8 A;  2N9P C;  2PE6 B;  2D2Q A;  4RM8 A;  4BVU C;  2MLB A;  2BGF A;  2KWV B;  3LJ3 A;  2B3A A;  4ZRI A;  1IPG A;  3OLM D;  1J8C A;  1OGW A;  2L05 A;  2KMC A;  2BYF A;  1VCB A;  2DEN B;  1WGH A;  1J19 A;  2AL3 A;  3OJ4 B;  5J18 A;  1KLV A;  3L10 B;  3N30 A;  2KTR B;  4K7S A;  3VFK A;  4DWF A;  4JGH B;  2L0F A;  3HIZ A;  2KC1 A;  3L16 A;  2QHO A;  1P0R A;  3VUX A;  4EFO A;  5J17 A;  1LQB A;  1WR6 E;  2KDI A;  4BOZ B;  2FCQ A;  1YX5 B;  2RPQ A;  4TQ1 A;  2OOB B;  3A4R A;  3I3T B;  2DAJ A;  3VQI A;  1WXV A;  2BYV E;  5D6J B;  4BOS C;  4MGI E;  2ZNV C;  2KN5 A;  2MX2 A;  4W9E A;  3HK0 A;  1YQB A;  2RD0 A;  1OTR B;  2G45 B;  1KOT A;  3NOB A;  4FUL A;  5JH5 C;  2BF8 B;  4KSK C;  4E3C A;  1WGD A;  4WWP A;  3QAQ A;  3M3J A;  4W9C A;  4IWP A;  1RFA A;  3ZLZ A;  2KX3 A;  1RRB A;  4ANU A;  1V80 A;  2EKE C;  2MRP A;  2NBW B;  4G50 A;  3AI5 A;  4BKS A;  1V86 A;  3VH4 B;  3DQV A;  3K9O B;  1WGY A;  2IO0 B;  3ZTC A;  4ICV A;  4LDT D;  3DCG A;  4WQO B;  1ISN A;  2LWP A;  4NJ6 A;  5DPS A;  1Z2M A;  1WF9 A;  2ZCB A;  5HKH A;  2M0X A;  1WR1 A;  4EOY A;  2MW5 A;  2D3G A;  1P9D U;  3QK0 A;  4MH0 E;  1GJZ A;  4KDL B;  4BBN C;  1WE6 A;  3A33 B;  2AL6 A;  3PRM B;  3ZDT A;  3P2B A;  4EZL A;  1GC7 A;  2HJ8 A;  4N9F 4;  3QJZ A;  4DHZ E;  4KSL C;  1RAX A;  2LD9 A;  1EF1 A;  1UEL A;  2JF5 A;  1LXD A;  1WJN A;  3DBH I;  4GMV A;  1UD7 A;  1Y8R C;  2C5L C;  2JZ3 B;  4NAW B;  4GOC A;  4HCN B;  4ASW C;  2XEW A;  2KQS A;  2K8H A;  4MGK E;  2M1M A;  3LDZ E;  5IAA C;  3JYU A;  3APD A;  2KD0 A;  4PS8 A;  1WX8 A;  4G3X B;  3VVW B;  2MP2 A;  2FCN A;  2LZ6 A;  1WX7 A;  2JY6 A;  4XC2 A;  4W9H A;  3WAL A;  3L54 A;  2V3S A;  2W9N A;  2MWS B;  2NPT A;  2XBB C;  4FHK A;  4M0W B;  2CHZ A;  2MQJ A;  4BFR A;  4ZRJ A;  4X57 B;  3WAM A;  3VAW A;  2M4N A;  2KLG A;  4GDL B;  3RUL A;  3TMP B;  4XZ4 A;  1TGZ B;  2D07 B;  3W1S C;  1WXA A;  4ZDV A;  1M94 A;  2IYD B;  3APC A;  1GC6 A;  1E7U A;  2ZVO A;  4AJW A;  4MSQ B;  2A4Z A;  1HE8 A;  3QQ8 B;  3AUL A;  4II2 B;  3U30 A;  1JRU A;  2K1F A;  4IWQ A;  2ZNV B;  3V62 A;  2IBI B;  1YIW A;  2N9E B;  4HDQ A;  4I6N B;  2HD5 B;  1XQQ A;  3R7R A;  4WWO A;  1V49 A;  3ZRC A;  2IZV B;  2AWT A;  4A20 A;  1S1Q B;  1WGG A;  2LVO A;  3OJ3 A;  4M8N A;  2L0T A;  2DZJ A;  2CS4 A;  2FCM A;  3K9P B;  3MJW A;  3VTW A;  3ZW3 A;  2PPH A;  3RD2 A;  3ZNI D;  1D3Z A;  2MBQ A;  1BT0 A;  4FJY A;  3BIN A;  4E71 A;  2FCS A;  1GUA B;  4HXD A;  4MEL A;  4F8C B;  1OEY A;  2GBM A;  4GGQ A;  4IW0 A;  4FAD A;  1V2Y A;  1R4M I;  3DBR I;  3HM6 X;  3DPD A;  4GDK A;  3M62 B;  3VDZ A;  2I1J A;  2MSE D;  5AZG A;  5AZF A;  2KAN A;  3VTV A;  2KWU B;  3H9D A;  2BWF A;  3QCA A;  3L13 A;  3ZKJ C;  1WJ4 A;  3V61 A;  4KIK A;  4W9G A;  1WI0 A;  4ZYN A;  2BKF A;  1ZW7 A;  2KXJ A;  3PS6 A;  4EUT A;  4AP4 C;  1WE7 A;  1WJU A;  3PHX B;  2L00 B;  3KUD B;  4JLC A;  3W1S A;  2KJ6 A;  2DYM A;  2KVR A;  5KHO A;  3RUI B;  5DPW A;  2M8S A;  2KDF B;  1E90 A;  3QHT A;  3B08 A;  2BPS A;  1U4A A;  2KOX A;  3PV1 A;  4WWN A;  1P3Q U;  2KWC A;  1PQS A;  2DZI A;  2KQ7 A;  2LGX A;  3SHQ A;  4DDG D;  5DPR A;  1GG3 A;  3VTU A;  2ZEQ A;  4YL8 A;  4AJY B;  2Z0D B;  3PGE A;  3VHT C;  4HPL B;  2ZPN A;  2MBB B;  3IG3 A;  3KYC D;  1WJ6 A;  2LRU A;  3DVN U;  5AZH A;  3R7Q A;  3KW5 B;  5CHW A;  3UF8 A;  3X0W A;  3QAR A;  3UQA A;  2DZK A;  3EFU A;  1E8X A;  2NR2 A;  4NPN A;  1V5O A;  2ZCC A;  1WH3 A;  5EDS A;  2N7E A;  4LDT B;  5KHQ A;  2KHW B;  4B9K A;  1LFD A;  3D32 A;  1E8Y A;  2MBO A;  2ZJD A;  4WJO A;  2J7Q B;  4E74 A;  3NZU A;  3QX1 A;  1P1A A;  4F1S A;  1V6E A;  5E6P A;  3GZN I;  3KUC B;  1WX9 A;  3NHE B;  4DHJ B;  1S3S G;  3H1U A;  3H7P B;  3SD5 A;  3QC8 B;  1C1Y B;  4MSM B;  2FIF A;  4MM3 A;  2YVC A;  1KM7 A;  4W9F A;  5E6O A;  1SIF A;  4I6L B;  1Q1O A;  2KNB A;  1T0Y A;  4IG7 B;  4NJ7 A;  3PHW B;  3UIP B;  3VXW A;  2HTH A;  5FR6 A;  5LXI B;  3WAN A;  2NBV B;  3PRZ A;  4BKG A;  2R2Q A;  4MJS A;  3RCZ A;  1OEY J;  4NQK E;  2DAF A;  4GN1 A;  1TZ1 A;  1Z5S B;  1MG8 A;  2N4F A;  4CO7 A;  1K8R B;  3QA8 A;  2KJH B;  3QWZ B;  5CX3 A;  3PRP B;  2REX A;  3Q3F A;  4KZ0 A;  2L3Z A;  1QZE A;  1WIA A;  2VRR B;  2Y5B B;  3UGB B;  2D10 A;  3BY4 B;  4GXB A;  5JZE B;  2G4D B;  2D11 A;  3PT2 B;  4FHJ A;  2FID A;  1FXT B;  5LLI A;  3MTN B;  4IM2 A;  3HHM A;  3H7S A;  3PLU A;  4GDK B;  4LJO B;  5G55 A;  3TBL D;  2N1V A;  2BKR B;  3ALB A;  3DBL I;  3CST A;  4K7W A;  5LXH A;  4CHK A;  1WZ0 A;  4A3P A;  2IO2 B;  2AEH A;  1NI2 A;  1SGH A;  4KIK B;  2K25 A;  2NS5 A;  2LAS A;  3C0R B;  3WIM A;  5AEK B;  3R66 C;  4G0N B;  4ANV A;  3EHV A;  2V4L A;  2IO1 B;  2GBR A;  3TCA A;  2KC2 A;  5DCN A;  4GB9 A;  2RGF A;  4JIO U;  1Q5W B;  2FAZ A;  2LVP A;  3APF A;  3B1L X;  4W9L A;  2C7N B;  2K8C A;  4WJP A;  3U8Z A;  5D7G A;  4AUQ C;  1R4N I;  3JSV A;  5BO4 B;  1E5W A;  2AYO B;  2EMS A;  4I6P A;  2O2V B;  3DBS A;  4TV3 A;  1E8Z A;  1IYF A;  1UZX B;  1A5R A;  2LJ5 A;  3UIO B;  1J0G A;  5TR5 A;  3VH3 B;  4WJQ A;  3M63 B;  4B95 A;  3N3K B;  3M95 A;  3UIN B;  3TL5 A;  3CSF A;  3PLV A;  2MA9 B;  2JRI B;  2L76 A;  3A9K B;  3IHP C;  3QIJ A;  4W9K A;  3ZIM A;  5J2R A;  2J0M A;  3PPA A;  4PS3 A;  1ZKH A;  1L2N A;  5D94 A;  3ZO5 B;  2G3Q B;  2I1K A;  1NBF C;  2L8J A;  3A9J B;  1WFY A;  3JW0 X;  4CYE A;  5D2M B;  2DYB A;  3H6N A;  2HE7 A;  5IA7 A;  1WMH A;  4KZC A;  1AAR A;  1I35 A;  3ZTD A;  4DHJ D;  4RM9 A;  3U7D A;  1EF5 A;  2PEA A;  4AWJ A;  1C3T A;  1GNU A;  2CR5 A;  4OVU A;  2BYE A;  4GDL A;  4BKS D;  2LXC A;  2MBE A;  3HM3 A;  4LCD E;  3ENE A;  3ZNG C;  4DBG A;  1V5T A;  1WXM A;  1WRD B;  2ASQ A;  1UH6 A;  2G4S A;  2O6V B;  4ANW A;  4OVV A;  5CHV C;  2CKH B;  1NDD A;  5L95 C;  2K6D B;  2JPH A;  2GBN A;  2C60 A;  1EO6 A;  4A3O A;  2KMA A;  1UGM A;  4DXA B;  4M8M A;  1KJT A;  3JSV B;  4JQW C;  3B0A A;  5JHA A;  3ML9 A;  4W9J A;  2NBU A;  3ZVV A;  2GOW A;  4K1R B;  3AXC A;  3RZW C;  2Z59 B;  4KV2 A;  2KLC A;  3Q3J A;  2J0K A;  4ANX A;  3V60 A;  3RT3 B;  2GBJ A;  3EC8 A;  2FNJ B;  3OAW A;  4W9D A;  2JUO A;  3IBE A;  4HK2 A;  4NNJ B;  3A9K A;  4WJN A;  2LVQ A;  3A4S C;  1LM8 B;  4TKN A;  1WM3 A;  4URK A;  3ONS A;  1V9J A;  3DVG Y;  2N9X A;  2LUE A;  4G11 A;  3X23 A;  2KX0 A;  4HPM B;  4PYZ A;  2IO3 B;  1OQY A;  3W1Y A;  2LGD A;  2KTF A;  4DHZ B;  2N7D A;  2C7M B;  4HJK A;  2DHZ A;  2RR9 A;  4IWO A;  4J6I A;  3KUZ A;  1E8W A;  4TUU A;  2KDE B;  1UBQ A;  2J0J A;  3T8M A;  2KZR A;  5L83 A;  2UYZ B;  3O65 B;  2A5U A;  3V6E B;  3ZUN A;  3AU5 A;  3KH0 A;  5CTR C;  3CF6 E;  4IUM B;  4BBN F;  2MP2 B;  2O6V A;  1TBE A;  2XK5 B;  2K6Q A;  2WDT B;  3PRE A;  4EEW A;  2OJR A;  3ECI A;  1E7V A;  2C9W B;  2WYQ A;  2MCN B;  4IM3 A;  1YX6 B;  2ZVN A;  3DOW A;  5CHF A;  2JWZ A;  3AU4 A;  2KO3 A;  4WAA A;  2LI5 A;  4MGY E;  4MJS B;  2JRH A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...