2MX2A

Ubx-l domain of vcip135
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
81
structure length
81
Chain Sequence
b'KEKKIRITTNDGRQSMVTLKSSTTFFELQESIAREFNIPPYLQCIRYGFPPKELMPPQAGMEKEPVPLQHGDRITIEILKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deubiquitinating protein VCIP135
publication title Structure and interaction mode of the UBX-L domain of VCIP135 determined by solution NMR spectroscopy
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 81
sequence length 81
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mx2A00
2HTHA 1GC6A 1XT9B 2ASQA 3DOWA 4NAWB 1H8CA 4G3XB 2KMAA 1RFAA 3Q3FA 2JWZA 3K9OB 2N7EA 3JYUA 4HJKA 3U8ZA 1WMHB 3N30A 3ZNHB 2B3AA 4KSKC 4W9CA 2LRUA 1WGRA 3H1UA 1WE6A 3EC8A 3PS6A 3HIZA 3ECIA 3QHTA 2L0FA 2I1KA 4GIVA 3DBHI 1P1AA 4B9KA 3QX1A 3NZSA 1GUAB 3VQIA 3C0RB 3VUYA 4CO7A 1GNUA 1T0YA 2KFKB 1JRUA 4MH0E 1GC7A 2DZKA 4IM0A 2JY6A 4JIOU 5CX3A 1EUVB 1TBEA 2EMSA 1WH3A 4NAWA 4IWPA 4PYZA 3ML8A 3X0WA 3ZW3A 4E74A 4MSMB 3DBSA 2LXCA 4KV2A 1I42A 1V5TA 3PRMB 4ANVA 4AJWA 3WAOA 1YD8U 2KVRA 2ZJDA 3NS8A 1LM8B 1OGWA 4GDLB 3RCZA 4X57B 2C5LC 5JH5C 3B1LX 2CHWA 2DAJA 2LASA 2MA9B 4WJQA 2DZIA 3ZKJC 2DYOA 2MBHA 3PLUA 4KZ0A 4LDTD 5CHWA 2IY0B 4EFOA 3JSVA 4HCPB 4DHZB 3O65B 2KQSA 4B95A 2D3GA 2L8JA 2MW5A 2KFKA 4FADA 4W9KA 5E6OA 5KHOA 3KW5B 2REXA 1WX7A 2R2OA 5HKHA 1V81A 2O6VA 4DWFA 3ZLZA 3U7DA 1SIFA 5CHVC 2KC2A 3JVZX 2MQJA 2ZEQA 1LXDA 4OVUA 1E90A 1I35A 2L00B 2KJHB 2NVUI 2XBBC 4BBNC 2G4SA 2MX2A 4LCDE 2AWTA 4ZRKA 1AARA 2LGDA 4DXAB 4GOCA 4BKTA 1L7YA 2G45B 3NY5A 2UYZB 3CSTA 2N7DA 2YVCA 3PREA 3RD2A 1EO6A 2JRHA 2GBJA 1WZ0A 2MWSB 4ZRJA 4BOSC 2JUOA 3KH0A 4WWPA 2JRIB 2ZZPB 2A4ZA 3KYDD 1WXAA 2K39A 4MSQB 4ANUA 4NNJB 2BWES 5J2RA 3MHSD 2CU1A 2ZCBA 4FHKA 4NJ6A 3PHWB 3L0WB 4G11A 3SU8X 4BKSA 5C23A 2DYMA 4FJVB 4HDOA 1V86A 3HM3A 1WR1A 2KQ7A 2M0XA 2HJ8A 4XX5A 1IYFA 4TV3A 3TJPA 4EOYA 4ICVA 5DPSA 4NJ7A 4NQLB 3K9PB 4FJYA 3WA0A 3A9JA 3DVGY 2IO1B 3A4RA 4BOZB 1KOTA 1L2NA 4BKGA 1ZKHA 1EF1A 2MBBB 2FCQA 3V6EB 3NHEB 3KUZA 3AU5A 1VD2A 2C7HA 4GXBA 3CF6E 2G3QB 4ASWC 4B6WA 2BYEA 4MEMA 1TTNA 3DQVA 1E8WA 3VUXA 1V80A 2MBOA 4AOFA 3ZNID 4DBGA 2KWCA 4OVVA 4MDKE 2FNJB 1YJ1A 3SHQA 4DHJB 1OEYJ 1WI0A 3M95A 4HK2A 2MCNB 1M94A 1E7VA 2EMTA 3Q3JA 4PS8A 4JLCA 1WIAA 1R4NI 4J6IA 5GMVA 3LDZE 5AZGA 5G2NA 4KDIC 2KLCA 2KZRA 4E3CA 1TGZB 5AZFA 2C7NB 4W9GA 3OJ3A 1MG8A 4FN2A 4KSLC 2GBRA 2UWQA 3H7PB 5E6PA 3RYTA 3UQAA 4LJPB 3IHPC 3IVFA 3SDLC 2GBMA 2XK5A 2LD9A 1R4MI 2KWUB 2D11A 1Q1OA 2L76A 4MGYE 3KUDB 4K7SA 4NY0A 2ZVOA 4XC2A 1J19A 4NPNA 2G4DB 2KX0A 3WAMA 1P0RA 3IG3A 2C9WB 3EFUA 2FCNA 3ENEA 2GBNA 2LJ5A 4HWIB 4TQ1A 1G6JA 3ML9A 2NBUA 1S3SG 2RPQA 4PS3A 2N9PC 3CSFA 3VTVA 2KX3A 4DDID 4F8CB 2AYOB 4URKA 1WGHA 3I3TB 2HE7A 2ZVNA 4WAAA 2NBWB 3VH4B 3PGEA 3QQ8B 5JZEB 5D7GA 3QCAA 1WMHA 3ZNZB 2KJ6A 2KJRA 3UINB 2O6VD 4HDQA 3ZIMA 1ZW7A 3VFKA 4W9DA 4ANWA 3ZTCA 4W9FA 3ZRCA 3QC8B 4HPMB 1NI2A 2KOXA 3RZWC 2AEHA 3N3KB 4CHKA 1UH6A 4IC7B 3HK0A 2DENB 4IM2A 2D10A 2FAZA 2MP2B 4WQOB 2LVOA 3UIOB 2HD5B 3APCA 4P7IA 4FBJB 2K8HA 1E8ZA 2AL3A 3IBEA 3R7RA 3V62A 1KJTA 3V61A 1SE9A 3RUIB 1V5OA 3DDCB 1OTRB 2RD0A 4I6NB 4JL9A 2KDBA 3M63B 2L05A 4ZRIA 1E7UA 2QHOA 4LDTB 3BINA 2NCNA 3RULA 4MJSB 4II2B 4GDLA 4KIKB 4F1SA 3KUCB 5JHBA 1KLVA 5E6NA 2LGXA 1WYWB 2K6DB 2LRWA 4GMVA 3R66C 3ALBA 4WWNA 4ZDVA 3PSEB 5C1ZA 3HHMA 1WX8A 2KK8A 2K8CA 4DHZE 3ZO5B 1YX5B 3WAPA 5EDSA 2W9NA 2JPHA 1UGMA 1KM7A 5AEKB 1WZ3A 4JGHB 1GJZA 3UGBB 2BKFA 2IY1B 2J0MA 3PV1A 3OLMD 3P2BA 4EUTA 4M8MA 2M1MA 2WWZA 1XD3B 2PE6B 2IZVB 1WF9A 2MLBA 4IW0A 3VDZA 2BYVE 2LGYA 3A1QB 3ZDMC 2MRPA 4W9LA 2L7RA 2M8SA 3QARA 3AULA 1RAXA 4RM9A 2KC1A 3TCAA 1WX9A 3QK0A 4K7WA 3L16A 4LJOB 3PT2B 2CHXA 4EZKA 2FUHB 3VTUA 1F9JA 1WJNA 4TKNA 3HM6X 2D2QA 3R7QA 4ICUA 2DHZA 4W9HA 2K8BA 3SD5A 2NBVB 2AL6A 3WANA 2BF8B 2MSED 2WX1A 1BT0A 2O2VB 3NOBA 2VRRB 2IO2B 1WGGA 2KTRB 5D2MB 2L3ZA 4MELA 3UF8A 3EHVA 4GB9A 3TIXA 2KTFA 2V3SA 4MGIE 3N32A 2J7QB 2NPTB 5DPWA 4M0WB 3L54A 3GZNI 1LFDA 3WALA 3VUWA 4MGZE 4G0NB 3V6CB 4WJPA 1E8XA 2DX5B 3PTFC 2BPSA 1WJUA 2N1WA 3QA8A 5DPTA 3V60A 4FHJA 2KWVB 3M62B 4ANXA 2Z0DB 2ZPNA 4AP4C 4IG7B 4BVUC 5JHAA 1C3TA 3D32A 3DBLI 2OOBB 4GSWA 1WRDB 5KHQA 3UIPB 2XEWA 1IP9A 1XQQA 1Q5WB 4AUQC 3VHTC 2KLGA 4G50A 3OJ4B 5CTRC 3VXWA 4WWOA 2JVCA 3CMMB 2LVQA 2CKHB 4I6PA 2J0JA 2CS4A 2NR2A 3L10B 1EF5A 2NPTA 1CMXB 2GBKA 3BY4B 2K1FA 4HCNB 4EEWA 1GG3A 2C7MB 2L0TA 2BYFA 2WDTB 2KDEB 1E8YA 4K81A 1YIWA 2LZ6A 2BKRB 4RM8A 5D6JB 1WE7A 2D07B 2MBQA 3AXCA 2M4NA 2A5UA 2KD0A 4AWJA 3H7PA 2DZJA 3TMPB 1WGYA 3VH3B 3KVFB 3PLVA 3PRZA 4AJYB 3RZFA 5J18A 1D3ZA 2IYDB 2KNBA 1OEYA 4CYEA 2PEAA 3DVNU 3AU4A 3JW0X 2EKEC 3U30A 2IO3B 3DVNV 2N4FA 4BFRA 1ISNA 1VCBA 5TR5A 4GDKB 2CR5A 2M17A 1UZXB 4K1RB 4EKUA 3H9DA 3JSVB 1S1QB 4IWQA 2NS5A 1U4AA 1WY8A 2KDFB 2RR9A 4A3PA 5AZHA 2LUEA 2KXJA 3X23A 1X1MA 4GGQA 2JZ3B 3GOEA 3IFWB 5DCNA 2ZPYA 2ZCCA 2FIFA 1QZEA 2O6VB 2OJRA 4IUMB 3ZRFA 5LLIA 4IM3A 1UD7A 3ZVVA 5L83A 3TBLD 2N9XA 2YLMA 2ZNVB 2JF5A 3QIJA 4ZYNA 2KDIA 4KDLB 1NBFC 3A4SC 4F7ZA 1V2YA 2ZNVC 3APDA 5LXHA 4GDKA 5LXIB 3NZUA 1H4RA 3TL5A 1UBQA 4BKSD 3M3JA 1Y8RC 1J0GA 4FA6A 3WIMA 3QAQA 3QJZA 4PS7A 1UBIA 1Z2MA 1E5WA 1SGHA 4MM3A 2MP2A 1FXTB 3PPAA 4NQKE 4WJNA 4XZ4A 4BBNF 3DVGX 1LQBA 4A3OA 1YQBA 1WXVA 2KO3A 2KKCA 1WFYA 3QWZB 2WX0A 2FIDA 3A9KB 4W9JA 2DAFA 1WGDA 1IPGA 1J8CA 2LI5A 3B08A 4MJSA 5G55A 1P3QU 4KIKA 1P98A 4KVGB 4HVBA 5IA7A 2DZMA 3AI5A 2V4LA 3ONSA 3ZTDA 3W1YA 3A9JB 3LJ3A 4HPLB 1Q0WB 2PPHA 1P9DU 3L08A 3MJWA 2I1JA 4E71A 3PVLA 3PZDA 4MGKE 3DCGA 5J17A 4A20A 2Z0EB 4M8NA 4EZJA 2KMCA 2KHWB 4TUUA 2KANA 1RLFA 2RSUA 2LVPA 3UQBA 2KFJA 3PRPB 2Z59B 2N1VA 3DPDA 1V9JA 1YX6B 4IWOA 1WXMA 3APFA 2PE9A 3A9KA 2JT4B 4RMAA 4JQWC 4HXDA 1RRBA 2MBEA 4HLEA 2WYQA 1TZ1A 1WXSA 1WR6E 4N9F4 2IO0B 3A1QA 1A5RA 2N9EB 1WJ4A 1K8RB 2FCSA 4PYUA 3W1SC 2Y5BB 3H7SA 3H6NA 3R3MA 2K25A 4GU2A 4II3B 3A33B 1V6EA 5FR6A 3ZNGC 4DHJD 2JZZA 1ZGUB 2KN5A 3KYCD 4I6LB 4KZCA 3ZDTA 3VVWB 3DBRI 2CHZA 5D94A 2DYBA 5IAAC 4DK5A 4WJOA 1OQYA 1WJ6A 3T9LA 4EZLA 3EECA 3S2AA 4DDGD 2R2QA 1Z5SB 2C60A 4FJZA 2XK5B 3L13A 2PJHA 1PQSA 2RGFA 3L17A 3W1SA 2O2VA 1UELA 1HE8A 3B0AA 2GOWA 2GMIC 2LWPA 1NDDA 2KTRA 5CHFA 3RT3B 3VAWA 4W9EA 3ZUNA 2FCMA 1C1YB 2BWFA 2J0KA 1WM2A 3MTNB 4GN1A 4K7UA 4FULA 3VTWA 5L95C 3PHXB 1V49A 4FLHA 2BGFA 4TQ0A 5BO4B 2IBIB 2V1YA 2K6QA 4W9IA 1WM3A 2JXXA 4YL8A 3T8MA 2LXAA 5DPRA 3OAWA
chains in the Genus database with same CATH superfamily
2HTHA 1GC6A 2ASQA 4NAWB 2KMAA 2N7EA 3N30A 4AQ7A 2L83A 3H1UA 3MP9A 2NMQA 1YJJA 3PS6A 1HXYD 2WQYB 4NJCA 1DOIA 2I1KA 1P1AA 3E9SA 1WSPA 4PK1A 1T0YA 4DHZB 1EUVB 3EUB2 4E74A 3ML8A 2QCZA 4MSMB 2LXCA 4KV2A 1V5TA 4AJWA 1PDXA 4GDLB 1KFYB 3B1LX 2CHWA 2MA9B 4YTPB 3ZKJC 2J4XA 3PLUA 2IY0B 1HA5A 4ZRQA 2KFKA 3O13A 4W9KA 2VZKD 5E6OA 5KHOA 2O6VA 1SIFA 3SEBA 1C4CA 5CHVC 1KLGD 2MQJA 1E90A 1I35A 1Y56A 2KDMA 2LGDA 2XNAC 2G45B 2UYZB 2N7DA 4A8XC 3RD2A 1EO6A 1FFVA 4BOSC 3KH0A 4DXFA 2D3BA 1JW9D 2V3PA 3BYTB 1WXAA 2BWES 3MHSD 2CU1A 4NJ6A 3PHWB 3L0WB 2LUMA 5C23A 1ET6A 1XCQL 1WR1A 5AUKA 2HJ8A 4NJ7A 4NQLB 3K9PB 4FJYA 3A9JA 3DVGY 2IO1B 3A4RA 4BOZB 2BS3B 4BKGA 1ZKHA 2MBBB 1SIJA 3KUZA 3AU5A 5BMGA 2BYEA 2N9LA 1E8WA 1J7CA 1SEBD 1V80A 2MBOA 3ZNID 4HRSA 2AQ3B 4DHJB 1OEYJ 1WI0A 3M95A 4HK2A 2MCNB 1E7VA 2JX5A 3RNAC 2ZW1A 4KGRA 3N1YC 4IKGA 1FO4A 4DQOC 4E3CA 2C7NB 4FN2A 2GBRA 3IHPC 1F77A 3NJTA 3NG0A 2FE8A 2OEDA 3AECB 3KUDB 4OZCA 4LNKA 2KX0A 3WAMA 4ZYSA 1HTOA 3ML9A 4LNNA 2KX3A 4URKA 1WGHA 2ZVNA 2DLBA 5FR3A 4ITKA 3QCAA 2NTTA 2O6VD 3AE2B 4KKJA 1E6EB 3QC8B 1OQQA 2LMCA 1UWMA 3E56A 3HK0A 4IM2A 2D10A 1QQRA 1FNVA 2LVOA 1VZ7A 2HD5B 5BYQA 1WRIA 1SE9A 4YSXB 1V5OA 4ZRIA 1J7BA 3R2TA 4MJSB 4GDLA 4F1SA 3KUCB 3TEYA 2LGXA 2K6DB 2WXGA 1STEA 3AE7B 4WWNA 5C1ZA 1LO5D 3ZO5B 3WAPA 2JPHA 1KM7A 1YN5A 4JGHB 1QLBB 3DWGC 2IJ0A 2INDC 4IW0A 1WF9A 3QARA 1RAXA 1WX9A 3QK0A 1QILA 4LJOB 2BYTA 4EZKA 3VTUA 1WJNA 3KWLA 3NUHB 3HM6X 4GLSC 3R7QA 2K8BA 2NBVB 2AL6A 3WANA 2MSED 2QEJC 1BT0A 1HZ5A 3U4EG 4LK0M 2V3SA 2TSSA 1LFDA 3VUWA 2VH1A 2I38A 3V6CB 2HJ1A 2IGDA 1WJUA 2BS2B 1C3TA 3I63C 1ZP0B 2QILA 1WRDB 3UIPB 2WXHA 2DBYA 3VHTC 4US8A 2JVCA 4L1BA 1DOYA 1CMXB 3TSSA 1YMHE 2WDTB 1SBBB 1CZPA 4OVZA 5D6JB 1ROEA 2D07B 3AXCA 2KD0A 2INPE 2DZJA 3TMPB 5BMHA 3KVFB 3PLVA 5J18A 3T3NA 2J52A 1D3ZA 2PEAA 3ZJTA 3DVNU 1FPYA 1L0YB 3DWMA 3DVNV 4BFRA 4GDKB 1C77A 2CR5A 2D5GA 5IKCM 3TEXA 1S1QB 2RR9A 5AZHA 1X1MA 2JZ3B 1OFFA 5DCNA 2K9XA 2ZCCA 1UF0A 1QZEA 2N0SB 3P63A 5LLIA 2QSDA 1UD7A 2YLMA 4ZYNA 2KDIA 4KDLB 3PZ8A 1E0ZA 1K50A 1J0GA 2PIAA 3QJZA 4JE3B 1UBIA 3AEGB 1E5WA 1XLQA 1DOXA 1LQBA 2KO3A 2LJIA 2Y3AA 2WX0A 1WGDA 5FKAC 4MACA 2GLSA 2GRIA 2LI5A 1P7FA 4MJSA 5G55A 1P3QU 5IA7A 4N59A 3W1YA 4HPLB 3LJ3A 1T3QA 5J17A 3W5UB 2D3CA 2KANA 2RSUA 3PRPB 2H89B 2Z59B 3DPDA 4IWOA 1WXMA 2MBEA 1N5XA 1TZ1A 1WR6E 3H8HA 2N9EB 2WXLA 3R3MA 1GB4A 5FR6A 2QMTA 3VR8B 3ZNGC 4DHJD 2JZZA 3KYCD 1QT9A 3VVWB 1ZXHA 1TS4A 5D94A 3T9LA 3S2AA 4DDGD 2INCC 1PGAA 4FJZA 2R61A 2MH7A 2PJHA 1PQSA 3L17A 3W1SA 1HE8A 3B0AA 4N6EB 1RYJA 1EWCA 2FCMA 1WM2A 3AB5A 1MHXA 3VTWA 2J53A 1V49A 4TQ0A 5BO4B 3TUOA 1SE3A 2K6QA 1WM3A 1SJED 2BQQA 1ZPSA 1QKZA 1XT9B 2PTLA 4D2KA 5D3IB 2KWDA 4G3XB 4NAMA 2JWZA 3U8ZA 3VRAB 2LRUA 1WGRA 2WS3B 3EC8A 4P1CC 3HIZA 4LLGM 3T3OA 1N5WA 3LYYA 4ZOHC 4B9KA 3QX1A 3VQIA 4CO7A 1GNUA 2KFKB 1IUEA 2JY6A 3U52E 1WH3A 3X0WA 4IDIA 4ANVA 1YD8U 2KVRA 3NS8A 1LM8B 4X57B 2C5LC 1YNTE 2DAJA 2DZIA 1F0ZA 2N9KA 2YEPF 2LFIA 3O65B 2D3GA 2L8JA 2MW5A 2PW9A 3N9YC 4FADA 3ZYYX 5HKHA 1V81A 4DWFA 3C19A 2IPKD 1KF6B 3P4QB 1BXTA 1E10A 1ZE3D 2KJHB 2XBBC 2G4SA 4ZRKA 1D4BA 2QIEB 4DXAB 1TKEA 3NVZA 1NYQA 3B2FA 2YVCA 3PREA 2M56B 1WZ0A 2MWSB 4XDCA 5EE1A 4BAXA 2JRIB 4WAFA 4NNJB 4FHKA 4G11A 1MI0A 5C3JB 2DYMA 4HDOA 4XX5A 1NI3A 1K51A 4TV3A 4NZLB 4EOYA 1EWYC 3WA0A 1FIQA 3RNFC 3NHEB 2C7HA 3NZ3A 2G3QB 4ASWC 5JXVA 4MEMA 2M0AA 3VUXA 3UI3A 2EKIA 2JZPA 4O1NA 4JLCA 1WIAA 4J6IA 3LDZE 5G2NA 2KZRA 3TEWA 1MG8A 1IBXB 1L0XB 2UWQA 3H7PB 3ZJUA 3UQAA 1D6EC 4LJPB 1PYWD 4N58A 3GB1A 4FXCA 1I4HA 2ZVOA 3VR9B 3DHGC 4XC2A 5I4DA 2INNE 5LNK1 1V1PB 3IG3A 3RFZB 3EFUA 3Q3MC 3ENEA 4ARIA 2V3NA 2NBUA 4H2AA 2RPQA 4PS3A 5HFYA 2V4IB 2HE7A 4RGOS 2WXRA 2WXFA 4AS1A 4C7YA 4KGTA 1D5XC 3VRBB 1L6VA 2MEKA 2Z8LA 3Q8CA 3VFKA 4P1BC 3LB8C 3RZWC 1GPXA 1KRHA 4MM3B 1L6UA 3UIOB 3BVGA 3V61A 4JL9A 2RD0A 3MHZA 2L05A 1E7UA 3BINA 2NCNA 1E7PB 4XYCA 5JHBA 4GMVA 3R66C 3PSEB 1WX8A 2K8CA 3MJ5A 2EELA 2DWQA 4WWMA 3UGBB 2BKFA 2IY1B 2JQRB 2PMVA 2KAJA 3P2BA 2WXKA 4M8MA 1XD3B 2IZVB 2MLBA 3VDZA 3A1QB 2QDFA 3ZGZA 1C76A 1AWDA 2L7RA 1SF0A 1D5MC 4YSYB 4K7WA 2WP9B 4TKNA 1A70A 1MHHE 4ICUA 4RFBA 2DHZA 1UGJA 4ZHOA 2M19A 2BBCA 2BF8B 5HHDG 2ICIA 3AE1B 2O2VB 3NOBA 2AQ2B 2MJDA 2IO2B 1MJDA 2L3ZA 3TIXA 3N32A 4WURA 2J7QB 4KGSA 4USAA 4WJPA 1E8XA 2BPSA 5MPOA 3QA8A 1L5PA 3D32A 3OWEB 1PGBA 4GSWA 2H88B 2AQ1B 4AUQC 2KLGA 2W82A 3Q6BA 1HTQA 2LVQA 4I6PA 2J0JA 2CS4A 3RI7C 3L10B 2KT7A 3Q8BA 2GBKA 1D5ZC 1C79A 2C7MB 2L0TA 4LNIA 1E8YA 4K81A 2G1EA 1IBXA 2A5UA 3ZXVA 3RNBC 3H7PA 2QC8A 3VH3B 2UU7A 3GS2A 3AEDB 2KNBA 1OEYA 1RM6C 1QOFA 3JW0X 2IO3B 2K0PA 1GAQB 1ISNA 1VCBA 2JXTA 5TR5A 5GXGB 2RDGA 4S17A 3SFEB 1WY8A 1ZUD2 1V1PA 1UWXA 2LUEA 2KXJA 3X23A 3DHHC 1TJEA 2ZPYA 4ZHPA 2FIFA 3FKYA 4IUMB 4IM3A 3RNEC 2ZNVB 1I4PA 3QIJA 3NVWA 1NBFC 2IGGA 3BK2A 5LXHA 3APDA 5IN7A 5LXIB 2GB1A 3M3JA 4FA6A 4RNAA 1ESFA 5E6JA 5G5HA 5IOIA 4MM3A 5HI1A 1HEZE 4NQKE 4XZ4A 3AM9A 1L4ZB 3NVVA 2KKCA 2ON8A 3QWZB 2FIDA 1AN8A 3AH7A 2Y5CA 1IPGA 3AI5A 2V4LA 3ZTDA 3P4RB 2PPHA 1P9DU 2I1JA 4MGKE 3PZDA 5BYRA 2Z0EB 2KMCA 1RLFA 1B9RA 2LVPA 1V9JA 2K3UA 4WIPA 2ACZB 4RMAA 3A9KA 4JQWC 4RGTA 3I57A 4HLEA 2WYQA 2KYWA 2IO0B 3A1QA 1OQRA 3H7SA 4II3B 1WGKA 4I6LB 1ZGUB 1FRDA 3RNGC 4RH6A 2AX5A 4S0RA 3EECA 2R2QA 1Z5SB 2C60A 1SJHD 3AEFB 2XK5B 2OJWA 3L13A 2CU3A 2O2VA 1UELA 1XF5L 5CHFA 1NYRA 3VAWA 4WH4A 3ZUNA 4GN1A 4K7UA 2K22A 2X8XX 1T0QC 5L95C 3FC4A 2BGFA 4UDUC 1BUIC 2LXAA 2MJ3A 2JSVX 3DOWA 2WXMA 3Q3FA 5BYSA 3K9OB 4A90A 3ZNHB 3AV8A 4KSKC 1QOBA 4W9CA 1WE6A 4ACFA 2RPVA 2W55A 1MG4A 3AE8B 3ECIA 2L52A 1WYGA 4RCOA 1GUAB 3VUYA 1E9MA 2RMMA 4MH0E 1GC7A 2DZKA 4IM0A 4JIOU 5CX3A 1TBEA 2EMSA 3ZW3A 4IWPA 3DBSA 2VH2A 2WXNA 3BVMA 3PRMB 5BMIA 1HQRD 3EFCA 3NRZA 5JH5C 5EE0A 2LASA 1JMLA 2MBHA 3HVZA 1XEEA 4KZ0A 4HCPB 1JWUD 1FNUA 3HRDD 2REXA 2R2OA 3Q3OC 2PVOD 3ZLZA 1K52A 2KC2A 2D3AA 4MT5A 1JCKB 3JVZX 2ZEQA 4OVUA 1JRPA 2MX2A 2AWTA 1AARA 1MFWA 1FXAA 1V8CA 4KX6B 1L7YA 3NY5A 3CSTA 3V3XA 2JRHA 2GBJA 4ZRJA 2JUOA 1WWTA 4L23A 2HDEA 3KLSX 4MSQB 4ANUA 5J2RA 2ZCBA 2KN4A 1R4NB 2QJLA 3SU8X 2IGHA 4BKSA 3U7ZA 3I5JC 2KQ7A 3BVZA 2WHIA 4ICVA 1MVKA 5DPSA 2RDHA 2W3SA 2KMMA 3AE9B 1FCCC 1ZDVA 1I4QA 3V6EB 1F1HA 1VD2A 1R4MB 3CF6E 2LHDA 2G9HD 1TTNA 2BW2A 2KWCA 4IOIE 1YJ1A 3LXFA 1M94A 3Q3JA 4XE0A 2Q5WD 1R4NI 5GMVA 3AN1A 1ENFA 2KLCA 1TGZB 4W9GA 2BVCA 3OJ3A 3ZQ4A 1QF6A 4KSLC 1QOGA 3RYTA 1EU4A 4MH8A 1UNSA 2GBMA 2XK5A 3ETRA 1R4MI 2L76A 4MGYE 4K7SA 4BZAA 2L1AA 2RDBC 1J19A 3IT6B 4NPNA 1L4DB 2G4DB 4OHJA 5T8IA 2SAKA 3IAS1 4XWTA 1ZXIA 2FCNA 4HJGE 4HWIB 4TQ1A 1S3SG 2N9PC 4F8CB 2AYOB 3Q8EA 3BIID 4WAAA 2NBWB 1C4AA 1TIFA 2WXPA 3PGEA 5D7GA 3ZXRA 3U2SC 3KQ4A 3ZNZB 2KJRA 3UINB 1RFKA 1EU3A 4W9DA 4ANWA 3ZTCA 3ZRCA 3CWIA 1NI2A 2KOXA 4CHKA 1I4RA 1UH6A 2MP2B 4P7IA 4FBJB 1E8ZA 3R7RA 1KJTA 1Q10A 2KQ4X 1GB1A 3CIRB 4I6NB 3M63B 2QHOA 2KVZA 4LDTB 1TKYA 4KIKB 5E6NA 1WYWB 2WXJA 3P1MA 4WQMA 4LTUA 4RF1A 4JWSC 4DHZE 5EDSA 2W9NA 1GJZA 4YTNB 2IDYA 1PUTA 1F52A 2M1MA 2LGYA 1L0VB 1I7HA 3ZDMC 2MRPA 4W9LA 3DBLB 2E3TA 2KC1A 4C4VB 2BT6A 3EA6A 2FUHB 1F9JA 4LNFA 4W9HA 3SD5A 3BYYB 1K53A 1XO3A 2WX1A 1WGGA 3IT4B 3UF8A 3GE8C 2V0GA 1KTKA 3Q2AC 3SFDB 4MGZE 4G0NB 5H8YE 1SE4A 2DX5B 1N60A 3V60A 2N1WA 4FHJA 2KWVB 3AE3B 4ANXA 4BVUC 2LGSA 4OZAA 3DBLI 1N63A 1FMAD 2XEWA 1XQQA 1TY2A 4G50A 3VXWA 2GI9A 4WWOA 2WXIA 2NR2A 4PT5A 2NPTA 3MC9A 4M0WA 3BY4B 4HCNB 3AEAB 4XDDA 2KDEB 2LZ6A 2BB6A 1FD6A 1XCTL 2MBQA 4K3BA 4AWJA 1FXIA 1N6ZA 2WXQA 4J3OD 5EE3A 3U30A 4A9AA 2FBWB 3I9V1 4B0MA 1TS5A 2M17A 4K1RB 3JSVB 4IWQA 3URYA 1U4AA 2KDFB 5AUIA 3RNCC 3GE3C 4GGQA 3Q14C 3GOEA 3IFWB 2JU6X 1SB3C 1ZDXA 3ZVVA 2W54A 3TBLD 3C8YA 3FILA 3P42A 4LNOA 1TT5B 3AE5B 3A4SC 4F7ZA 2BB5A 1V2YA 3NZUA 1UBQA 2L32A 1Y8RC 4A6QA 4PS7A 1Z2MA 2MP2A 1FXTB 4BBNF 1XLNA 3DVGX 4A3OA 1YQBA 1WXVA 1QOAA 2XN9C 1J7AA 3A9KB 4W9JA 2DAFA 1CK1A 2W3RA 2X38A 1J8CA 3WCQA 2OHFA 3B08A 1JWSD 4KIKA 1P98A 4YXDB 4KVGB 4HVBA 2JWUA 1Q0WB 3MJWA 4E71A 3ABVB 3PVLA 3MFGA 3DCGA 4A20A 4EZJA 2KHWB 3Q3NC 3UQBA 2KFJA 1VR9A 1B1ZA 4C7ZA 3AEBB 3R2IA 1YX6B 4DXGA 2PE9A 2JT4B 2LGIA 4HXDA 4N9F4 1WJ4A 1K8RB 2Y5BB 1YN4A 4K3CA 2K25A 3P4SB 3A33B 4JWUC 4KZCA 1XXGA 4C4VA 2CJNA 2ZW0A 4WJOA 1OQYA 1WJ6A 4EZLA 3TEZA 4YSZB 1NVID 2GOWA 1NDDA 2WNMA 3RT3B 3DBHB 3MTNB 4FLHA 1YN3A 2V1YA 4REZA 1JROA 2WDQB 4W9IA 4YL8A 4L2YA 2SEBD 1JWBD 4PYZA 5E6PA 3RPFC 3T8MA 1I42A 1PFDA 3L4PA 3BK1A 1FEHA 1H8CA 1RFAA 1T0RC 2PVGC 4HJKA 3JYUA 1WMHB 2JYTA 3OG5A 2B3AA 1TYGB 1N62A 1TS2A 4C80A 4OW0A 3MC8A 3QHTA 2L0FA 4GIVA 3DBHI 3NZSA 4XGAB 3C0RB 1JRUA 1FRRA 4NAWA 3NVYA 3MC0B 3WAOA 2ZJDA 3Q69A 3Q8AA 1OGWA 3RCZA 4P6VF 4WJQA 3AE6B 2DYOA 5FK9C 4LDTD 5CHWA 4EFOA 3JSVA 3J9CA 1EM7A 1F2RC 2KQSA 4B95A 1T0SC 3BWUD 2V9HA 1FCLA 2WGSA 1XLOA 3KW5B 5EE9A 1WX7A 1R7SA 4B0EA 2I2YA 3U7DA 3BZDB 3DHIC 1LXDA 1VJKA 2L00B 2NVUI 4BBNC 2BTEA 4LCDE 1TZOA 1TKGA 4YT0B 4KKIA 1VLBA 4GOCA 4BKTA 4M02A 4C00A 3ZJVA 5IP4D 4WWPA 3AEEB 2ZZPB 2A4ZA 3KYDD 3N1XC 1C4PA 2K39A 4EE2A 4OZBA 3V05A 1C9FA 4C56C 3B2GA 1HZ6A 4FJVB 1SSNA 1V86A 3HM3A 2M0XA 1YQ4B 2WXOA 1IYFA 3TJPA 1FNWA 1KOTA 1L2NA 1EF1A 2FCQA 1JWAD 4GXBA 2KACA 4B6WA 1FFUA 1DYQA 3DQVA 4AOFA 4DBGA 4OVVA 4MDKE 2FNJB 3SHQA 2DNFA 2EMTA 1JQ4A 4PS8A 5AZGA 4KDIC 5AZFA 2J42A 1JWMD 4M00A 3FAHA 3HUIA 4A55A 3IVFA 4RGMA 3SDLC 1UUPA 1P7EA 2LD9A 2KWUB 2D11A 1Q1OA 4NY0A 1BMLC 1I4GA 3Q8FA 1P0RA 2C9WB 3AE4B 2GBNA 2LJ5A 1G6JA 2WDVB 3CSFA 3VTVA 4DDID 3I3TB 2LHEA 3VH4B 1TY0A 2WU2B 3QQ8B 5JZEB 1WMHA 2KJ6A 4HDQA 3ZIMA 1V97A 1ZW7A 4W9FA 2WDRB 4ARCA 4R3DA 4HPMB 2AEHA 3N3KB 4IC7B 2DENB 2FAZA 2MJEA 4WQOB 3APCA 2YEPB 2K8HA 3V62A 2AL3A 3IBEA 5HG2A 1ACCA 1TS3A 3RUIB 3DDCB 1OTRB 2KDBA 4CQNA 3RULA 4II2B 3P4PB 4TSSA 1KLVA 2LRWA 3ALBA 4ZDVA 1PGXA 3HHMA 2KK8A 1WXQA 2LEKA 2VZKB 1YX5B 2JYEA 1UGMA 4Q2JA 5AEKB 1WZ3A 2J0MA 3PV1A 1ZOYB 2WLBA 3OLMD 3PZ7A 1C78A 2E6XA 4EUTA 3PO0A 1AW7A 3GZNB 2NTSA 3AMZA 2WWZA 2PE6B 2BYVE 2B76B 1KLUD 2M8SA 3AULA 4RM9A 3NS1A 3TCAA 3L16A 3PT2B 2CHXA 2N7JA 3HVDA 2D2QA 3N20C 4US9A 1IGDA 3GP7A 4HEA1 2VRRB 5H92C 2KTRB 1JALA 5D2MB 1V1OA 4MELA 3EHVA 4GB9A 2KTFA 4MGIE 2NPTB 1VZ8A 5DPWA 4M0WB 3L54A 3GZNI 1SXTA 3WALA 2BS4B 3PTFC 5DPTA 1MPEA 3M62B 2Z0DB 2ZPNA 4P16A 4IG7B 5G5GA 4AP4C 5JHAA 2OOBB 5KHQA 1IP9A 3N1ZC 1SE2A 1CQVA 1Q5WB 4XWWA 3B9JA 3OJ4B 5CTRC 1LGRA 3CMMB 2CKHB 1VDVA 1EF5A 1YJIA 4M01A 3IAM1 1NENB 2K1FA 4EEWA 1GG3A 2BYFA 1RWSA 4HPPA 5IO9A 1YIWA 2BKRB 4RM8A 1WE7A 2M4NA 1WGYA 2CJOA 3PRZA 4AJYB 3RZFA 3FILB 2IYDB 4CYEA 3W2DA 3AU4A 1VZ6A 2EKEC 1IGCA 2N4FA 2MHJA 1DGJA 1UZXB 1AYFA 4EKUA 3H9DA 1M4VA 2NS5A 4A3PA 1N61A 5D3DA 2ONQA 4QAYA 3W5VB 2Y5PA 3KWVA 4RF0A 4HROA 2O6VB 2OJRA 3ZRFA 1T5XD 5L83A 2N9XA 1T6BX 2JF5A 3RMKC 1I4XA 2ZNVC 4GDKA 1H4RA 3TL5A 4JPSA 4BKSD 4RGNA 3WIMA 3QAQA 1SGHA 4YTMB 3PPAA 1VRAB 4WJNA 1WFYA 4HKQA 3SR6A 2WU5B 1YQ3B 1XLPA 2K5PA 3W9CB 4HKZE 5C2TB 3DBRB 2DZMA 3ONSA 3A9JB 1YOVB 3L08A 5TSSA 4M8NA 4TUUA 1GOZA 1F2RI 2N1VA 4TMAB 3APFA 4YWGG 1RRBA 1WXSA 1A5RA 4PYUA 2FCSA 3W1SC 1CJEA 3H6NA 4GU2A 1V6EA 2KN5A 2PKOA 3IXSA 3ZDTA 3DBRI 2CHZA 2FUG1 2DYBA 5IAAC 4DK5A 4JX1C 2RGFA 2PLPA 2HTME 2GMIC 2LWPA 3EGRA 3RN9C 2KTRA 1ET9A 4W9EA 3R8BA 1C1YB 2BWFA 2J0KA 1NEKB 4FULA 1KH0A 3PHXB 2IBIB 1FM0D 4ZRPA 2JXXA 5DPRA 3OAWA
chains in the Genus database with same CATH topology
2HTHA 1GC6A 1XT9B 2ASQA 3DOWA 4NAWB 1H8CA 4G3XB 2KMAA 1RFAA 3Q3FA 2JWZA 3K9OB 2N7EA 3JYUA 4HJKA 3U8ZA 1WMHB 3N30A 3ZNHB 2B3AA 4KSKC 4W9CA 2LRUA 1WGRA 3H1UA 1WE6A 3EC8A 3PS6A 3HIZA 3ECIA 3QHTA 2L0FA 2I1KA 4GIVA 3DBHI 1P1AA 4B9KA 3QX1A 3NZSA 1GUAB 3VQIA 3C0RB 3VUYA 4CO7A 1GNUA 1T0YA 2KFKB 1JRUA 4MH0E 1GC7A 2DZKA 4IM0A 2JY6A 4JIOU 5CX3A 1EUVB 1TBEA 2EMSA 1WH3A 4NAWA 4IWPA 4PYZA 3ML8A 3X0WA 3ZW3A 4E74A 4MSMB 3DBSA 2LXCA 4KV2A 1I42A 1V5TA 3PRMB 4ANVA 4AJWA 3WAOA 1YD8U 2KVRA 2ZJDA 3NS8A 1LM8B 1OGWA 4GDLB 3RCZA 4X57B 2C5LC 5JH5C 3B1LX 2CHWA 2DAJA 2LASA 2MA9B 4WJQA 2DZIA 3ZKJC 2DYOA 2MBHA 3PLUA 4KZ0A 4LDTD 5CHWA 2IY0B 4EFOA 3JSVA 4HCPB 4DHZB 3O65B 2KQSA 4B95A 2D3GA 2L8JA 2MW5A 2KFKA 4FADA 4W9KA 5E6OA 5KHOA 3KW5B 2REXA 1WX7A 2R2OA 5HKHA 1V81A 2O6VA 4DWFA 3ZLZA 3U7DA 1SIFA 5CHVC 2KC2A 3JVZX 2MQJA 2ZEQA 1LXDA 4OVUA 1E90A 1I35A 2L00B 2KJHB 2NVUI 2XBBC 4BBNC 2G4SA 2MX2A 4LCDE 2AWTA 4ZRKA 1AARA 2LGDA 4DXAB 4GOCA 4BKTA 1L7YA 2G45B 3NY5A 2UYZB 3CSTA 2N7DA 2YVCA 3PREA 3RD2A 1EO6A 2JRHA 2GBJA 1WZ0A 2MWSB 4ZRJA 4BOSC 2JUOA 3KH0A 4WWPA 2JRIB 2ZZPB 2A4ZA 3KYDD 1WXAA 2K39A 4MSQB 4ANUA 4NNJB 2BWES 5J2RA 3MHSD 2CU1A 2ZCBA 4FHKA 4NJ6A 3PHWB 3L0WB 4G11A 3SU8X 4BKSA 5C23A 2DYMA 4FJVB 4HDOA 1V86A 3HM3A 1WR1A 2KQ7A 2M0XA 2HJ8A 4XX5A 1IYFA 4TV3A 3TJPA 4EOYA 4ICVA 5DPSA 4NJ7A 4NQLB 3K9PB 4FJYA 3WA0A 3A9JA 3DVGY 2IO1B 3A4RA 4BOZB 1KOTA 1L2NA 4BKGA 1ZKHA 1EF1A 2MBBB 2FCQA 3V6EB 3NHEB 3KUZA 3AU5A 1VD2A 2C7HA 4GXBA 3CF6E 2G3QB 4ASWC 4B6WA 2BYEA 4MEMA 1TTNA 3DQVA 1E8WA 3VUXA 1V80A 2MBOA 4AOFA 3ZNID 4DBGA 2KWCA 4OVVA 4MDKE 2FNJB 1YJ1A 3SHQA 4DHJB 1OEYJ 1WI0A 3M95A 4HK2A 2MCNB 1M94A 1E7VA 2EMTA 3Q3JA 4PS8A 4JLCA 1WIAA 1R4NI 4J6IA 5GMVA 3LDZE 5AZGA 5G2NA 4KDIC 2KLCA 2KZRA 4E3CA 1TGZB 5AZFA 2C7NB 4W9GA 3OJ3A 1MG8A 4FN2A 4KSLC 2GBRA 2UWQA 3H7PB 5E6PA 3RYTA 3UQAA 4LJPB 3IHPC 3IVFA 3SDLC 2GBMA 2XK5A 2LD9A 1R4MI 2KWUB 2D11A 1Q1OA 2L76A 4MGYE 3KUDB 4K7SA 4NY0A 2ZVOA 4XC2A 1J19A 4NPNA 2G4DB 2KX0A 3WAMA 1P0RA 3IG3A 2C9WB 3EFUA 2FCNA 3ENEA 2GBNA 2LJ5A 4HWIB 4TQ1A 1G6JA 3ML9A 2NBUA 1S3SG 2RPQA 4PS3A 2N9PC 3CSFA 3VTVA 2KX3A 4DDID 4F8CB 2AYOB 4URKA 1WGHA 3I3TB 2HE7A 2ZVNA 4WAAA 2NBWB 3VH4B 3PGEA 3QQ8B 5JZEB 5D7GA 3QCAA 1WMHA 3ZNZB 2KJ6A 2KJRA 3UINB 2O6VD 4HDQA 3ZIMA 1ZW7A 3VFKA 4W9DA 4ANWA 3ZTCA 4W9FA 3ZRCA 3QC8B 4HPMB 1NI2A 2KOXA 3RZWC 2AEHA 3N3KB 4CHKA 1UH6A 4IC7B 3HK0A 2DENB 4IM2A 2D10A 2FAZA 2MP2B 4WQOB 2LVOA 3UIOB 2HD5B 3APCA 4P7IA 4FBJB 2K8HA 1E8ZA 2AL3A 3IBEA 3R7RA 3V62A 1KJTA 3V61A 1SE9A 3RUIB 1V5OA 3DDCB 1OTRB 2RD0A 4I6NB 4JL9A 2KDBA 3M63B 2L05A 4ZRIA 1E7UA 2QHOA 4LDTB 3BINA 2NCNA 3RULA 4MJSB 4II2B 4GDLA 4KIKB 4F1SA 3KUCB 5JHBA 1KLVA 5E6NA 2LGXA 1WYWB 2K6DB 2LRWA 4GMVA 3R66C 3ALBA 4WWNA 4ZDVA 3PSEB 5C1ZA 3HHMA 1WX8A 2KK8A 2K8CA 4DHZE 3ZO5B 1YX5B 3WAPA 5EDSA 2W9NA 2JPHA 1UGMA 1KM7A 5AEKB 1WZ3A 4JGHB 1GJZA 3UGBB 2BKFA 2IY1B 2J0MA 3PV1A 3OLMD 3P2BA 4EUTA 4M8MA 2M1MA 2WWZA 1XD3B 2PE6B 2IZVB 1WF9A 2MLBA 4IW0A 3VDZA 2BYVE 2LGYA 3A1QB 3ZDMC 2MRPA 4W9LA 2L7RA 2M8SA 3QARA 3AULA 1RAXA 4RM9A 2KC1A 3TCAA 1WX9A 3QK0A 4K7WA 3L16A 4LJOB 3PT2B 2CHXA 4EZKA 2FUHB 3VTUA 1F9JA 1WJNA 4TKNA 3HM6X 2D2QA 3R7QA 4ICUA 2DHZA 4W9HA 2K8BA 3SD5A 2NBVB 2AL6A 3WANA 2BF8B 2MSED 2WX1A 1BT0A 2O2VB 3NOBA 2VRRB 2IO2B 1WGGA 2KTRB 5D2MB 2L3ZA 4MELA 3UF8A 3EHVA 4GB9A 3TIXA 2KTFA 2V3SA 4MGIE 3N32A 2J7QB 2NPTB 5DPWA 4M0WB 3L54A 3GZNI 1LFDA 3WALA 3VUWA 4MGZE 4G0NB 3V6CB 4WJPA 1E8XA 2DX5B 3PTFC 2BPSA 1WJUA 2N1WA 3QA8A 5DPTA 3V60A 4FHJA 2KWVB 3M62B 4ANXA 2Z0DB 2ZPNA 4AP4C 4IG7B 4BVUC 5JHAA 1C3TA 3D32A 3DBLI 2OOBB 4GSWA 1WRDB 5KHQA 3UIPB 2XEWA 1IP9A 1XQQA 1Q5WB 4AUQC 3VHTC 2KLGA 4G50A 3OJ4B 5CTRC 3VXWA 4WWOA 2JVCA 3CMMB 2LVQA 2CKHB 4I6PA 2J0JA 2CS4A 2NR2A 3L10B 1EF5A 2NPTA 1CMXB 2GBKA 3BY4B 2K1FA 4HCNB 4EEWA 1GG3A 2C7MB 2L0TA 2BYFA 2WDTB 2KDEB 1E8YA 4K81A 1YIWA 2LZ6A 2BKRB 4RM8A 5D6JB 1WE7A 2D07B 2MBQA 3AXCA 2M4NA 2A5UA 2KD0A 4AWJA 3H7PA 2DZJA 3TMPB 1WGYA 3VH3B 3KVFB 3PLVA 3PRZA 4AJYB 3RZFA 5J18A 1D3ZA 2IYDB 2KNBA 1OEYA 4CYEA 2PEAA 3DVNU 3AU4A 3JW0X 2EKEC 3U30A 2IO3B 3DVNV 2N4FA 4BFRA 1ISNA 1VCBA 5TR5A 4GDKB 2CR5A 2M17A 1UZXB 4K1RB 4EKUA 3H9DA 3JSVB 1S1QB 4IWQA 2NS5A 1U4AA 1WY8A 2KDFB 2RR9A 4A3PA 5AZHA 2LUEA 2KXJA 3X23A 1X1MA 4GGQA 2JZ3B 3GOEA 3IFWB 5DCNA 2ZPYA 2ZCCA 2FIFA 1QZEA 2O6VB 2OJRA 4IUMB 3ZRFA 5LLIA 4IM3A 1UD7A 3ZVVA 5L83A 3TBLD 2N9XA 2YLMA 2ZNVB 2JF5A 3QIJA 4ZYNA 2KDIA 4KDLB 1NBFC 3A4SC 4F7ZA 1V2YA 2ZNVC 3APDA 5LXHA 4GDKA 5LXIB 3NZUA 1H4RA 3TL5A 1UBQA 4BKSD 3M3JA 1Y8RC 1J0GA 4FA6A 3WIMA 3QAQA 3QJZA 4PS7A 1UBIA 1Z2MA 1E5WA 1SGHA 4MM3A 2MP2A 1FXTB 3PPAA 4NQKE 4WJNA 4XZ4A 4BBNF 3DVGX 1LQBA 4A3OA 1YQBA 1WXVA 2KO3A 2KKCA 1WFYA 3QWZB 2WX0A 2FIDA 3A9KB 4W9JA 2DAFA 1WGDA 1IPGA 1J8CA 2LI5A 3B08A 4MJSA 5G55A 1P3QU 4KIKA 1P98A 4KVGB 4HVBA 5IA7A 2DZMA 3AI5A 2V4LA 3ONSA 3ZTDA 3W1YA 3A9JB 3LJ3A 4HPLB 1Q0WB 2PPHA 1P9DU 3L08A 3MJWA 2I1JA 4E71A 3PVLA 3PZDA 4MGKE 3DCGA 5J17A 4A20A 2Z0EB 4M8NA 4EZJA 2KMCA 2KHWB 4TUUA 2KANA 1RLFA 2RSUA 2LVPA 3UQBA 2KFJA 3PRPB 2Z59B 2N1VA 3DPDA 1V9JA 1YX6B 4IWOA 1WXMA 3APFA 2PE9A 3A9KA 2JT4B 4RMAA 4JQWC 4HXDA 1RRBA 2MBEA 4HLEA 2WYQA 1TZ1A 1WXSA 1WR6E 4N9F4 2IO0B 3A1QA 1A5RA 2N9EB 1WJ4A 1K8RB 2FCSA 4PYUA 3W1SC 2Y5BB 3H7SA 3H6NA 3R3MA 2K25A 4GU2A 4II3B 3A33B 1V6EA 5FR6A 3ZNGC 4DHJD 2JZZA 1ZGUB 2KN5A 3KYCD 4I6LB 4KZCA 3ZDTA 3VVWB 3DBRI 2CHZA 5D94A 2DYBA 5IAAC 4DK5A 4WJOA 1OQYA 1WJ6A 3T9LA 4EZLA 3EECA 3S2AA 4DDGD 2R2QA 1Z5SB 2C60A 4FJZA 2XK5B 3L13A 2PJHA 1PQSA 2RGFA 3L17A 3W1SA 2O2VA 1UELA 1HE8A 3B0AA 2GOWA 2GMIC 2LWPA 1NDDA 2KTRA 5CHFA 3RT3B 3VAWA 4W9EA 3ZUNA 2FCMA 1C1YB 2BWFA 2J0KA 1WM2A 3MTNB 4GN1A 4K7UA 4FULA 3VTWA 5L95C 3PHXB 1V49A 4FLHA 2BGFA 4TQ0A 5BO4B 2IBIB 2V1YA 2K6QA 4W9IA 1WM3A 2JXXA 4YL8A 3T8MA 2LXAA 5DPRA 3OAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTH A;  1GC6 A;  1XT9 B;  2ASQ A;  3DOW A;  4NAW B;  1H8C A;  4G3X B;  2KMA A;  1RFA A;  3Q3F A;  2JWZ A;  3K9O B;  2N7E A;  3JYU A;  4HJK A;  3U8Z A;  1WMH B;  3N30 A;  3ZNH B;  2B3A A;  4KSK C;  4W9C A;  2LRU A;  1WGR A;  3H1U A;  1WE6 A;  3EC8 A;  3PS6 A;  3HIZ A;  3ECI A;  3QHT A;  2L0F A;  2I1K A;  4GIV A;  3DBH I;  1P1A A;  4B9K A;  3QX1 A;  3NZS A;  1GUA B;  3VQI A;  3C0R B;  3VUY A;  4CO7 A;  1GNU A;  1T0Y A;  2KFK B;  1JRU A;  4MH0 E;  1GC7 A;  2DZK A;  4IM0 A;  2JY6 A;  4JIO U;  5CX3 A;  1EUV B;  1TBE A;  2EMS A;  1WH3 A;  4NAW A;  4IWP A;  4PYZ A;  3ML8 A;  3X0W A;  3ZW3 A;  4E74 A;  4MSM B;  3DBS A;  2LXC A;  4KV2 A;  1I42 A;  1V5T A;  3PRM B;  4ANV A;  4AJW A;  3WAO A;  1YD8 U;  2KVR A;  2ZJD A;  3NS8 A;  1LM8 B;  1OGW A;  4GDL B;  3RCZ A;  4X57 B;  2C5L C;  5JH5 C;  3B1L X;  2CHW A;  2DAJ A;  2LAS A;  2MA9 B;  4WJQ A;  2DZI A;  3ZKJ C;  2DYO A;  2MBH A;  3PLU A;  4KZ0 A;  4LDT D;  5CHW A;  2IY0 B;  4EFO A;  3JSV A;  4HCP B;  4DHZ B;  3O65 B;  2KQS A;  4B95 A;  2D3G A;  2L8J A;  2MW5 A;  2KFK A;  4FAD A;  4W9K A;  5E6O A;  5KHO A;  3KW5 B;  2REX A;  1WX7 A;  2R2O A;  5HKH A;  1V81 A;  2O6V A;  4DWF A;  3ZLZ A;  3U7D A;  1SIF A;  5CHV C;  2KC2 A;  3JVZ X;  2MQJ A;  2ZEQ A;  1LXD A;  4OVU A;  1E90 A;  1I35 A;  2L00 B;  2KJH B;  2NVU I;  2XBB C;  4BBN C;  2G4S A;  2MX2 A;  4LCD E;  2AWT A;  4ZRK A;  1AAR A;  2LGD A;  4DXA B;  4GOC A;  4BKT A;  1L7Y A;  2G45 B;  3NY5 A;  2UYZ B;  3CST A;  2N7D A;  2YVC A;  3PRE A;  3RD2 A;  1EO6 A;  2JRH A;  2GBJ A;  1WZ0 A;  2MWS B;  4ZRJ A;  4BOS C;  2JUO A;  3KH0 A;  4WWP A;  2JRI B;  2ZZP B;  2A4Z A;  3KYD D;  1WXA A;  2K39 A;  4MSQ B;  4ANU A;  4NNJ B;  2BWE S;  5J2R A;  3MHS D;  2CU1 A;  2ZCB A;  4FHK A;  4NJ6 A;  3PHW B;  3L0W B;  4G11 A;  3SU8 X;  4BKS A;  5C23 A;  2DYM A;  4FJV B;  4HDO A;  1V86 A;  3HM3 A;  1WR1 A;  2KQ7 A;  2M0X A;  2HJ8 A;  4XX5 A;  1IYF A;  4TV3 A;  3TJP A;  4EOY A;  4ICV A;  5DPS A;  4NJ7 A;  4NQL B;  3K9P B;  4FJY A;  3WA0 A;  3A9J A;  3DVG Y;  2IO1 B;  3A4R A;  4BOZ B;  1KOT A;  1L2N A;  4BKG A;  1ZKH A;  1EF1 A;  2MBB B;  2FCQ A;  3V6E B;  3NHE B;  3KUZ A;  3AU5 A;  1VD2 A;  2C7H A;  4GXB A;  3CF6 E;  2G3Q B;  4ASW C;  4B6W A;  2BYE A;  4MEM A;  1TTN A;  3DQV A;  1E8W A;  3VUX A;  1V80 A;  2MBO A;  4AOF A;  3ZNI D;  4DBG A;  2KWC A;  4OVV A;  4MDK E;  2FNJ B;  1YJ1 A;  3SHQ A;  4DHJ B;  1OEY J;  1WI0 A;  3M95 A;  4HK2 A;  2MCN B;  1M94 A;  1E7V A;  2EMT A;  3Q3J A;  4PS8 A;  4JLC A;  1WIA A;  1R4N I;  4J6I A;  5GMV A;  3LDZ E;  5AZG A;  5G2N A;  4KDI C;  2KLC A;  2KZR A;  4E3C A;  1TGZ B;  5AZF A;  2C7N B;  4W9G A;  3OJ3 A;  1MG8 A;  4FN2 A;  4KSL C;  2GBR A;  2UWQ A;  3H7P B;  5E6P A;  3RYT A;  3UQA A;  4LJP B;  3IHP C;  3IVF A;  3SDL C;  2GBM A;  2XK5 A;  2LD9 A;  1R4M I;  2KWU B;  2D11 A;  1Q1O A;  2L76 A;  4MGY E;  3KUD B;  4K7S A;  4NY0 A;  2ZVO A;  4XC2 A;  1J19 A;  4NPN A;  2G4D B;  2KX0 A;  3WAM A;  1P0R A;  3IG3 A;  2C9W B;  3EFU A;  2FCN A;  3ENE A;  2GBN A;  2LJ5 A;  4HWI B;  4TQ1 A;  1G6J A;  3ML9 A;  2NBU A;  1S3S G;  2RPQ A;  4PS3 A;  2N9P C;  3CSF A;  3VTV A;  2KX3 A;  4DDI D;  4F8C B;  2AYO B;  4URK A;  1WGH A;  3I3T B;  2HE7 A;  2ZVN A;  4WAA A;  2NBW B;  3VH4 B;  3PGE A;  3QQ8 B;  5JZE B;  5D7G A;  3QCA A;  1WMH A;  3ZNZ B;  2KJ6 A;  2KJR A;  3UIN B;  2O6V D;  4HDQ A;  3ZIM A;  1ZW7 A;  3VFK A;  4W9D A;  4ANW A;  3ZTC A;  4W9F A;  3ZRC A;  3QC8 B;  4HPM B;  1NI2 A;  2KOX A;  3RZW C;  2AEH A;  3N3K B;  4CHK A;  1UH6 A;  4IC7 B;  3HK0 A;  2DEN B;  4IM2 A;  2D10 A;  2FAZ A;  2MP2 B;  4WQO B;  2LVO A;  3UIO B;  2HD5 B;  3APC A;  4P7I A;  4FBJ B;  2K8H A;  1E8Z A;  2AL3 A;  3IBE A;  3R7R A;  3V62 A;  1KJT A;  3V61 A;  1SE9 A;  3RUI B;  1V5O A;  3DDC B;  1OTR B;  2RD0 A;  4I6N B;  4JL9 A;  2KDB A;  3M63 B;  2L05 A;  4ZRI A;  1E7U A;  2QHO A;  4LDT B;  3BIN A;  2NCN A;  3RUL A;  4MJS B;  4II2 B;  4GDL A;  4KIK B;  4F1S A;  3KUC B;  5JHB A;  1KLV A;  5E6N A;  2LGX A;  1WYW B;  2K6D B;  2LRW A;  4GMV A;  3R66 C;  3ALB A;  4WWN A;  4ZDV A;  3PSE B;  5C1Z A;  3HHM A;  1WX8 A;  2KK8 A;  2K8C A;  4DHZ E;  3ZO5 B;  1YX5 B;  3WAP A;  5EDS A;  2W9N A;  2JPH A;  1UGM A;  1KM7 A;  5AEK B;  1WZ3 A;  4JGH B;  1GJZ A;  3UGB B;  2BKF A;  2IY1 B;  2J0M A;  3PV1 A;  3OLM D;  3P2B A;  4EUT A;  4M8M A;  2M1M A;  2WWZ A;  1XD3 B;  2PE6 B;  2IZV B;  1WF9 A;  2MLB A;  4IW0 A;  3VDZ A;  2BYV E;  2LGY A;  3A1Q B;  3ZDM C;  2MRP A;  4W9L A;  2L7R A;  2M8S A;  3QAR A;  3AUL A;  1RAX A;  4RM9 A;  2KC1 A;  3TCA A;  1WX9 A;  3QK0 A;  4K7W A;  3L16 A;  4LJO B;  3PT2 B;  2CHX A;  4EZK A;  2FUH B;  3VTU A;  1F9J A;  1WJN A;  4TKN A;  3HM6 X;  2D2Q A;  3R7Q A;  4ICU A;  2DHZ A;  4W9H A;  2K8B A;  3SD5 A;  2NBV B;  2AL6 A;  3WAN A;  2BF8 B;  2MSE D;  2WX1 A;  1BT0 A;  2O2V B;  3NOB A;  2VRR B;  2IO2 B;  1WGG A;  2KTR B;  5D2M B;  2L3Z A;  4MEL A;  3UF8 A;  3EHV A;  4GB9 A;  3TIX A;  2KTF A;  2V3S A;  4MGI E;  3N32 A;  2J7Q B;  2NPT B;  5DPW A;  4M0W B;  3L54 A;  3GZN I;  1LFD A;  3WAL A;  3VUW A;  4MGZ E;  4G0N B;  3V6C B;  4WJP A;  1E8X A;  2DX5 B;  3PTF C;  2BPS A;  1WJU A;  2N1W A;  3QA8 A;  5DPT A;  3V60 A;  4FHJ A;  2KWV B;  3M62 B;  4ANX A;  2Z0D B;  2ZPN A;  4AP4 C;  4IG7 B;  4BVU C;  5JHA A;  1C3T A;  3D32 A;  3DBL I;  2OOB B;  4GSW A;  1WRD B;  5KHQ A;  3UIP B;  2XEW A;  1IP9 A;  1XQQ A;  1Q5W B;  4AUQ C;  3VHT C;  2KLG A;  4G50 A;  3OJ4 B;  5CTR C;  3VXW A;  4WWO A;  2JVC A;  3CMM B;  2LVQ A;  2CKH B;  4I6P A;  2J0J A;  2CS4 A;  2NR2 A;  3L10 B;  1EF5 A;  2NPT A;  1CMX B;  2GBK A;  3BY4 B;  2K1F A;  4HCN B;  4EEW A;  1GG3 A;  2C7M B;  2L0T A;  2BYF A;  2WDT B;  2KDE B;  1E8Y A;  4K81 A;  1YIW A;  2LZ6 A;  2BKR B;  4RM8 A;  5D6J B;  1WE7 A;  2D07 B;  2MBQ A;  3AXC A;  2M4N A;  2A5U A;  2KD0 A;  4AWJ A;  3H7P A;  2DZJ A;  3TMP B;  1WGY A;  3VH3 B;  3KVF B;  3PLV A;  3PRZ A;  4AJY B;  3RZF A;  5J18 A;  1D3Z A;  2IYD B;  2KNB A;  1OEY A;  4CYE A;  2PEA A;  3DVN U;  3AU4 A;  3JW0 X;  2EKE C;  3U30 A;  2IO3 B;  3DVN V;  2N4F A;  4BFR A;  1ISN A;  1VCB A;  5TR5 A;  4GDK B;  2CR5 A;  2M17 A;  1UZX B;  4K1R B;  4EKU A;  3H9D A;  3JSV B;  1S1Q B;  4IWQ A;  2NS5 A;  1U4A A;  1WY8 A;  2KDF B;  2RR9 A;  4A3P A;  5AZH A;  2LUE A;  2KXJ A;  3X23 A;  1X1M A;  4GGQ A;  2JZ3 B;  3GOE A;  3IFW B;  5DCN A;  2ZPY A;  2ZCC A;  2FIF A;  1QZE A;  2O6V B;  2OJR A;  4IUM B;  3ZRF A;  5LLI A;  4IM3 A;  1UD7 A;  3ZVV A;  5L83 A;  3TBL D;  2N9X A;  2YLM A;  2ZNV B;  2JF5 A;  3QIJ A;  4ZYN A;  2KDI A;  4KDL B;  1NBF C;  3A4S C;  4F7Z A;  1V2Y A;  2ZNV C;  3APD A;  5LXH A;  4GDK A;  5LXI B;  3NZU A;  1H4R A;  3TL5 A;  1UBQ A;  4BKS D;  3M3J A;  1Y8R C;  1J0G A;  4FA6 A;  3WIM A;  3QAQ A;  3QJZ A;  4PS7 A;  1UBI A;  1Z2M A;  1E5W A;  1SGH A;  4MM3 A;  2MP2 A;  1FXT B;  3PPA A;  4NQK E;  4WJN A;  4XZ4 A;  4BBN F;  3DVG X;  1LQB A;  4A3O A;  1YQB A;  1WXV A;  2KO3 A;  2KKC A;  1WFY A;  3QWZ B;  2WX0 A;  2FID A;  3A9K B;  4W9J A;  2DAF A;  1WGD A;  1IPG A;  1J8C A;  2LI5 A;  3B08 A;  4MJS A;  5G55 A;  1P3Q U;  4KIK A;  1P98 A;  4KVG B;  4HVB A;  5IA7 A;  2DZM A;  3AI5 A;  2V4L A;  3ONS A;  3ZTD A;  3W1Y A;  3A9J B;  3LJ3 A;  4HPL B;  1Q0W B;  2PPH A;  1P9D U;  3L08 A;  3MJW A;  2I1J A;  4E71 A;  3PVL A;  3PZD A;  4MGK E;  3DCG A;  5J17 A;  4A20 A;  2Z0E B;  4M8N A;  4EZJ A;  2KMC A;  2KHW B;  4TUU A;  2KAN A;  1RLF A;  2RSU A;  2LVP A;  3UQB A;  2KFJ A;  3PRP B;  2Z59 B;  2N1V A;  3DPD A;  1V9J A;  1YX6 B;  4IWO A;  1WXM A;  3APF A;  2PE9 A;  3A9K A;  2JT4 B;  4RMA A;  4JQW C;  4HXD A;  1RRB A;  2MBE A;  4HLE A;  2WYQ A;  1TZ1 A;  1WXS A;  1WR6 E;  4N9F 4;  2IO0 B;  3A1Q A;  1A5R A;  2N9E B;  1WJ4 A;  1K8R B;  2FCS A;  4PYU A;  3W1S C;  2Y5B B;  3H7S A;  3H6N A;  3R3M A;  2K25 A;  4GU2 A;  4II3 B;  3A33 B;  1V6E A;  5FR6 A;  3ZNG C;  4DHJ D;  2JZZ A;  1ZGU B;  2KN5 A;  3KYC D;  4I6L B;  4KZC A;  3ZDT A;  3VVW B;  3DBR I;  2CHZ A;  5D94 A;  2DYB A;  5IAA C;  4DK5 A;  4WJO A;  1OQY A;  1WJ6 A;  3T9L A;  4EZL A;  3EEC A;  3S2A A;  4DDG D;  2R2Q A;  1Z5S B;  2C60 A;  4FJZ A;  2XK5 B;  3L13 A;  2PJH A;  1PQS A;  2RGF A;  3L17 A;  3W1S A;  2O2V A;  1UEL A;  1HE8 A;  3B0A A;  2GOW A;  2GMI C;  2LWP A;  1NDD A;  2KTR A;  5CHF A;  3RT3 B;  3VAW A;  4W9E A;  3ZUN A;  2FCM A;  1C1Y B;  2BWF A;  2J0K A;  1WM2 A;  3MTN B;  4GN1 A;  4K7U A;  4FUL A;  3VTW A;  5L95 C;  3PHX B;  1V49 A;  4FLH A;  2BGF A;  4TQ0 A;  5BO4 B;  2IBI B;  2V1Y A;  2K6Q A;  4W9I A;  1WM3 A;  2JXX A;  4YL8 A;  3T8M A;  2LXA A;  5DPR A;  3OAW A; 
#chains in the Genus database with same CATH topology
 2HTH A;  1GC6 A;  2ASQ A;  4NAW B;  2KMA A;  2N7E A;  3N30 A;  4AQ7 A;  2L83 A;  3H1U A;  3MP9 A;  2NMQ A;  1YJJ A;  3PS6 A;  1HXY D;  2WQY B;  4NJC A;  1DOI A;  2I1K A;  1P1A A;  3E9S A;  1WSP A;  4PK1 A;  1T0Y A;  4DHZ B;  1EUV B;  3EUB 2;  4E74 A;  3ML8 A;  2QCZ A;  4MSM B;  2LXC A;  4KV2 A;  1V5T A;  4AJW A;  1PDX A;  4GDL B;  1KFY B;  3B1L X;  2CHW A;  2MA9 B;  4YTP B;  3ZKJ C;  2J4X A;  3PLU A;  2IY0 B;  1HA5 A;  4ZRQ A;  2KFK A;  3O13 A;  4W9K A;  2VZK D;  5E6O A;  5KHO A;  2O6V A;  1SIF A;  3SEB A;  1C4C A;  5CHV C;  1KLG D;  2MQJ A;  1E90 A;  1I35 A;  1Y56 A;  2KDM A;  2LGD A;  2XNA C;  2G45 B;  2UYZ B;  2N7D A;  4A8X C;  3RD2 A;  1EO6 A;  1FFV A;  4BOS C;  3KH0 A;  4DXF A;  2D3B A;  1JW9 D;  2V3P A;  3BYT B;  1WXA A;  2BWE S;  3MHS D;  2CU1 A;  4NJ6 A;  3PHW B;  3L0W B;  2LUM A;  5C23 A;  1ET6 A;  1XCQ L;  1WR1 A;  5AUK A;  2HJ8 A;  4NJ7 A;  4NQL B;  3K9P B;  4FJY A;  3A9J A;  3DVG Y;  2IO1 B;  3A4R A;  4BOZ B;  2BS3 B;  4BKG A;  1ZKH A;  2MBB B;  1SIJ A;  3KUZ A;  3AU5 A;  5BMG A;  2BYE A;  2N9L A;  1E8W A;  1J7C A;  1SEB D;  1V80 A;  2MBO A;  3ZNI D;  4HRS A;  2AQ3 B;  4DHJ B;  1OEY J;  1WI0 A;  3M95 A;  4HK2 A;  2MCN B;  1E7V A;  2JX5 A;  3RNA C;  2ZW1 A;  4KGR A;  3N1Y C;  4IKG A;  1FO4 A;  4DQO C;  4E3C A;  2C7N B;  4FN2 A;  2GBR A;  3IHP C;  1F77 A;  3NJT A;  3NG0 A;  2FE8 A;  2OED A;  3AEC B;  3KUD B;  4OZC A;  4LNK A;  2KX0 A;  3WAM A;  4ZYS A;  1HTO A;  3ML9 A;  4LNN A;  2KX3 A;  4URK A;  1WGH A;  2ZVN A;  2DLB A;  5FR3 A;  4ITK A;  3QCA A;  2NTT A;  2O6V D;  3AE2 B;  4KKJ A;  1E6E B;  3QC8 B;  1OQQ A;  2LMC A;  1UWM A;  3E56 A;  3HK0 A;  4IM2 A;  2D10 A;  1QQR A;  1FNV A;  2LVO A;  1VZ7 A;  2HD5 B;  5BYQ A;  1WRI A;  1SE9 A;  4YSX B;  1V5O A;  4ZRI A;  1J7B A;  3R2T A;  4MJS B;  4GDL A;  4F1S A;  3KUC B;  3TEY A;  2LGX A;  2K6D B;  2WXG A;  1STE A;  3AE7 B;  4WWN A;  5C1Z A;  1LO5 D;  3ZO5 B;  3WAP A;  2JPH A;  1KM7 A;  1YN5 A;  4JGH B;  1QLB B;  3DWG C;  2IJ0 A;  2IND C;  4IW0 A;  1WF9 A;  3QAR A;  1RAX A;  1WX9 A;  3QK0 A;  1QIL A;  4LJO B;  2BYT A;  4EZK A;  3VTU A;  1WJN A;  3KWL A;  3NUH B;  3HM6 X;  4GLS C;  3R7Q A;  2K8B A;  2NBV B;  2AL6 A;  3WAN A;  2MSE D;  2QEJ C;  1BT0 A;  1HZ5 A;  3U4E G;  4LK0 M;  2V3S A;  2TSS A;  1LFD A;  3VUW A;  2VH1 A;  2I38 A;  3V6C B;  2HJ1 A;  2IGD A;  1WJU A;  2BS2 B;  1C3T A;  3I63 C;  1ZP0 B;  2QIL A;  1WRD B;  3UIP B;  2WXH A;  2DBY A;  3VHT C;  4US8 A;  2JVC A;  4L1B A;  1DOY A;  1CMX B;  3TSS A;  1YMH E;  2WDT B;  1SBB B;  1CZP A;  4OVZ A;  5D6J B;  1ROE A;  2D07 B;  3AXC A;  2KD0 A;  2INP E;  2DZJ A;  3TMP B;  5BMH A;  3KVF B;  3PLV A;  5J18 A;  3T3N A;  2J52 A;  1D3Z A;  2PEA A;  3ZJT A;  3DVN U;  1FPY A;  1L0Y B;  3DWM A;  3DVN V;  4BFR A;  4GDK B;  1C77 A;  2CR5 A;  2D5G A;  5IKC M;  3TEX A;  1S1Q B;  2RR9 A;  5AZH A;  1X1M A;  2JZ3 B;  1OFF A;  5DCN A;  2K9X A;  2ZCC A;  1UF0 A;  1QZE A;  2N0S B;  3P63 A;  5LLI A;  2QSD A;  1UD7 A;  2YLM A;  4ZYN A;  2KDI A;  4KDL B;  3PZ8 A;  1E0Z A;  1K50 A;  1J0G A;  2PIA A;  3QJZ A;  4JE3 B;  1UBI A;  3AEG B;  1E5W A;  1XLQ A;  1DOX A;  1LQB A;  2KO3 A;  2LJI A;  2Y3A A;  2WX0 A;  1WGD A;  5FKA C;  4MAC A;  2GLS A;  2GRI A;  2LI5 A;  1P7F A;  4MJS A;  5G55 A;  1P3Q U;  5IA7 A;  4N59 A;  3W1Y A;  4HPL B;  3LJ3 A;  1T3Q A;  5J17 A;  3W5U B;  2D3C A;  2KAN A;  2RSU A;  3PRP B;  2H89 B;  2Z59 B;  3DPD A;  4IWO A;  1WXM A;  2MBE A;  1N5X A;  1TZ1 A;  1WR6 E;  3H8H A;  2N9E B;  2WXL A;  3R3M A;  1GB4 A;  5FR6 A;  2QMT A;  3VR8 B;  3ZNG C;  4DHJ D;  2JZZ A;  3KYC D;  1QT9 A;  3VVW B;  1ZXH A;  1TS4 A;  5D94 A;  3T9L A;  3S2A A;  4DDG D;  2INC C;  1PGA A;  4FJZ A;  2R61 A;  2MH7 A;  2PJH A;  1PQS A;  3L17 A;  3W1S A;  1HE8 A;  3B0A A;  4N6E B;  1RYJ A;  1EWC A;  2FCM A;  1WM2 A;  3AB5 A;  1MHX A;  3VTW A;  2J53 A;  1V49 A;  4TQ0 A;  5BO4 B;  3TUO A;  1SE3 A;  2K6Q A;  1WM3 A;  1SJE D;  2BQQ A;  1ZPS A;  1QKZ A;  1XT9 B;  2PTL A;  4D2K A;  5D3I B;  2KWD A;  4G3X B;  4NAM A;  2JWZ A;  3U8Z A;  3VRA B;  2LRU A;  1WGR A;  2WS3 B;  3EC8 A;  4P1C C;  3HIZ A;  4LLG M;  3T3O A;  1N5W A;  3LYY A;  4ZOH C;  4B9K A;  3QX1 A;  3VQI A;  4CO7 A;  1GNU A;  2KFK B;  1IUE A;  2JY6 A;  3U52 E;  1WH3 A;  3X0W A;  4IDI A;  4ANV A;  1YD8 U;  2KVR A;  3NS8 A;  1LM8 B;  4X57 B;  2C5L C;  1YNT E;  2DAJ A;  2DZI A;  1F0Z A;  2N9K A;  2YEP F;  2LFI A;  3O65 B;  2D3G A;  2L8J A;  2MW5 A;  2PW9 A;  3N9Y C;  4FAD A;  3ZYY X;  5HKH A;  1V81 A;  4DWF A;  3C19 A;  2IPK D;  1KF6 B;  3P4Q B;  1BXT A;  1E10 A;  1ZE3 D;  2KJH B;  2XBB C;  2G4S A;  4ZRK A;  1D4B A;  2QIE B;  4DXA B;  1TKE A;  3NVZ A;  1NYQ A;  3B2F A;  2YVC A;  3PRE A;  2M56 B;  1WZ0 A;  2MWS B;  4XDC A;  5EE1 A;  4BAX A;  2JRI B;  4WAF A;  4NNJ B;  4FHK A;  4G11 A;  1MI0 A;  5C3J B;  2DYM A;  4HDO A;  4XX5 A;  1NI3 A;  1K51 A;  4TV3 A;  4NZL B;  4EOY A;  1EWY C;  3WA0 A;  1FIQ A;  3RNF C;  3NHE B;  2C7H A;  3NZ3 A;  2G3Q B;  4ASW C;  5JXV A;  4MEM A;  2M0A A;  3VUX A;  3UI3 A;  2EKI A;  2JZP A;  4O1N A;  4JLC A;  1WIA A;  4J6I A;  3LDZ E;  5G2N A;  2KZR A;  3TEW A;  1MG8 A;  1IBX B;  1L0X B;  2UWQ A;  3H7P B;  3ZJU A;  3UQA A;  1D6E C;  4LJP B;  1PYW D;  4N58 A;  3GB1 A;  4FXC A;  1I4H A;  2ZVO A;  3VR9 B;  3DHG C;  4XC2 A;  5I4D A;  2INN E;  5LNK 1;  1V1P B;  3IG3 A;  3RFZ B;  3EFU A;  3Q3M C;  3ENE A;  4ARI A;  2V3N A;  2NBU A;  4H2A A;  2RPQ A;  4PS3 A;  5HFY A;  2V4I B;  2HE7 A;  4RGO S;  2WXR A;  2WXF A;  4AS1 A;  4C7Y A;  4KGT A;  1D5X C;  3VRB B;  1L6V A;  2MEK A;  2Z8L A;  3Q8C A;  3VFK A;  4P1B C;  3LB8 C;  3RZW C;  1GPX A;  1KRH A;  4MM3 B;  1L6U A;  3UIO B;  3BVG A;  3V61 A;  4JL9 A;  2RD0 A;  3MHZ A;  2L05 A;  1E7U A;  3BIN A;  2NCN A;  1E7P B;  4XYC A;  5JHB A;  4GMV A;  3R66 C;  3PSE B;  1WX8 A;  2K8C A;  3MJ5 A;  2EEL A;  2DWQ A;  4WWM A;  3UGB B;  2BKF A;  2IY1 B;  2JQR B;  2PMV A;  2KAJ A;  3P2B A;  2WXK A;  4M8M A;  1XD3 B;  2IZV B;  2MLB A;  3VDZ A;  3A1Q B;  2QDF A;  3ZGZ A;  1C76 A;  1AWD A;  2L7R A;  1SF0 A;  1D5M C;  4YSY B;  4K7W A;  2WP9 B;  4TKN A;  1A70 A;  1MHH E;  4ICU A;  4RFB A;  2DHZ A;  1UGJ A;  4ZHO A;  2M19 A;  2BBC A;  2BF8 B;  5HHD G;  2ICI A;  3AE1 B;  2O2V B;  3NOB A;  2AQ2 B;  2MJD A;  2IO2 B;  1MJD A;  2L3Z A;  3TIX A;  3N32 A;  4WUR A;  2J7Q B;  4KGS A;  4USA A;  4WJP A;  1E8X A;  2BPS A;  5MPO A;  3QA8 A;  1L5P A;  3D32 A;  3OWE B;  1PGB A;  4GSW A;  2H88 B;  2AQ1 B;  4AUQ C;  2KLG A;  2W82 A;  3Q6B A;  1HTQ A;  2LVQ A;  4I6P A;  2J0J A;  2CS4 A;  3RI7 C;  3L10 B;  2KT7 A;  3Q8B A;  2GBK A;  1D5Z C;  1C79 A;  2C7M B;  2L0T A;  4LNI A;  1E8Y A;  4K81 A;  2G1E A;  1IBX A;  2A5U A;  3ZXV A;  3RNB C;  3H7P A;  2QC8 A;  3VH3 B;  2UU7 A;  3GS2 A;  3AED B;  2KNB A;  1OEY A;  1RM6 C;  1QOF A;  3JW0 X;  2IO3 B;  2K0P A;  1GAQ B;  1ISN A;  1VCB A;  2JXT A;  5TR5 A;  5GXG B;  2RDG A;  4S17 A;  3SFE B;  1WY8 A;  1ZUD 2;  1V1P A;  1UWX A;  2LUE A;  2KXJ A;  3X23 A;  3DHH C;  1TJE A;  2ZPY A;  4ZHP A;  2FIF A;  3FKY A;  4IUM B;  4IM3 A;  3RNE C;  2ZNV B;  1I4P A;  3QIJ A;  3NVW A;  1NBF C;  2IGG A;  3BK2 A;  5LXH A;  3APD A;  5IN7 A;  5LXI B;  2GB1 A;  3M3J A;  4FA6 A;  4RNA A;  1ESF A;  5E6J A;  5G5H A;  5IOI A;  4MM3 A;  5HI1 A;  1HEZ E;  4NQK E;  4XZ4 A;  3AM9 A;  1L4Z B;  3NVV A;  2KKC A;  2ON8 A;  3QWZ B;  2FID A;  1AN8 A;  3AH7 A;  2Y5C A;  1IPG A;  3AI5 A;  2V4L A;  3ZTD A;  3P4R B;  2PPH A;  1P9D U;  2I1J A;  4MGK E;  3PZD A;  5BYR A;  2Z0E B;  2KMC A;  1RLF A;  1B9R A;  2LVP A;  1V9J A;  2K3U A;  4WIP A;  2ACZ B;  4RMA A;  3A9K A;  4JQW C;  4RGT A;  3I57 A;  4HLE A;  2WYQ A;  2KYW A;  2IO0 B;  3A1Q A;  1OQR A;  3H7S A;  4II3 B;  1WGK A;  4I6L B;  1ZGU B;  1FRD A;  3RNG C;  4RH6 A;  2AX5 A;  4S0R A;  3EEC A;  2R2Q A;  1Z5S B;  2C60 A;  1SJH D;  3AEF B;  2XK5 B;  2OJW A;  3L13 A;  2CU3 A;  2O2V A;  1UEL A;  1XF5 L;  5CHF A;  1NYR A;  3VAW A;  4WH4 A;  3ZUN A;  4GN1 A;  4K7U A;  2K22 A;  2X8X X;  1T0Q C;  5L95 C;  3FC4 A;  2BGF A;  4UDU C;  1BUI C;  2LXA A;  2MJ3 A;  2JSV X;  3DOW A;  2WXM A;  3Q3F A;  5BYS A;  3K9O B;  4A90 A;  3ZNH B;  3AV8 A;  4KSK C;  1QOB A;  4W9C A;  1WE6 A;  4ACF A;  2RPV A;  2W55 A;  1MG4 A;  3AE8 B;  3ECI A;  2L52 A;  1WYG A;  4RCO A;  1GUA B;  3VUY A;  1E9M A;  2RMM A;  4MH0 E;  1GC7 A;  2DZK A;  4IM0 A;  4JIO U;  5CX3 A;  1TBE A;  2EMS A;  3ZW3 A;  4IWP A;  3DBS A;  2VH2 A;  2WXN A;  3BVM A;  3PRM B;  5BMI A;  1HQR D;  3EFC A;  3NRZ A;  5JH5 C;  5EE0 A;  2LAS A;  1JML A;  2MBH A;  3HVZ A;  1XEE A;  4KZ0 A;  4HCP B;  1JWU D;  1FNU A;  3HRD D;  2REX A;  2R2O A;  3Q3O C;  2PVO D;  3ZLZ A;  1K52 A;  2KC2 A;  2D3A A;  4MT5 A;  1JCK B;  3JVZ X;  2ZEQ A;  4OVU A;  1JRP A;  2MX2 A;  2AWT A;  1AAR A;  1MFW A;  1FXA A;  1V8C A;  4KX6 B;  1L7Y A;  3NY5 A;  3CST A;  3V3X A;  2JRH A;  2GBJ A;  4ZRJ A;  2JUO A;  1WWT A;  4L23 A;  2HDE A;  3KLS X;  4MSQ B;  4ANU A;  5J2R A;  2ZCB A;  2KN4 A;  1R4N B;  2QJL A;  3SU8 X;  2IGH A;  4BKS A;  3U7Z A;  3I5J C;  2KQ7 A;  3BVZ A;  2WHI A;  4ICV A;  1MVK A;  5DPS A;  2RDH A;  2W3S A;  2KMM A;  3AE9 B;  1FCC C;  1ZDV A;  1I4Q A;  3V6E B;  1F1H A;  1VD2 A;  1R4M B;  3CF6 E;  2LHD A;  2G9H D;  1TTN A;  2BW2 A;  2KWC A;  4IOI E;  1YJ1 A;  3LXF A;  1M94 A;  3Q3J A;  4XE0 A;  2Q5W D;  1R4N I;  5GMV A;  3AN1 A;  1ENF A;  2KLC A;  1TGZ B;  4W9G A;  2BVC A;  3OJ3 A;  3ZQ4 A;  1QF6 A;  4KSL C;  1QOG A;  3RYT A;  1EU4 A;  4MH8 A;  1UNS A;  2GBM A;  2XK5 A;  3ETR A;  1R4M I;  2L76 A;  4MGY E;  4K7S A;  4BZA A;  2L1A A;  2RDB C;  1J19 A;  3IT6 B;  4NPN A;  1L4D B;  2G4D B;  4OHJ A;  5T8I A;  2SAK A;  3IAS 1;  4XWT A;  1ZXI A;  2FCN A;  4HJG E;  4HWI B;  4TQ1 A;  1S3S G;  2N9P C;  4F8C B;  2AYO B;  3Q8E A;  3BII D;  4WAA A;  2NBW B;  1C4A A;  1TIF A;  2WXP A;  3PGE A;  5D7G A;  3ZXR A;  3U2S C;  3KQ4 A;  3ZNZ B;  2KJR A;  3UIN B;  1RFK A;  1EU3 A;  4W9D A;  4ANW A;  3ZTC A;  3ZRC A;  3CWI A;  1NI2 A;  2KOX A;  4CHK A;  1I4R A;  1UH6 A;  2MP2 B;  4P7I A;  4FBJ B;  1E8Z A;  3R7R A;  1KJT A;  1Q10 A;  2KQ4 X;  1GB1 A;  3CIR B;  4I6N B;  3M63 B;  2QHO A;  2KVZ A;  4LDT B;  1TKY A;  4KIK B;  5E6N A;  1WYW B;  2WXJ A;  3P1M A;  4WQM A;  4LTU A;  4RF1 A;  4JWS C;  4DHZ E;  5EDS A;  2W9N A;  1GJZ A;  4YTN B;  2IDY A;  1PUT A;  1F52 A;  2M1M A;  2LGY A;  1L0V B;  1I7H A;  3ZDM C;  2MRP A;  4W9L A;  3DBL B;  2E3T A;  2KC1 A;  4C4V B;  2BT6 A;  3EA6 A;  2FUH B;  1F9J A;  4LNF A;  4W9H A;  3SD5 A;  3BYY B;  1K53 A;  1XO3 A;  2WX1 A;  1WGG A;  3IT4 B;  3UF8 A;  3GE8 C;  2V0G A;  1KTK A;  3Q2A C;  3SFD B;  4MGZ E;  4G0N B;  5H8Y E;  1SE4 A;  2DX5 B;  1N60 A;  3V60 A;  2N1W A;  4FHJ A;  2KWV B;  3AE3 B;  4ANX A;  4BVU C;  2LGS A;  4OZA A;  3DBL I;  1N63 A;  1FMA D;  2XEW A;  1XQQ A;  1TY2 A;  4G50 A;  3VXW A;  2GI9 A;  4WWO A;  2WXI A;  2NR2 A;  4PT5 A;  2NPT A;  3MC9 A;  4M0W A;  3BY4 B;  4HCN B;  3AEA B;  4XDD A;  2KDE B;  2LZ6 A;  2BB6 A;  1FD6 A;  1XCT L;  2MBQ A;  4K3B A;  4AWJ A;  1FXI A;  1N6Z A;  2WXQ A;  4J3O D;  5EE3 A;  3U30 A;  4A9A A;  2FBW B;  3I9V 1;  4B0M A;  1TS5 A;  2M17 A;  4K1R B;  3JSV B;  4IWQ A;  3URY A;  1U4A A;  2KDF B;  5AUI A;  3RNC C;  3GE3 C;  4GGQ A;  3Q14 C;  3GOE A;  3IFW B;  2JU6 X;  1SB3 C;  1ZDX A;  3ZVV A;  2W54 A;  3TBL D;  3C8Y A;  3FIL A;  3P42 A;  4LNO A;  1TT5 B;  3AE5 B;  3A4S C;  4F7Z A;  2BB5 A;  1V2Y A;  3NZU A;  1UBQ A;  2L32 A;  1Y8R C;  4A6Q A;  4PS7 A;  1Z2M A;  2MP2 A;  1FXT B;  4BBN F;  1XLN A;  3DVG X;  4A3O A;  1YQB A;  1WXV A;  1QOA A;  2XN9 C;  1J7A A;  3A9K B;  4W9J A;  2DAF A;  1CK1 A;  2W3R A;  2X38 A;  1J8C A;  3WCQ A;  2OHF A;  3B08 A;  1JWS D;  4KIK A;  1P98 A;  4YXD B;  4KVG B;  4HVB A;  2JWU A;  1Q0W B;  3MJW A;  4E71 A;  3ABV B;  3PVL A;  3MFG A;  3DCG A;  4A20 A;  4EZJ A;  2KHW B;  3Q3N C;  3UQB A;  2KFJ A;  1VR9 A;  1B1Z A;  4C7Z A;  3AEB B;  3R2I A;  1YX6 B;  4DXG A;  2PE9 A;  2JT4 B;  2LGI A;  4HXD A;  4N9F 4;  1WJ4 A;  1K8R B;  2Y5B B;  1YN4 A;  4K3C A;  2K25 A;  3P4S B;  3A33 B;  4JWU C;  4KZC A;  1XXG A;  4C4V A;  2CJN A;  2ZW0 A;  4WJO A;  1OQY A;  1WJ6 A;  4EZL A;  3TEZ A;  4YSZ B;  1NVI D;  2GOW A;  1NDD A;  2WNM A;  3RT3 B;  3DBH B;  3MTN B;  4FLH A;  1YN3 A;  2V1Y A;  4REZ A;  1JRO A;  2WDQ B;  4W9I A;  4YL8 A;  4L2Y A;  2SEB D;  1JWB D;  4PYZ A;  5E6P A;  3RPF C;  3T8M A;  1I42 A;  1PFD A;  3L4P A;  3BK1 A;  1FEH A;  1H8C A;  1RFA A;  1T0R C;  2PVG C;  4HJK A;  3JYU A;  1WMH B;  2JYT A;  3OG5 A;  2B3A A;  1TYG B;  1N62 A;  1TS2 A;  4C80 A;  4OW0 A;  3MC8 A;  3QHT A;  2L0F A;  4GIV A;  3DBH I;  3NZS A;  4XGA B;  3C0R B;  1JRU A;  1FRR A;  4NAW A;  3NVY A;  3MC0 B;  3WAO A;  2ZJD A;  3Q69 A;  3Q8A A;  1OGW A;  3RCZ A;  4P6V F;  4WJQ A;  3AE6 B;  2DYO A;  5FK9 C;  4LDT D;  5CHW A;  4EFO A;  3JSV A;  3J9C A;  1EM7 A;  1F2R C;  2KQS A;  4B95 A;  1T0S C;  3BWU D;  2V9H A;  1FCL A;  2WGS A;  1XLO A;  3KW5 B;  5EE9 A;  1WX7 A;  1R7S A;  4B0E A;  2I2Y A;  3U7D A;  3BZD B;  3DHI C;  1LXD A;  1VJK A;  2L00 B;  2NVU I;  4BBN C;  2BTE A;  4LCD E;  1TZO A;  1TKG A;  4YT0 B;  4KKI A;  1VLB A;  4GOC A;  4BKT A;  4M02 A;  4C00 A;  3ZJV A;  5IP4 D;  4WWP A;  3AEE B;  2ZZP B;  2A4Z A;  3KYD D;  3N1X C;  1C4P A;  2K39 A;  4EE2 A;  4OZB A;  3V05 A;  1C9F A;  4C56 C;  3B2G A;  1HZ6 A;  4FJV B;  1SSN A;  1V86 A;  3HM3 A;  2M0X A;  1YQ4 B;  2WXO A;  1IYF A;  3TJP A;  1FNW A;  1KOT A;  1L2N A;  1EF1 A;  2FCQ A;  1JWA D;  4GXB A;  2KAC A;  4B6W A;  1FFU A;  1DYQ A;  3DQV A;  4AOF A;  4DBG A;  4OVV A;  4MDK E;  2FNJ B;  3SHQ A;  2DNF A;  2EMT A;  1JQ4 A;  4PS8 A;  5AZG A;  4KDI C;  5AZF A;  2J42 A;  1JWM D;  4M00 A;  3FAH A;  3HUI A;  4A55 A;  3IVF A;  4RGM A;  3SDL C;  1UUP A;  1P7E A;  2LD9 A;  2KWU B;  2D11 A;  1Q1O A;  4NY0 A;  1BML C;  1I4G A;  3Q8F A;  1P0R A;  2C9W B;  3AE4 B;  2GBN A;  2LJ5 A;  1G6J A;  2WDV B;  3CSF A;  3VTV A;  4DDI D;  3I3T B;  2LHE A;  3VH4 B;  1TY0 A;  2WU2 B;  3QQ8 B;  5JZE B;  1WMH A;  2KJ6 A;  4HDQ A;  3ZIM A;  1V97 A;  1ZW7 A;  4W9F A;  2WDR B;  4ARC A;  4R3D A;  4HPM B;  2AEH A;  3N3K B;  4IC7 B;  2DEN B;  2FAZ A;  2MJE A;  4WQO B;  3APC A;  2YEP B;  2K8H A;  3V62 A;  2AL3 A;  3IBE A;  5HG2 A;  1ACC A;  1TS3 A;  3RUI B;  3DDC B;  1OTR B;  2KDB A;  4CQN A;  3RUL A;  4II2 B;  3P4P B;  4TSS A;  1KLV A;  2LRW A;  3ALB A;  4ZDV A;  1PGX A;  3HHM A;  2KK8 A;  1WXQ A;  2LEK A;  2VZK B;  1YX5 B;  2JYE A;  1UGM A;  4Q2J A;  5AEK B;  1WZ3 A;  2J0M A;  3PV1 A;  1ZOY B;  2WLB A;  3OLM D;  3PZ7 A;  1C78 A;  2E6X A;  4EUT A;  3PO0 A;  1AW7 A;  3GZN B;  2NTS A;  3AMZ A;  2WWZ A;  2PE6 B;  2BYV E;  2B76 B;  1KLU D;  2M8S A;  3AUL A;  4RM9 A;  3NS1 A;  3TCA A;  3L16 A;  3PT2 B;  2CHX A;  2N7J A;  3HVD A;  2D2Q A;  3N20 C;  4US9 A;  1IGD A;  3GP7 A;  4HEA 1;  2VRR B;  5H92 C;  2KTR B;  1JAL A;  5D2M B;  1V1O A;  4MEL A;  3EHV A;  4GB9 A;  2KTF A;  4MGI E;  2NPT B;  1VZ8 A;  5DPW A;  4M0W B;  3L54 A;  3GZN I;  1SXT A;  3WAL A;  2BS4 B;  3PTF C;  5DPT A;  1MPE A;  3M62 B;  2Z0D B;  2ZPN A;  4P16 A;  4IG7 B;  5G5G A;  4AP4 C;  5JHA A;  2OOB B;  5KHQ A;  1IP9 A;  3N1Z C;  1SE2 A;  1CQV A;  1Q5W B;  4XWW A;  3B9J A;  3OJ4 B;  5CTR C;  1LGR A;  3CMM B;  2CKH B;  1VDV A;  1EF5 A;  1YJI A;  4M01 A;  3IAM 1;  1NEN B;  2K1F A;  4EEW A;  1GG3 A;  2BYF A;  1RWS A;  4HPP A;  5IO9 A;  1YIW A;  2BKR B;  4RM8 A;  1WE7 A;  2M4N A;  1WGY A;  2CJO A;  3PRZ A;  4AJY B;  3RZF A;  3FIL B;  2IYD B;  4CYE A;  3W2D A;  3AU4 A;  1VZ6 A;  2EKE C;  1IGC A;  2N4F A;  2MHJ A;  1DGJ A;  1UZX B;  1AYF A;  4EKU A;  3H9D A;  1M4V A;  2NS5 A;  4A3P A;  1N61 A;  5D3D A;  2ONQ A;  4QAY A;  3W5V B;  2Y5P A;  3KWV A;  4RF0 A;  4HRO A;  2O6V B;  2OJR A;  3ZRF A;  1T5X D;  5L83 A;  2N9X A;  1T6B X;  2JF5 A;  3RMK C;  1I4X A;  2ZNV C;  4GDK A;  1H4R A;  3TL5 A;  4JPS A;  4BKS D;  4RGN A;  3WIM A;  3QAQ A;  1SGH A;  4YTM B;  3PPA A;  1VRA B;  4WJN A;  1WFY A;  4HKQ A;  3SR6 A;  2WU5 B;  1YQ3 B;  1XLP A;  2K5P A;  3W9C B;  4HKZ E;  5C2T B;  3DBR B;  2DZM A;  3ONS A;  3A9J B;  1YOV B;  3L08 A;  5TSS A;  4M8N A;  4TUU A;  1GOZ A;  1F2R I;  2N1V A;  4TMA B;  3APF A;  4YWG G;  1RRB A;  1WXS A;  1A5R A;  4PYU A;  2FCS A;  3W1S C;  1CJE A;  3H6N A;  4GU2 A;  1V6E A;  2KN5 A;  2PKO A;  3IXS A;  3ZDT A;  3DBR I;  2CHZ A;  2FUG 1;  2DYB A;  5IAA C;  4DK5 A;  4JX1 C;  2RGF A;  2PLP A;  2HTM E;  2GMI C;  2LWP A;  3EGR A;  3RN9 C;  2KTR A;  1ET9 A;  4W9E A;  3R8B A;  1C1Y B;  2BWF A;  2J0K A;  1NEK B;  4FUL A;  1KH0 A;  3PHX B;  2IBI B;  1FM0 D;  4ZRP A;  2JXX A;  5DPR A;  3OAW A; 
#chains in the Genus database with same CATH homology
 2HTH A;  1GC6 A;  1XT9 B;  2ASQ A;  3DOW A;  4NAW B;  1H8C A;  4G3X B;  2KMA A;  1RFA A;  3Q3F A;  2JWZ A;  3K9O B;  2N7E A;  3JYU A;  4HJK A;  3U8Z A;  1WMH B;  3N30 A;  3ZNH B;  2B3A A;  4KSK C;  4W9C A;  2LRU A;  1WGR A;  3H1U A;  1WE6 A;  3EC8 A;  3PS6 A;  3HIZ A;  3ECI A;  3QHT A;  2L0F A;  2I1K A;  4GIV A;  3DBH I;  1P1A A;  4B9K A;  3QX1 A;  3NZS A;  1GUA B;  3VQI A;  3C0R B;  3VUY A;  4CO7 A;  1GNU A;  1T0Y A;  2KFK B;  1JRU A;  4MH0 E;  1GC7 A;  2DZK A;  4IM0 A;  2JY6 A;  4JIO U;  5CX3 A;  1EUV B;  1TBE A;  2EMS A;  1WH3 A;  4NAW A;  4IWP A;  4PYZ A;  3ML8 A;  3X0W A;  3ZW3 A;  4E74 A;  4MSM B;  3DBS A;  2LXC A;  4KV2 A;  1I42 A;  1V5T A;  3PRM B;  4ANV A;  4AJW A;  3WAO A;  1YD8 U;  2KVR A;  2ZJD A;  3NS8 A;  1LM8 B;  1OGW A;  4GDL B;  3RCZ A;  4X57 B;  2C5L C;  5JH5 C;  3B1L X;  2CHW A;  2DAJ A;  2LAS A;  2MA9 B;  4WJQ A;  2DZI A;  3ZKJ C;  2DYO A;  2MBH A;  3PLU A;  4KZ0 A;  4LDT D;  5CHW A;  2IY0 B;  4EFO A;  3JSV A;  4HCP B;  4DHZ B;  3O65 B;  2KQS A;  4B95 A;  2D3G A;  2L8J A;  2MW5 A;  2KFK A;  4FAD A;  4W9K A;  5E6O A;  5KHO A;  3KW5 B;  2REX A;  1WX7 A;  2R2O A;  5HKH A;  1V81 A;  2O6V A;  4DWF A;  3ZLZ A;  3U7D A;  1SIF A;  5CHV C;  2KC2 A;  3JVZ X;  2MQJ A;  2ZEQ A;  1LXD A;  4OVU A;  1E90 A;  1I35 A;  2L00 B;  2KJH B;  2NVU I;  2XBB C;  4BBN C;  2G4S A;  2MX2 A;  4LCD E;  2AWT A;  4ZRK A;  1AAR A;  2LGD A;  4DXA B;  4GOC A;  4BKT A;  1L7Y A;  2G45 B;  3NY5 A;  2UYZ B;  3CST A;  2N7D A;  2YVC A;  3PRE A;  3RD2 A;  1EO6 A;  2JRH A;  2GBJ A;  1WZ0 A;  2MWS B;  4ZRJ A;  4BOS C;  2JUO A;  3KH0 A;  4WWP A;  2JRI B;  2ZZP B;  2A4Z A;  3KYD D;  1WXA A;  2K39 A;  4MSQ B;  4ANU A;  4NNJ B;  2BWE S;  5J2R A;  3MHS D;  2CU1 A;  2ZCB A;  4FHK A;  4NJ6 A;  3PHW B;  3L0W B;  4G11 A;  3SU8 X;  4BKS A;  5C23 A;  2DYM A;  4FJV B;  4HDO A;  1V86 A;  3HM3 A;  1WR1 A;  2KQ7 A;  2M0X A;  2HJ8 A;  4XX5 A;  1IYF A;  4TV3 A;  3TJP A;  4EOY A;  4ICV A;  5DPS A;  4NJ7 A;  4NQL B;  3K9P B;  4FJY A;  3WA0 A;  3A9J A;  3DVG Y;  2IO1 B;  3A4R A;  4BOZ B;  1KOT A;  1L2N A;  4BKG A;  1ZKH A;  1EF1 A;  2MBB B;  2FCQ A;  3V6E B;  3NHE B;  3KUZ A;  3AU5 A;  1VD2 A;  2C7H A;  4GXB A;  3CF6 E;  2G3Q B;  4ASW C;  4B6W A;  2BYE A;  4MEM A;  1TTN A;  3DQV A;  1E8W A;  3VUX A;  1V80 A;  2MBO A;  4AOF A;  3ZNI D;  4DBG A;  2KWC A;  4OVV A;  4MDK E;  2FNJ B;  1YJ1 A;  3SHQ A;  4DHJ B;  1OEY J;  1WI0 A;  3M95 A;  4HK2 A;  2MCN B;  1M94 A;  1E7V A;  2EMT A;  3Q3J A;  4PS8 A;  4JLC A;  1WIA A;  1R4N I;  4J6I A;  5GMV A;  3LDZ E;  5AZG A;  5G2N A;  4KDI C;  2KLC A;  2KZR A;  4E3C A;  1TGZ B;  5AZF A;  2C7N B;  4W9G A;  3OJ3 A;  1MG8 A;  4FN2 A;  4KSL C;  2GBR A;  2UWQ A;  3H7P B;  5E6P A;  3RYT A;  3UQA A;  4LJP B;  3IHP C;  3IVF A;  3SDL C;  2GBM A;  2XK5 A;  2LD9 A;  1R4M I;  2KWU B;  2D11 A;  1Q1O A;  2L76 A;  4MGY E;  3KUD B;  4K7S A;  4NY0 A;  2ZVO A;  4XC2 A;  1J19 A;  4NPN A;  2G4D B;  2KX0 A;  3WAM A;  1P0R A;  3IG3 A;  2C9W B;  3EFU A;  2FCN A;  3ENE A;  2GBN A;  2LJ5 A;  4HWI B;  4TQ1 A;  1G6J A;  3ML9 A;  2NBU A;  1S3S G;  2RPQ A;  4PS3 A;  2N9P C;  3CSF A;  3VTV A;  2KX3 A;  4DDI D;  4F8C B;  2AYO B;  4URK A;  1WGH A;  3I3T B;  2HE7 A;  2ZVN A;  4WAA A;  2NBW B;  3VH4 B;  3PGE A;  3QQ8 B;  5JZE B;  5D7G A;  3QCA A;  1WMH A;  3ZNZ B;  2KJ6 A;  2KJR A;  3UIN B;  2O6V D;  4HDQ A;  3ZIM A;  1ZW7 A;  3VFK A;  4W9D A;  4ANW A;  3ZTC A;  4W9F A;  3ZRC A;  3QC8 B;  4HPM B;  1NI2 A;  2KOX A;  3RZW C;  2AEH A;  3N3K B;  4CHK A;  1UH6 A;  4IC7 B;  3HK0 A;  2DEN B;  4IM2 A;  2D10 A;  2FAZ A;  2MP2 B;  4WQO B;  2LVO A;  3UIO B;  2HD5 B;  3APC A;  4P7I A;  4FBJ B;  2K8H A;  1E8Z A;  2AL3 A;  3IBE A;  3R7R A;  3V62 A;  1KJT A;  3V61 A;  1SE9 A;  3RUI B;  1V5O A;  3DDC B;  1OTR B;  2RD0 A;  4I6N B;  4JL9 A;  2KDB A;  3M63 B;  2L05 A;  4ZRI A;  1E7U A;  2QHO A;  4LDT B;  3BIN A;  2NCN A;  3RUL A;  4MJS B;  4II2 B;  4GDL A;  4KIK B;  4F1S A;  3KUC B;  5JHB A;  1KLV A;  5E6N A;  2LGX A;  1WYW B;  2K6D B;  2LRW A;  4GMV A;  3R66 C;  3ALB A;  4WWN A;  4ZDV A;  3PSE B;  5C1Z A;  3HHM A;  1WX8 A;  2KK8 A;  2K8C A;  4DHZ E;  3ZO5 B;  1YX5 B;  3WAP A;  5EDS A;  2W9N A;  2JPH A;  1UGM A;  1KM7 A;  5AEK B;  1WZ3 A;  4JGH B;  1GJZ A;  3UGB B;  2BKF A;  2IY1 B;  2J0M A;  3PV1 A;  3OLM D;  3P2B A;  4EUT A;  4M8M A;  2M1M A;  2WWZ A;  1XD3 B;  2PE6 B;  2IZV B;  1WF9 A;  2MLB A;  4IW0 A;  3VDZ A;  2BYV E;  2LGY A;  3A1Q B;  3ZDM C;  2MRP A;  4W9L A;  2L7R A;  2M8S A;  3QAR A;  3AUL A;  1RAX A;  4RM9 A;  2KC1 A;  3TCA A;  1WX9 A;  3QK0 A;  4K7W A;  3L16 A;  4LJO B;  3PT2 B;  2CHX A;  4EZK A;  2FUH B;  3VTU A;  1F9J A;  1WJN A;  4TKN A;  3HM6 X;  2D2Q A;  3R7Q A;  4ICU A;  2DHZ A;  4W9H A;  2K8B A;  3SD5 A;  2NBV B;  2AL6 A;  3WAN A;  2BF8 B;  2MSE D;  2WX1 A;  1BT0 A;  2O2V B;  3NOB A;  2VRR B;  2IO2 B;  1WGG A;  2KTR B;  5D2M B;  2L3Z A;  4MEL A;  3UF8 A;  3EHV A;  4GB9 A;  3TIX A;  2KTF A;  2V3S A;  4MGI E;  3N32 A;  2J7Q B;  2NPT B;  5DPW A;  4M0W B;  3L54 A;  3GZN I;  1LFD A;  3WAL A;  3VUW A;  4MGZ E;  4G0N B;  3V6C B;  4WJP A;  1E8X A;  2DX5 B;  3PTF C;  2BPS A;  1WJU A;  2N1W A;  3QA8 A;  5DPT A;  3V60 A;  4FHJ A;  2KWV B;  3M62 B;  4ANX A;  2Z0D B;  2ZPN A;  4AP4 C;  4IG7 B;  4BVU C;  5JHA A;  1C3T A;  3D32 A;  3DBL I;  2OOB B;  4GSW A;  1WRD B;  5KHQ A;  3UIP B;  2XEW A;  1IP9 A;  1XQQ A;  1Q5W B;  4AUQ C;  3VHT C;  2KLG A;  4G50 A;  3OJ4 B;  5CTR C;  3VXW A;  4WWO A;  2JVC A;  3CMM B;  2LVQ A;  2CKH B;  4I6P A;  2J0J A;  2CS4 A;  2NR2 A;  3L10 B;  1EF5 A;  2NPT A;  1CMX B;  2GBK A;  3BY4 B;  2K1F A;  4HCN B;  4EEW A;  1GG3 A;  2C7M B;  2L0T A;  2BYF A;  2WDT B;  2KDE B;  1E8Y A;  4K81 A;  1YIW A;  2LZ6 A;  2BKR B;  4RM8 A;  5D6J B;  1WE7 A;  2D07 B;  2MBQ A;  3AXC A;  2M4N A;  2A5U A;  2KD0 A;  4AWJ A;  3H7P A;  2DZJ A;  3TMP B;  1WGY A;  3VH3 B;  3KVF B;  3PLV A;  3PRZ A;  4AJY B;  3RZF A;  5J18 A;  1D3Z A;  2IYD B;  2KNB A;  1OEY A;  4CYE A;  2PEA A;  3DVN U;  3AU4 A;  3JW0 X;  2EKE C;  3U30 A;  2IO3 B;  3DVN V;  2N4F A;  4BFR A;  1ISN A;  1VCB A;  5TR5 A;  4GDK B;  2CR5 A;  2M17 A;  1UZX B;  4K1R B;  4EKU A;  3H9D A;  3JSV B;  1S1Q B;  4IWQ A;  2NS5 A;  1U4A A;  1WY8 A;  2KDF B;  2RR9 A;  4A3P A;  5AZH A;  2LUE A;  2KXJ A;  3X23 A;  1X1M A;  4GGQ A;  2JZ3 B;  3GOE A;  3IFW B;  5DCN A;  2ZPY A;  2ZCC A;  2FIF A;  1QZE A;  2O6V B;  2OJR A;  4IUM B;  3ZRF A;  5LLI A;  4IM3 A;  1UD7 A;  3ZVV A;  5L83 A;  3TBL D;  2N9X A;  2YLM A;  2ZNV B;  2JF5 A;  3QIJ A;  4ZYN A;  2KDI A;  4KDL B;  1NBF C;  3A4S C;  4F7Z A;  1V2Y A;  2ZNV C;  3APD A;  5LXH A;  4GDK A;  5LXI B;  3NZU A;  1H4R A;  3TL5 A;  1UBQ A;  4BKS D;  3M3J A;  1Y8R C;  1J0G A;  4FA6 A;  3WIM A;  3QAQ A;  3QJZ A;  4PS7 A;  1UBI A;  1Z2M A;  1E5W A;  1SGH A;  4MM3 A;  2MP2 A;  1FXT B;  3PPA A;  4NQK E;  4WJN A;  4XZ4 A;  4BBN F;  3DVG X;  1LQB A;  4A3O A;  1YQB A;  1WXV A;  2KO3 A;  2KKC A;  1WFY A;  3QWZ B;  2WX0 A;  2FID A;  3A9K B;  4W9J A;  2DAF A;  1WGD A;  1IPG A;  1J8C A;  2LI5 A;  3B08 A;  4MJS A;  5G55 A;  1P3Q U;  4KIK A;  1P98 A;  4KVG B;  4HVB A;  5IA7 A;  2DZM A;  3AI5 A;  2V4L A;  3ONS A;  3ZTD A;  3W1Y A;  3A9J B;  3LJ3 A;  4HPL B;  1Q0W B;  2PPH A;  1P9D U;  3L08 A;  3MJW A;  2I1J A;  4E71 A;  3PVL A;  3PZD A;  4MGK E;  3DCG A;  5J17 A;  4A20 A;  2Z0E B;  4M8N A;  4EZJ A;  2KMC A;  2KHW B;  4TUU A;  2KAN A;  1RLF A;  2RSU A;  2LVP A;  3UQB A;  2KFJ A;  3PRP B;  2Z59 B;  2N1V A;  3DPD A;  1V9J A;  1YX6 B;  4IWO A;  1WXM A;  3APF A;  2PE9 A;  3A9K A;  2JT4 B;  4RMA A;  4JQW C;  4HXD A;  1RRB A;  2MBE A;  4HLE A;  2WYQ A;  1TZ1 A;  1WXS A;  1WR6 E;  4N9F 4;  2IO0 B;  3A1Q A;  1A5R A;  2N9E B;  1WJ4 A;  1K8R B;  2FCS A;  4PYU A;  3W1S C;  2Y5B B;  3H7S A;  3H6N A;  3R3M A;  2K25 A;  4GU2 A;  4II3 B;  3A33 B;  1V6E A;  5FR6 A;  3ZNG C;  4DHJ D;  2JZZ A;  1ZGU B;  2KN5 A;  3KYC D;  4I6L B;  4KZC A;  3ZDT A;  3VVW B;  3DBR I;  2CHZ A;  5D94 A;  2DYB A;  5IAA C;  4DK5 A;  4WJO A;  1OQY A;  1WJ6 A;  3T9L A;  4EZL A;  3EEC A;  3S2A A;  4DDG D;  2R2Q A;  1Z5S B;  2C60 A;  4FJZ A;  2XK5 B;  3L13 A;  2PJH A;  1PQS A;  2RGF A;  3L17 A;  3W1S A;  2O2V A;  1UEL A;  1HE8 A;  3B0A A;  2GOW A;  2GMI C;  2LWP A;  1NDD A;  2KTR A;  5CHF A;  3RT3 B;  3VAW A;  4W9E A;  3ZUN A;  2FCM A;  1C1Y B;  2BWF A;  2J0K A;  1WM2 A;  3MTN B;  4GN1 A;  4K7U A;  4FUL A;  3VTW A;  5L95 C;  3PHX B;  1V49 A;  4FLH A;  2BGF A;  4TQ0 A;  5BO4 B;  2IBI B;  2V1Y A;  2K6Q A;  4W9I A;  1WM3 A;  2JXX A;  4YL8 A;  3T8M A;  2LXA A;  5DPR A;  3OAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...