2MXDA

Solution structure of vpg of porcine sapovirus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
GAMAIALRDDEYDEWQDIIRDWRKEMTVQQFLDLKERALSGASDPDSQRYNAWLELRAKRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the porcine sapovirus VPg core reveals a stable three-helical bundle with a conserved surface patch.
pubmed doi rcsb
source organism Porcine enteric sapovirus
molecule tags Viral protein
molecule keywords Viral protein genome-linked
total genus 18
structure length 62
sequence length 62
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.110 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 2mxdA00
2MXDA 2M4HA
chains in the Genus database with same CATH superfamily
2PXVA 2L1PA 3JXBC 2FJRA 3PXPA 2LYKA 2M4HA 3KZ3A 1LMB3 2EF8A 2HFZA 3R09A 3TRBA 2MEZA 1U2ZA 2ICPA 1GT0C 4EKIA 1PRVA 3GZDC 3OKZA 4OBMA 2LYRA 3F51A 2ODRD 2GZUA 4WVLA 4X4GA 3NXHA 5DT2A 3U3WA 3QOWA 2BNMA 2PXBA 3JXCL 1JWLA 1OCTC 4JCYA 1R69A 3DNVB 2PUAA 1DWKA 2YBDA 4IVZA 4I6TA 2BNOA 3PE5A 2JCGA 1QP7A 3OQOA 2PUGA 4PU8A 2AUWA 3S8QA 1POUA 4J1WA 1ZVVA 2PXDA 1Y9QA 3G0TA 1PNRA 2XSDC 3BS3A 2LLWA 2KEIA 1NERA 1LQCA 4YG1A 3IVPA 1ZPQA 2V3CC 3F52A 4J1XA 1MFQC 1ZS4A 3GZDA 5A7LA 4X4HA 4ER6A 1NEQA 3GN5B 4ER0A 2IVQA 3OQMA 1PRUA 3OWQA 2PE5A 3SCHA 4JQDA 4X4BA 2PUFA 1XWRA 4Q2JA 2HINA 3ZKCA 4EQZA 3OMTA 4X4IA 2PXQA 3SCGA 2XIUA 3O9XA 1ZZBA 4Z58A 4YBAA 1ZZ8A 4F8DA 2B5AA 2R1JL 4PU4C 4EKGA 1ZZ6A 2L8NA 1O4XA 3VK0A 1VPWA 1PERL 3RZZA 3QOXA 3HZIB 4X4DA 2J7UA 2LNMA 4IWRA 3G5GA 1QQBA 1QQAA 1B0NA 4DE9A 3G7DA 3GBFA 1JH9A 2PXTA 1BDHA 4HRAA 2PXFA 2IVGA 1LCCA 2XCJA 3F6WA 4MCTA 3GZCA 2IV1A 3LISA 2IUOA 2D5VA 4YG4A 5GAGi 4IA8A 5DTRA 4GQMA 1DW9A 3OP9A 1AU7A 3SX0A 1HQ1A 4X4EA 3MEJA 1SQ8A 2XXPA 3CECA 5DRTA 2GRMA 2AXUA 3GUUA 3CROL 3MLFA 5DSXA 1UTXA 2HCNA 1WIZA 4DE8A 1CJGA 2ICTA 4FN3A 1X57A 2L49A 2HSGA 3FYMA 4GHJA 2LYJA 3NDBB 1ADRA 4O8BA 1S7EA 4ER7A 2WIUB 2H8RA 2PXKA 1BDIA 4FBIA 1L1MA 3TELA 2JQEA 1ZAYA 4I6RA 1ZUGA 3BDNA 1JFSA 3QQ6A 2VEOA 2LYLA 2KZ8A 1Y7YA 3LQXA 3CLCA 2PXEA 2GRLA 1RZSA 1IC8A 2WUSR 3D1NI 2LCVA 3ZHIA 3H5TA 3FYAA 1DULA 2LYSA 5DRYA 4Z5DA 5GAHi 2XI8A 1QB2A 1RZRD 1X2LA 4YG7B 2OFYA 2KEJA 2J7WA 1LLIA 3M9LA 3LFPA 3NROA 4I6UA 2PUCA 3A9ZA 3UFDA 1PRAA 3GN5A 4Z5HA 2AW6A 3OQNA 2PUDA 2LYQA 5K98B 4Z5CA 1NW3A 1ZZ7A 3SCFA 1HF0A 4MCXA 2XXAA 2A6CA 3UWPA 4EK9A 5DTMA 1OSLA 3JXDL 4Y42A 2AXZA 2IVBA 3R1FA 4NDWA 3A9YA 2XJ3A 3KXAA 1ZZ9A 1UXDA 1QPZA 4X4FA 3NZLA 2KEKA 2PUBA 1ZZCA 4Z59A 4ER5A 2BNNA 2EBYA 4I8TA 1WETA 3DM5A 2KPJA 2PIJA 4X4CA 2AXVA 2O4AA 2XXQA 1EFAA 3VWSA 1JFTA 1WH6A 1E3OC 2R63A 3A9XA 2PXLA 3SR4A 2LLVA 2CSFA 1RZRA 2BJCA 2OR1L 3ME5A 3L1PA 2O49A 1CQTA 1WH8A 3FMYA 1RPEL 2FFHA 2PXPA 3EUSA 1RIOA 3TEPA 5JUWA 2JVLA 2PXUA 2O38A 4PU7A 3KJXA 3QFIA 1R63A 3TFLA 3QF3A 1QP0A 1UXCA 2EWTA 4ER3A 1QP4A 2LYPA 4OB4A 2CROA 2AWIA 4EZIA 4YARA 3ZHMA 3BD1A 3KL4A 1LCDA 2MXDA 3ZPXA 2PUEA 3B7HA 2IU7A 1YSEA 4JCXA 3QWGA 1QZXA 2MQKA 2HCSA 2PPXA 3QYXA 4PU3C 5DTQA
chains in the Genus database with same CATH topology
2L1PA 3G0TA 3VWSA 3TEPA 3MEJA 4DE9A 5DRYA 5JUWA 1NW3A 2M4HA 5DTQA 3TELA 3NZLA 2MXDA 2LLWA 3A9XA 2XXPA 3ZPXA 2HFZA 3R09A 1U2ZA 3QFIA 5DTRA 3TFLA 5DRTA 3OWQA 4EKIA 4ER5A 2VEOA 2J7WA 2YBDA 3GZDC 3OKZA 3SR4A 4EKGA 3M9LA 3NROA 4OBMA 4ER3A 2LLVA 3UWPA 4EK9A 3PE5A 4Q2JA 3ME5A 3GUUA 3A9ZA 4HRAA 3QOXA 5DTMA 2ODRD 4EQZA 3GZDA 4ER7A 2HCSA 4WVLA 2J7UA 2LNMA 3NXHA 2HCNA 5DSXA 5DT2A 4ER6A 3QOWA 3SX0A 4DE8A 3A9YA 3GZCA 4EZIA 2XXQA 4ER0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MXD A;  2M4H A; 
#chains in the Genus database with same CATH topology
 2PXV A;  2L1P A;  3JXB C;  2FJR A;  3PXP A;  2LYK A;  2M4H A;  3KZ3 A;  1LMB 3;  2EF8 A;  2HFZ A;  3R09 A;  3TRB A;  2MEZ A;  1U2Z A;  2ICP A;  1GT0 C;  4EKI A;  1PRV A;  3GZD C;  3OKZ A;  4OBM A;  2LYR A;  3F51 A;  2ODR D;  2GZU A;  4WVL A;  4X4G A;  3NXH A;  5DT2 A;  3U3W A;  3QOW A;  2BNM A;  2PXB A;  3JXC L;  1JWL A;  1OCT C;  4JCY A;  1R69 A;  3DNV B;  2PUA A;  1DWK A;  2YBD A;  4IVZ A;  4I6T A;  2BNO A;  3PE5 A;  2JCG A;  1QP7 A;  3OQO A;  2PUG A;  4PU8 A;  2AUW A;  3S8Q A;  1POU A;  4J1W A;  1ZVV A;  2PXD A;  1Y9Q A;  3G0T A;  1PNR A;  2XSD C;  3BS3 A;  2LLW A;  2KEI A;  1NER A;  1LQC A;  4YG1 A;  3IVP A;  1ZPQ A;  2V3C C;  3F52 A;  4J1X A;  1MFQ C;  1ZS4 A;  3GZD A;  5A7L A;  4X4H A;  4ER6 A;  1NEQ A;  3GN5 B;  4ER0 A;  2IVQ A;  3OQM A;  1PRU A;  3OWQ A;  2PE5 A;  3SCH A;  4JQD A;  4X4B A;  2PUF A;  1XWR A;  4Q2J A;  2HIN A;  3ZKC A;  4EQZ A;  3OMT A;  4X4I A;  2PXQ A;  3SCG A;  2XIU A;  3O9X A;  1ZZB A;  4Z58 A;  4YBA A;  1ZZ8 A;  4F8D A;  2B5A A;  2R1J L;  4PU4 C;  4EKG A;  1ZZ6 A;  2L8N A;  1O4X A;  3VK0 A;  1VPW A;  1PER L;  3RZZ A;  3QOX A;  3HZI B;  4X4D A;  2J7U A;  2LNM A;  4IWR A;  3G5G A;  1QQB A;  1QQA A;  1B0N A;  4DE9 A;  3G7D A;  3GBF A;  1JH9 A;  2PXT A;  1BDH A;  4HRA A;  2PXF A;  2IVG A;  1LCC A;  2XCJ A;  3F6W A;  4MCT A;  3GZC A;  2IV1 A;  3LIS A;  2IUO A;  2D5V A;  4YG4 A;  5GAG i;  4IA8 A;  5DTR A;  4GQM A;  1DW9 A;  3OP9 A;  1AU7 A;  3SX0 A;  1HQ1 A;  4X4E A;  3MEJ A;  1SQ8 A;  2XXP A;  3CEC A;  5DRT A;  2GRM A;  2AXU A;  3GUU A;  3CRO L;  3MLF A;  5DSX A;  1UTX A;  2HCN A;  1WIZ A;  4DE8 A;  1CJG A;  2ICT A;  4FN3 A;  1X57 A;  2L49 A;  2HSG A;  3FYM A;  4GHJ A;  2LYJ A;  3NDB B;  1ADR A;  4O8B A;  1S7E A;  4ER7 A;  2WIU B;  2H8R A;  2PXK A;  1BDI A;  4FBI A;  1L1M A;  3TEL A;  2JQE A;  1ZAY A;  4I6R A;  1ZUG A;  3BDN A;  1JFS A;  3QQ6 A;  2VEO A;  2LYL A;  2KZ8 A;  1Y7Y A;  3LQX A;  3CLC A;  2PXE A;  2GRL A;  1RZS A;  1IC8 A;  2WUS R;  3D1N I;  2LCV A;  3ZHI A;  3H5T A;  3FYA A;  1DUL A;  2LYS A;  5DRY A;  4Z5D A;  5GAH i;  2XI8 A;  1QB2 A;  1RZR D;  1X2L A;  4YG7 B;  2OFY A;  2KEJ A;  2J7W A;  1LLI A;  3M9L A;  3LFP A;  3NRO A;  4I6U A;  2PUC A;  3A9Z A;  3UFD A;  1PRA A;  3GN5 A;  4Z5H A;  2AW6 A;  3OQN A;  2PUD A;  2LYQ A;  5K98 B;  4Z5C A;  1NW3 A;  1ZZ7 A;  3SCF A;  1HF0 A;  4MCX A;  2XXA A;  2A6C A;  3UWP A;  4EK9 A;  5DTM A;  1OSL A;  3JXD L;  4Y42 A;  2AXZ A;  2IVB A;  3R1F A;  4NDW A;  3A9Y A;  2XJ3 A;  3KXA A;  1ZZ9 A;  1UXD A;  1QPZ A;  4X4F A;  3NZL A;  2KEK A;  2PUB A;  1ZZC A;  4Z59 A;  4ER5 A;  2BNN A;  2EBY A;  4I8T A;  1WET A;  3DM5 A;  2KPJ A;  2PIJ A;  4X4C A;  2AXV A;  2O4A A;  2XXQ A;  1EFA A;  3VWS A;  1JFT A;  1WH6 A;  1E3O C;  2R63 A;  3A9X A;  2PXL A;  3SR4 A;  2LLV A;  2CSF A;  1RZR A;  2BJC A;  2OR1 L;  3ME5 A;  3L1P A;  2O49 A;  1CQT A;  1WH8 A;  3FMY A;  1RPE L;  2FFH A;  2PXP A;  3EUS A;  1RIO A;  3TEP A;  5JUW A;  2JVL A;  2PXU A;  2O38 A;  4PU7 A;  3KJX A;  3QFI A;  1R63 A;  3TFL A;  3QF3 A;  1QP0 A;  1UXC A;  2EWT A;  4ER3 A;  1QP4 A;  2LYP A;  4OB4 A;  2CRO A;  2AWI A;  4EZI A;  4YAR A;  3ZHM A;  3BD1 A;  3KL4 A;  1LCD A;  2MXD A;  3ZPX A;  2PUE A;  3B7H A;  2IU7 A;  1YSE A;  4JCX A;  3QWG A;  1QZX A;  2MQK A;  2HCS A;  2PPX A;  3QYX A;  4PU3 C;  5DTQ A; 
#chains in the Genus database with same CATH homology
 2L1P A;  3G0T A;  3VWS A;  3TEP A;  3MEJ A;  4DE9 A;  5DRY A;  5JUW A;  1NW3 A;  2M4H A;  5DTQ A;  3TEL A;  3NZL A;  2MXD A;  2LLW A;  3A9X A;  2XXP A;  3ZPX A;  2HFZ A;  3R09 A;  1U2Z A;  3QFI A;  5DTR A;  3TFL A;  5DRT A;  3OWQ A;  4EKI A;  4ER5 A;  2VEO A;  2J7W A;  2YBD A;  3GZD C;  3OKZ A;  3SR4 A;  4EKG A;  3M9L A;  3NRO A;  4OBM A;  4ER3 A;  2LLV A;  3UWP A;  4EK9 A;  3PE5 A;  4Q2J A;  3ME5 A;  3GUU A;  3A9Z A;  4HRA A;  3QOX A;  5DTM A;  2ODR D;  4EQZ A;  3GZD A;  4ER7 A;  2HCS A;  4WVL A;  2J7U A;  2LNM A;  3NXH A;  2HCN A;  5DSX A;  5DT2 A;  4ER6 A;  3QOW A;  3SX0 A;  4DE8 A;  3A9Y A;  3GZC A;  4EZI A;  2XXQ A;  4ER0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...