2MY5A

Solution structure of kstb-pcp in kosinostatin biosynthesis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
MQHASVIAQFVVEEFLPDVAPADVDVDLDLVDNGVIDSLGLLKVIAWLEDRFGIAADDVELSPEHFRSIRSIDAFVVGATTPPVEAKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1H and 15N Assigned Chemical Shifts for KstB-PCP
rcsb
source organism Micromonospora sp. tp-a0468
molecule tags Transport protein
molecule keywords Peptidyl carrier protein
total genus 19
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2015-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2my5A00
2KOSA 4PWVB 2MF4A 2K92A 2L9FA 3RG2A 1L0HA 1ACPA 2KG8A 2M5RA 2DNWA 2FQ0A 2N6ZA 2KGAA 2AF8A 2JU1A 3EJEA 2GDWA 4H2YC 2XZ0D 1HY8A 4DG9A 4IZ6A 2N98A 2FVFA 2MR8A 2EHSA 2JU2A 2KOOA 2K0XA 2KR5A 3CE7A 3GZLA 2AFDA 2KGEA 2FQ1A 2N50A 2FADA 2MVVA 5CZDB 2K0YA 3NY7B 2KOPA 2N5IA 1X3OA 2CQ8A 1T8KA 2FVEA 2KW2A 4NEOA 2VSQA 4CA3A 1DV5A 2FQ2A 2LIUA 1DNYA 5KP7B 5HVCA 2KG6A 4H2WC 4BPHA 5EJDA 3LMOA 2GDYA 4HKGA 2XZ1C 2GDXA 2FAEA 5HV8A 4BPFA 2JGPA 2LPKA 4MRTC 2KORA 2CNRA 2MVUA 1VKUA 2EHTA 2LTEA 2AVAA 2LKIA 3EJBA 2N6YA 2QNWA 3EJDA 2LL8A 4PXHB 2KG9A 2LIWA 2L22A 5KP6B 2MY5A 2K93A 1AF8A 1L0IA 5KP8B 1OR5A 2FVAA 1NQ4A 2LOLA 2PNGA 1HQBA 2L4BA 2KGDA 4H2XC 2KWLA 4R0MA 2ROQA 2FACA 2JQ4A 2KOQA 2CGQA 2L0QA 2MD9A 2LMLA 2FHSC 2K2QA 2K94A 2CG5B 2KGCA 2N5HA 1F80D 2AFEA 3GZMA 2MR7A 4BPGA 1KLPA 2X2BA
chains in the Genus database with same CATH superfamily
2KOSA 3CCJP 2PEJA 1K73Q 1M1KQ 4XFYA 1S72P 5F2OA 1VHNA 1BXIA 4F37A 3EJEA 3HZQA 3CC7P 2N98A 2FVFA 2EHSA 3DS2A 2M8PA 1EIAA 2K0XA 1K8AQ 2GZFA 2GZIA 2FQ1A 2N50A 3G29A 2N5IA 3CCQP 2Z44A 5KP7B 1Q86Q 2KG6A 1NJIQ 4QNBA 5HGLA 1N8RQ 2NO8A 4U0FA 1AYIA 1FR2A 1GXHA 2JGPA 2MVUA 5HGNA 2N6YA 1Z6MA 2LL8A 3DS5A 2GYKA 2PEMA 1E6JP 2JAZA 1OR5A 4COCA 1ZMBA 1E0HA 4GR2A 1HQBA 2M8NA 2VLNA 4R0MA 3CCEP 2PY8A 2M8LA 1AUMA 2ROQA 4WYMA 2FACA 2JQ4A 1MZ8A 3LRYA 3RG6C 1EMVA 2K0DX 2LF4A 4U0AA 1F80D 2DGYA 2KODA 4BPGA 1YJNP 1VQ8P 1Q82Q 4QKOA 3MGEA 2K92A 3G28A 2Z46A 3CCSP 1VQKP 1EOQA 2L6EA 3NTEA 2XV6A 1VQMP 3GJNA 3H4EA 2DNWA 3CMEP 5BS2A 3CCVP 1QRJA 4IZ6A 1Q81Q 2JU2A 2KOOA 2OTLP 3CE7A 3GZLA 4PH0A 2AFDA 5F2NA 4COPA 2EIAA 3Q20A 1RO0A 1GXGA 3G71P 2FADA 2GZEA 2K0YA 5F2KA 3NY7B 1X3OA 2CQ8A 2KW2A 3G26A 2FQ2A 1YIJP 5HVCA 3CCUP 3HYBA 2PEIA 2CWOA 1VQ5P 3CCLP 2GDYA 5BS1A 5HV8A 2P9XA 1KQSO 4BPFA 2CNRA 1W2BO 2AVAA 2QNWA 3EJDA 3CCMP 2LIWA 5KP6B 3CCRP 2L4BA 3CC2P 3CD6P 1VQ6P 2KWLA 3H0DA 2OTJP 2K5XA 2KOQA 2CGQA 2MD9A 2K2QA 3DS0A 2KGCA 3VRLC 1YJWP 2X2BA 1IMQA 4PWVB 2L9FA 4U0CA 3RG2A 2QA4P 1ACPA 2M5RA 5EW5E 1ZNVA 4XROA 2EFJA 2GZGA 2AF8A 1Q7YQ 4H2YC 2XZ0D 4U0BA 1HY8A 5HGMA 1M6EX 3WBHA 2MR8A 2JYGA 2KR5A 3B4QA 2XXMA 1RO2A 5JPAA 2MVVA 5CZDB 2KOPA 1T8KA 2FVEA 4NEOA 4CA3A 1RNIA 2JBGA 1DV5A 4H2WC 4BPHA 3CMAP 5EJDA 3LMOA 3B5IA 4HKGA 3G0VA 3G1GA 2QEXP 1A43A 4U0DA 2LPKA 4MRTC 1VQ4P 2KORA 2ERHA 1VKUA 2LTEA 2LKIA 3EJBA 1IMPA 1K30A 4UHPB 1IUQA 2KG9A 1K9MQ 2JYLA 1AF8A 1L0IA 1YI2P 3G21A 2FVAA 1NQ4A 2LOLA 2VLOA 2PNGA 2EG5A 2KGDA 3G6EP 4H2XC 2OARA 3CPWO 2PEKA 1M6NA 2WPTA 1GPJA 3H47A 3DS1A 3OW2O 2FHSC 3DS4A 3G1IA 1BAJA 2K94A 2CG5B 2N5HA 3GZMA 2MR7A 2Z45A 1VQ7P 4U0EA 3U43A 2MF4A 4IPYA 4PH1A 3CXCO 1UJZA 2JO0A 1L0HA 2KG8A 1CEIA 2FQ0A 2N6ZA 1VQOP 1KD1Q 2KGAA 2JU1A 2XT1A 2GDWA 3I56P 4DG9A 1YJ9P 3M1MA 2PEOA 2KGEA 1VQPP 2PENA 3CC4P 1KC8Q 2VSQA 4XFXA 2LIUA 5HGOA 1DNYA 1VQNP 2BHVA 1VQ9P 2XZ1C 1D1DA 2VLPA 4GR6A 2GDXA 2FAEA 3G4SP 3I55P 2EHTA 5I4TG 2VLQA 1M74A 4PXHB 1JJ2O 4M0IA 2L22A 2MY5A 2K93A 3GKLC 1VQLP 2ONTA 2PEQA 5DCKA 5KP8B 4XRQA 1UNKA 1QVFO 2BUOA 7CEIA 1QVGO 2JB0A 3DPHA 2E1MA 3E2DA 3DTJA 3DS3A 4XFZA 3P05A 2L0QA 1M90Q 2LMLA 1A8OA 2GZJA 2AFEA 1YITP 1YHQP 1KLPA
chains in the Genus database with same CATH topology
2KOSA 4PWVB 2MF4A 2K92A 2L9FA 3RG2A 1L0HA 1ACPA 2KG8A 2M5RA 2DNWA 2FQ0A 2N6ZA 2KGAA 2AF8A 2JU1A 3EJEA 2GDWA 4H2YC 2XZ0D 1HY8A 4DG9A 4IZ6A 2N98A 2FVFA 2MR8A 2EHSA 2JU2A 2KOOA 2K0XA 2KR5A 3CE7A 3GZLA 2AFDA 2KGEA 2FQ1A 2N50A 2FADA 2MVVA 5CZDB 2K0YA 3NY7B 2KOPA 2N5IA 1X3OA 2CQ8A 1T8KA 2FVEA 2KW2A 4NEOA 2VSQA 4CA3A 1DV5A 2FQ2A 2LIUA 1DNYA 5KP7B 5HVCA 2KG6A 4H2WC 4BPHA 5EJDA 3LMOA 2GDYA 4HKGA 2XZ1C 2GDXA 2FAEA 5HV8A 4BPFA 2JGPA 2LPKA 4MRTC 2KORA 2CNRA 2MVUA 1VKUA 2EHTA 2LTEA 2AVAA 2LKIA 3EJBA 2N6YA 2QNWA 3EJDA 2LL8A 4PXHB 2KG9A 2LIWA 2L22A 5KP6B 2MY5A 2K93A 1AF8A 1L0IA 5KP8B 1OR5A 2FVAA 1NQ4A 2LOLA 2PNGA 1HQBA 2L4BA 2KGDA 4H2XC 2KWLA 4R0MA 2ROQA 2FACA 2JQ4A 2KOQA 2CGQA 2L0QA 2MD9A 2LMLA 2FHSC 2K2QA 2K94A 2CG5B 2KGCA 2N5HA 1F80D 2AFEA 3GZMA 2MR7A 4BPGA 1KLPA 2X2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOS A;  4PWV B;  2MF4 A;  2K92 A;  2L9F A;  3RG2 A;  1L0H A;  1ACP A;  2KG8 A;  2M5R A;  2DNW A;  2FQ0 A;  2N6Z A;  2KGA A;  2AF8 A;  2JU1 A;  3EJE A;  2GDW A;  4H2Y C;  2XZ0 D;  1HY8 A;  4DG9 A;  4IZ6 A;  2N98 A;  2FVF A;  2MR8 A;  2EHS A;  2JU2 A;  2KOO A;  2K0X A;  2KR5 A;  3CE7 A;  3GZL A;  2AFD A;  2KGE A;  2FQ1 A;  2N50 A;  2FAD A;  2MVV A;  5CZD B;  2K0Y A;  3NY7 B;  2KOP A;  2N5I A;  1X3O A;  2CQ8 A;  1T8K A;  2FVE A;  2KW2 A;  4NEO A;  2VSQ A;  4CA3 A;  1DV5 A;  2FQ2 A;  2LIU A;  1DNY A;  5KP7 B;  5HVC A;  2KG6 A;  4H2W C;  4BPH A;  5EJD A;  3LMO A;  2GDY A;  4HKG A;  2XZ1 C;  2GDX A;  2FAE A;  5HV8 A;  4BPF A;  2JGP A;  2LPK A;  4MRT C;  2KOR A;  2CNR A;  2MVU A;  1VKU A;  2EHT A;  2LTE A;  2AVA A;  2LKI A;  3EJB A;  2N6Y A;  2QNW A;  3EJD A;  2LL8 A;  4PXH B;  2KG9 A;  2LIW A;  2L22 A;  5KP6 B;  2MY5 A;  2K93 A;  1AF8 A;  1L0I A;  5KP8 B;  1OR5 A;  2FVA A;  1NQ4 A;  2LOL A;  2PNG A;  1HQB A;  2L4B A;  2KGD A;  4H2X C;  2KWL A;  4R0M A;  2ROQ A;  2FAC A;  2JQ4 A;  2KOQ A;  2CGQ A;  2L0Q A;  2MD9 A;  2LML A;  2FHS C;  2K2Q A;  2K94 A;  2CG5 B;  2KGC A;  2N5H A;  1F80 D;  2AFE A;  3GZM A;  2MR7 A;  4BPG A;  1KLP A;  2X2B A; 
#chains in the Genus database with same CATH topology
 2KOS A;  3CCJ P;  2PEJ A;  1K73 Q;  1M1K Q;  4XFY A;  1S72 P;  5F2O A;  1VHN A;  1BXI A;  4F37 A;  3EJE A;  3HZQ A;  3CC7 P;  2N98 A;  2FVF A;  2EHS A;  3DS2 A;  2M8P A;  1EIA A;  2K0X A;  1K8A Q;  2GZF A;  2GZI A;  2FQ1 A;  2N50 A;  3G29 A;  2N5I A;  3CCQ P;  2Z44 A;  5KP7 B;  1Q86 Q;  2KG6 A;  1NJI Q;  4QNB A;  5HGL A;  1N8R Q;  2NO8 A;  4U0F A;  1AYI A;  1FR2 A;  1GXH A;  2JGP A;  2MVU A;  5HGN A;  2N6Y A;  1Z6M A;  2LL8 A;  3DS5 A;  2GYK A;  2PEM A;  1E6J P;  2JAZ A;  1OR5 A;  4COC A;  1ZMB A;  1E0H A;  4GR2 A;  1HQB A;  2M8N A;  2VLN A;  4R0M A;  3CCE P;  2PY8 A;  2M8L A;  1AUM A;  2ROQ A;  4WYM A;  2FAC A;  2JQ4 A;  1MZ8 A;  3LRY A;  3RG6 C;  1EMV A;  2K0D X;  2LF4 A;  4U0A A;  1F80 D;  2DGY A;  2KOD A;  4BPG A;  1YJN P;  1VQ8 P;  1Q82 Q;  4QKO A;  3MGE A;  2K92 A;  3G28 A;  2Z46 A;  3CCS P;  1VQK P;  1EOQ A;  2L6E A;  3NTE A;  2XV6 A;  1VQM P;  3GJN A;  3H4E A;  2DNW A;  3CME P;  5BS2 A;  3CCV P;  1QRJ A;  4IZ6 A;  1Q81 Q;  2JU2 A;  2KOO A;  2OTL P;  3CE7 A;  3GZL A;  4PH0 A;  2AFD A;  5F2N A;  4COP A;  2EIA A;  3Q20 A;  1RO0 A;  1GXG A;  3G71 P;  2FAD A;  2GZE A;  2K0Y A;  5F2K A;  3NY7 B;  1X3O A;  2CQ8 A;  2KW2 A;  3G26 A;  2FQ2 A;  1YIJ P;  5HVC A;  3CCU P;  3HYB A;  2PEI A;  2CWO A;  1VQ5 P;  3CCL P;  2GDY A;  5BS1 A;  5HV8 A;  2P9X A;  1KQS O;  4BPF A;  2CNR A;  1W2B O;  2AVA A;  2QNW A;  3EJD A;  3CCM P;  2LIW A;  5KP6 B;  3CCR P;  2L4B A;  3CC2 P;  3CD6 P;  1VQ6 P;  2KWL A;  3H0D A;  2OTJ P;  2K5X A;  2KOQ A;  2CGQ A;  2MD9 A;  2K2Q A;  3DS0 A;  2KGC A;  3VRL C;  1YJW P;  2X2B A;  1IMQ A;  4PWV B;  2L9F A;  4U0C A;  3RG2 A;  2QA4 P;  1ACP A;  2M5R A;  5EW5 E;  1ZNV A;  4XRO A;  2EFJ A;  2GZG A;  2AF8 A;  1Q7Y Q;  4H2Y C;  2XZ0 D;  4U0B A;  1HY8 A;  5HGM A;  1M6E X;  3WBH A;  2MR8 A;  2JYG A;  2KR5 A;  3B4Q A;  2XXM A;  1RO2 A;  5JPA A;  2MVV A;  5CZD B;  2KOP A;  1T8K A;  2FVE A;  4NEO A;  4CA3 A;  1RNI A;  2JBG A;  1DV5 A;  4H2W C;  4BPH A;  3CMA P;  5EJD A;  3LMO A;  3B5I A;  4HKG A;  3G0V A;  3G1G A;  2QEX P;  1A43 A;  4U0D A;  2LPK A;  4MRT C;  1VQ4 P;  2KOR A;  2ERH A;  1VKU A;  2LTE A;  2LKI A;  3EJB A;  1IMP A;  1K30 A;  4UHP B;  1IUQ A;  2KG9 A;  1K9M Q;  2JYL A;  1AF8 A;  1L0I A;  1YI2 P;  3G21 A;  2FVA A;  1NQ4 A;  2LOL A;  2VLO A;  2PNG A;  2EG5 A;  2KGD A;  3G6E P;  4H2X C;  2OAR A;  3CPW O;  2PEK A;  1M6N A;  2WPT A;  1GPJ A;  3H47 A;  3DS1 A;  3OW2 O;  2FHS C;  3DS4 A;  3G1I A;  1BAJ A;  2K94 A;  2CG5 B;  2N5H A;  3GZM A;  2MR7 A;  2Z45 A;  1VQ7 P;  4U0E A;  3U43 A;  2MF4 A;  4IPY A;  4PH1 A;  3CXC O;  1UJZ A;  2JO0 A;  1L0H A;  2KG8 A;  1CEI A;  2FQ0 A;  2N6Z A;  1VQO P;  1KD1 Q;  2KGA A;  2JU1 A;  2XT1 A;  2GDW A;  3I56 P;  4DG9 A;  1YJ9 P;  3M1M A;  2PEO A;  2KGE A;  1VQP P;  2PEN A;  3CC4 P;  1KC8 Q;  2VSQ A;  4XFX A;  2LIU A;  5HGO A;  1DNY A;  1VQN P;  2BHV A;  1VQ9 P;  2XZ1 C;  1D1D A;  2VLP A;  4GR6 A;  2GDX A;  2FAE A;  3G4S P;  3I55 P;  2EHT A;  5I4T G;  2VLQ A;  1M74 A;  4PXH B;  1JJ2 O;  4M0I A;  2L22 A;  2MY5 A;  2K93 A;  3GKL C;  1VQL P;  2ONT A;  2PEQ A;  5DCK A;  5KP8 B;  4XRQ A;  1UNK A;  1QVF O;  2BUO A;  7CEI A;  1QVG O;  2JB0 A;  3DPH A;  2E1M A;  3E2D A;  3DTJ A;  3DS3 A;  4XFZ A;  3P05 A;  2L0Q A;  1M90 Q;  2LML A;  1A8O A;  2GZJ A;  2AFE A;  1YIT P;  1YHQ P;  1KLP A; 
#chains in the Genus database with same CATH homology
 2KOS A;  4PWV B;  2MF4 A;  2K92 A;  2L9F A;  3RG2 A;  1L0H A;  1ACP A;  2KG8 A;  2M5R A;  2DNW A;  2FQ0 A;  2N6Z A;  2KGA A;  2AF8 A;  2JU1 A;  3EJE A;  2GDW A;  4H2Y C;  2XZ0 D;  1HY8 A;  4DG9 A;  4IZ6 A;  2N98 A;  2FVF A;  2MR8 A;  2EHS A;  2JU2 A;  2KOO A;  2K0X A;  2KR5 A;  3CE7 A;  3GZL A;  2AFD A;  2KGE A;  2FQ1 A;  2N50 A;  2FAD A;  2MVV A;  5CZD B;  2K0Y A;  3NY7 B;  2KOP A;  2N5I A;  1X3O A;  2CQ8 A;  1T8K A;  2FVE A;  2KW2 A;  4NEO A;  2VSQ A;  4CA3 A;  1DV5 A;  2FQ2 A;  2LIU A;  1DNY A;  5KP7 B;  5HVC A;  2KG6 A;  4H2W C;  4BPH A;  5EJD A;  3LMO A;  2GDY A;  4HKG A;  2XZ1 C;  2GDX A;  2FAE A;  5HV8 A;  4BPF A;  2JGP A;  2LPK A;  4MRT C;  2KOR A;  2CNR A;  2MVU A;  1VKU A;  2EHT A;  2LTE A;  2AVA A;  2LKI A;  3EJB A;  2N6Y A;  2QNW A;  3EJD A;  2LL8 A;  4PXH B;  2KG9 A;  2LIW A;  2L22 A;  5KP6 B;  2MY5 A;  2K93 A;  1AF8 A;  1L0I A;  5KP8 B;  1OR5 A;  2FVA A;  1NQ4 A;  2LOL A;  2PNG A;  1HQB A;  2L4B A;  2KGD A;  4H2X C;  2KWL A;  4R0M A;  2ROQ A;  2FAC A;  2JQ4 A;  2KOQ A;  2CGQ A;  2L0Q A;  2MD9 A;  2LML A;  2FHS C;  2K2Q A;  2K94 A;  2CG5 B;  2KGC A;  2N5H A;  1F80 D;  2AFE A;  3GZM A;  2MR7 A;  4BPG A;  1KLP A;  2X2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...