2MY7A

Nmr structure of unfolding intermediate state of rrm-3 domain of etr-3
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
97
structure length
97
Chain Sequence
GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR Structure of unfolding intermediate state of RRM-3 domain of ETR-3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords CUGBP Elav-like family member 2
total genus 4
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2my7A00
1WTBA 2DGOA 3MD1A 5GAGU 2LECA 3BS9A 1O0PA 1M90T 3H2UB 1WEZA 1X5TA 2XB2D 2LA6A 5LXYA 3U1MA 1HL6A 4YB1P 1VQ6S 3B4DA 2O3DA 4IOAQ 3PIOQ 1WF0A 5LSOA 3UCUP 1SJRA 3G6ES 1X5OA 1JJ2R 2YTCA 1A7GE 2DH9A 1Q82T 1D9AA 2CQ2A 5BJRA 2RRAA 3Q2TC 4F26A 1QVFR 2AD9A 1R8PA 2CPFA 2MSTA 2DNHA 1HD1A 3PIPQ 1KOHA 2EK6A 1ZZNA 2DIUA 1VBZA 2MZSA 3NNHA 1VQOS 3EGNA 2DNMA 5MLCV 2MB0B 3CC7S 1HD0A 2FC8A 2MGZB 2KG0A 5DDOC 3UWTA 1IQTA 2MJUA 2MZTA 2ADBA 3CUNA 2RU3A 3SDEA 2DGVA 2LQ5A 5DDQC 4UY8T 2GHPA 2CQPA 1Q7YT 4Y0FA 3ULHA 2MZJA 4P6QA 1URNA 3J7YU 3G71S 2DH8A 1VBXA 2DNZA 1N88A 2DIVA 3CCES 2DNLA 2CQHA 3UD3P 1VC6A 1NU4A 1JJHA 1WG4A 4Z2XA 3NNCA 1G2EA 2OSQA 2VOPA 3LPYA 2DNRA 1RK8A 2MZRA 3J7ZT 2MQOA 4FXVA 2MYFA 2CJKA 5D78A 1H6KX 1WI8A 3CCJS 1M5OC 2M70A 1YIJS 2BOPA 2SXLA 1OWXA 2QFJA 3VAHA 2FY1A 2DGTA 2M8DB 1X4HA 5GAHU 3CF5Q 1NJIT 1S79A 3DLLQ 1S72S 2DGXA 2X1GA 1ZZFA 2FC9A 5LJ5Y 1FT8A 1H2UX 2KXFA 2F9JA 2N3OA 1CVJA 2M9KA 2E5GA 3G8TA 3RW6A 2I38A 3MOJB 3CD6S 1WEYA 2DGUA 2DISA 3CCVS 2LMIA 4CQ1A 2VODA 4WFAQ 2RQ4A 2AYBA 2AYMA 2M0GB 2MKHA 1SJ4P 2U1AA 2VOOA 1DHMA 1OO0B 1SJQA 2XS7A 2RRBA 4A8XA 2DNPA 4LJMA 3UD4P 2ERRA 1WEXA 2CQDA 2DHAA 1ZH5A 4OZ1A 3VAGA 1WHXA 2F9DA 2ZJQQ 4WFBQ 3G96A 3CMES 4W90B 4PKDB 1HA1A 1VQ8S 2AYGA 3P49B 1VQKS 1N52B 4J5OA 3NNAA 3TP2A 2YKAA 1SJFA 2MKSA 3H2VE 2CPHA 2MMYA 2MQMA 5GMKa 2CQ0A 1D8ZA 4C0OC 3BO4A 3FEXB 2M52A 1WG5A 1PO6A 2J8AA 3THPA 2MKJA 4V19X 3R1LA 2RNEA 2MKCA 2DNGA 2MGZA 1M1KT 2PEHA 2JRSA 5GVQA 3MUVP 2KHCA 4ED5A 2KH9A 2J0QD 4YUDA 3CCMS 1U1PA 3B4MA 1DRZA 5LSLA 3BO2A 2KRRA 2MJNA 1WHWA 1YI2S 1U1MA 1KD1T 1WWHA 2KVIA 1FNXH 4F25A 2MZ1A 2M8HA 2U2FA 3Q2SC 5JVHQ 1F9FA 4WCEQ 5IM0A 1VQNS 4CH1A 2CPDA 3RW7A 1U1LA 1SJ3P 2MKKA 2VONA 2A3JA 1B7FA 4QQBA 3G8SA 1VQ9S 1BY9A 2K8GA 4ZKAA 1Q81T 2D9PA 3DXBA 1VC5A 2HGLA 2NLWA 2MSSA 1UAWA 1OPIA 2CPJA 2EK1A 2HZCA 3VALA 1U6FA 3SXLA 2OTLS 2KRBA 1WF1A 1FJCA 4ERDA 2LXUA 2EVZA 3EGZA 5ITHA 1WI6A 3TYTA 5CXTA 2LEBA 2DHGA 2MQQA 3CCUS 2MQLA 2LXIA 1FO1A 1KQSR 2MQNA 2KFYA 1WG1A 3P6YC 2KM8B 2KM8C 2QA4S 3IRWP 2DNQA 2RS2A 2M4MA 1U6BA 2J76E 1FHTA 2X1BA 1Q86T 2E5HA 1K8AT 2CQ4A 1W2BR 2DNKA 3ZZZA 3THTA 1X4GA 2QEXS 3TO8A 1X5PA 2MZQA 4QPTA 4CH0S 5DETA 2YH0A 3CCRS 3CC2S 4PR6A 2DGQA 2JVOA 1WF2A 4Y00A 1X4CA 5LJ3Y 3CCLS 2CQ1A 4TLQA 1L3KA 1YHQS 2ADCA 2E5IA 3US5A 2L08A 3BEGB 3MUTP 2X1FA 2MHNA 1K73T 4QU7A 1YWXA 1N54B 1DZ5A 1VQ7S 4OZ0A 3D2WA 1U1RA 2BZ2A 1FJ7A 4IUFA 4LMZA 1U1QA 1M5VC 3VAFA 2KU7A 2MPUA 2L9WA 1UW4A 3CTRA 3MURP 2RUGA 3BO3A 3UE2A 3MI7X 2KXNB 1VQ4S 1U1KA 5HO4A 3IWNC 2DK2A 2CQCA 1U1OA 1X4BA 4TU8A 2UP1A 4UQTA 2CQBA 2N3LA 2LKZA 4C7QA 5H1SV 2FPHX 2G4BA 4WIIA 5DDPC 2XS5A 2XNQA 1XN9A 2DHXA 2NZ4A 3CPWR 3CCSS 1X5SA 1FXLA 4C4WA 2J0SD 4IOCQ 2FHOB 5DDRC 3R27A 3G9CA 2N7CA 1X4EA 2DO0A 2MXYA 2AYEA 3I56S 3G4SS 2DH7A 1R8HA 2JX2A 1VQMS 1QVGR 1UP1A 1WELA 2KT5A 2LEAA 5HL7Q 2DNYA 2CPZA 2D9OA 2KI2A 4QU6A 2HGMA 2RQCA 1YJNS 2LYVA 4PRFA 2E5JA 1QM9A 4LIRA 3EX7B 1KC8T 2RT3A 2MQPA 1WHYA 1X4DA 1P27B 2OTJS 2XNRA 2DITA 2YWKA 4BS2A 2RVJA 4TU7A 3NMRA 1VQ5S 3CULA 3R1HA 2DNOA 2MY8A 1SXLA 5JVGQ 1WHVA 1DBDA 3P3DA 1OIAA 3CMAS 2F3JA 2JVRA 3S01A 4W92B 3CC4S 3L3CA 5GADU 1M5KC 2KXHA 2DO4A 2HYIB 2V94A 2DGWA 3HI9A 5IFMA 2YH1A 3UCZP 2N82B 3VAIA 1UFWA 2OJ3A 2I2YA 2OSRA 1P1TA 2MKIA 1N8RT 2Q79A 1YITS 4M5DB 1A9NB 3SDEB 3U1LA 3MD3A 1VQLS 2KYXA 2CQIA 1YJ9S 5FJ4A 1RKJA 3NS5A 2M2BA 2M88A 5IQQA 2RS8A 2GO9A 3V4MA 3N9UC 3S6EA 1M5PC 2HVZA 3HHNB 3LQVA 5CYJA 3SMZA 3VAMA 2WBRA 3K0JA 3VAKA 2DHSA 2M7SA 2E44A 4YOEA 3VAJA 2B0GA 4TU9A 2CQ3A 2G1DA 2MY7A 5D77A 2OIHA 1KOOA 2D3OR 1VBYA 1H2VZ 2HGNA 1X0FA 2DGSA 2LCWA 3I55S 3OW2R 4CIOA 4EGLA 2CPIA 2CPEA 2CPXA 2G0CA 1U1NA 2CQGA 1PGZA 4IO9Q 4RU2A 3MDFA 3JB9k 3S7RA 1K9MT 3CCQS 2KG1A 5CA5A 2X1AA 1NO8A 2L41A 1JMTA 4U67Q 5GAEU 2XS2A 2ZJRQ 2CPYA 3ZZYA 1VC0A 1YTYA 3S8SA 4WFNQ 5DM6Q 3VF0B 3P5TL 1X4FA 2DB1A 5IM0B 2XSFA 2LA4A 1AUDA 2K3KA 3UCGA 1U2FA 2JWNA 4FXWA 5LXRA 1JJ4A 3NS6A 3MUMP 4WKRA 3CXCR 4F02A 1FJEB 1H2TZ 1YJWS 1X4AA 2ZJPQ 5DM7Q 1VQPS 2DNNA 5EN1A 3MXHP 2KN4A 4WF9Q 3FEYB 2PE8A
chains in the Genus database with same CATH superfamily
1VRUB 2ZE2B 2Y0BB 2VC0A 3MD1A 2ZOGA 4MTPA 5GAGU 4O0IA 5EWGA 1SQGA 1T0TV 1T02A 1WEZA 1X5TA 4OQJA 5LT5A 4QR0A 5LXYA 2A18A 2Z58B 2E1RA 3DRPA 1RI7A 4WTYA 4UOGA 1XMOF 2QLWA 4IFYB 3V4IA 1VQ6S 5HANA 3PIOQ 5LSOA 4USVA 4RWXA 2C42A 2F40A 1NDCA 3M30A 2KHDA 5EX0A 2EPIA 2Z2ZA 4JI8F 3A4TA 2CQ2A 3Q2TC 3KLGB 2VB6A 1MMLA 1M5HA 3I5BA 4J7CA 3D4JA 1U24A 5B09A 1SKRA 1LV5A 2JEFA 2MSTA 2DNHA 3W8GA 1YZ6A 2W2NP 5B0AA 2R8GA 2IA0A 3CD0A 4QWAA 4R8UB 2YX4A 2M3DA 2HVDA 2GW8A 3Q22A 1ZZNA 2ASLA 4K59A 4Q0BA 2VFRA 1TL5A 3NNHA 1T9UA 2B4PA 2JFDA 3DDKA 3N0VA 2MEWA 2VDHA 4P2FA 5MLCV 1PJ6A 2VHGA 5L8RC 3I4HX 3LH2S 3UN3A 3MPVA 3H5UA 1PSDA 3CC7S 4PQUB 4LRBA 4C11B 1T9WA 4X4PA 5DDOC 3K7RA 2XC9A 2MJUA 2MZTA 2R7TA 3CUNA 3SIPB 2DD8S 4A8QA 1RYRA 1NH7A 3TZXA 4G1QB 2DGVA 2YKQA 5DDQC 3OTEA 3TEGA 1LWFA 2GHPA 4M5GA 5ETLA 3TJAA 5EDWA 3V81B 3OVBA 2NR0A 4P6QA 2HZVA 1HMVB 1N32J 1Y5LB 1XNQF 5AXMA 3IM9A 2IYGA 1LXNA 2GX8A 2DNZA 2MTLA 3IAS9 3CCES 2J9EA 3C14B 4DLGA 5KOWA 1VQYA 2ZZNA 2DNLA 2PGCA 3EZUA 3L95X 4LT6A 1XC9A 1Q4RA 2CRLA 1RT6A 4OI1A 1IKVA 5KT6A 4QW9A 1N48A 4FF3A 3KTQA 2VOPA 2OSQA 2OAUA 2XY6A 4M94A 2HQFA 2AV5A 4K4UA 1KKHA 2MZRA 4C3LA 3KMSA 1C1CB 1B70B 1HIYA 2MYFA 4O44A 3I0RA 5D78A 1D1UA 1NXIA 1QAJA 1FTCA 2M70A 2SXLA 4V1Ak 5K14B 1B4SA 4LF6J 2R7XA 1SH2A 4NEYA 3ZZTA 4QWEA 3HPOA 5M2RA 5GAHU 3NGRA 3CF5Q 1IM4A 1JQGA 3O44A 2XYHB 3EGVA 3ET6B 3V6HA 1N33F 4HHJA 4E0DA 2ZD1A 3EVMA 2X1GA 3IGNA 2LQJA 3ILLA 4OYMA 4UF4A 2YNGB 3M2VA 2BX6A 5KT2A 1OMSA 3EPGA 2ZHOA 3J80U 2YX7A 2KB2A 4IO1A 2HHPA 1S9FA 2M9KA 1RA6A 2OP5A 3BYPA 3CB4A 3MR2A 1QLNA 2E5GA 4C8ZA 1BQNA 1YGYA 4LRFA 3G8TA 4B3OB 4FN5A 1FE4A 1VQSA 3ETMA 1HW9A 2AKWB 4RL1A 4AUKA 4YHHJ 5L39A 4DSFA 3SZ2A 5DQHA 3KYLA 1LW0A 2DGUA 2Z2MA 3IRXA 2FTRA 2DISA 3CCVS 4F50A 3RU0A 1PYOB 3QRQA 4CO0A 4CQ1A 1RBLA 5I3QA 2H4YB 4MFBB 2AYBA 1CSJA 1WC3A 3FMWA 2XTJP 3HP6A 2H5IB 4OV6A 2HVEA 5HLFB 5CZXA 1SJ4P 2JC0A 1WOPA 2XM3A 2BRKA 3V4IB 1B64A 1HYSB 5GAEI 4LF1A 2BJ8A 5ETKA 1GX6A 1Y3JA 1LEOA 3V6KA 2IAJA 3ZNJ1 2IA6A 1MLAA 3BKUA 2F4VF 2GA7A 2V2VA 3GIRA 3HSDA 4ZVHA 4EBDA 2ERRA 2WVEA 4O4RA 3H5SA 1S6UA 2BKPA 3OQ2A 1RADB 2GGPB 3GTYX 4LQ9A 4NLOA 1TELA 5L9NA 3FMBA 3R5GA 1YJUA 1UWBB 5HQLA 3TJ8A 4YN3B 3G96A 4F4WA 4A8SA 3CMES 2BW7A 2ZKTA 4ZCLA 3JYTA 1F9HA 5LL6d 2M5YA 4DEZA 3HO1A 3RRGA 2WW8A 4KB7A 4LR8A 4PKDB 2ASJA 2XGQA 3EM1A 1Q0NA 2AIRB 1N52B 2R4FA 1RHQB 3Q8VA 3TP2A 1DTTA 5HQ8A 4KHRA 1R7IA 3O6QA 1DURA 3BSOA 4C8KA 3KLGA 3PV8A 2P9EA 1SQFA 4NZ6A 4DU7A 1ZTTA 2CQ0A 4IR9A 4FS2A 4ELUA 2ILYA 3RBZA 4QCLA 2CWXA 3H20A 4ZCKA 1PO6A 2PFFB 2HS0A 4V19X 2IM0A 2O1PA 1B0TA 3TNVA 3ZZOA 2YWHA 1S1VA 2MGZA 2R2RA 3TZZA 2XMMA 4ZP8A 2JRSA 2HHTA 4YHHF 4XPCA 2CIMA 3B8HA 2HNYA 2KHCA 1IKXA 3NXZA 1X8DA 3M1VB 1HARA 3UVJA 2I5JA 3AY0A 4X65F 1HQUA 2UXCF 1U1PA 3O3LA 2QC3A 4R5PA 1F3FA 4KPCA 1DQ9A 3QYYA 5L38A 4DL3A 1RA7A 1WHWA 1R6YA 6FD1A 1YI2S 1U1MA 2OELA 3F73A 2R7VA 2YQ3A 1U8WA 1WWHA 2A10A 4NPOA 1RTHA 1GMVA 3K5OA 1RHKB 5JVHQ 3U1NA 1F9FA 1ITPA 1HI8A 5IM0A 5HI7A 4OZJA 3SCJE 5E3QA 1CC8A 1FDDA 2MKKA 2UUCJ 2VONA 2UVVA 2FHMA 2QTWA 2WCXA 3A13A 3KFWX 4QQBA 1KR4A 1BY9A 1YX2A 4EO8A 5K8MA 1MN7A 4F4ZA 2D3UA 3PM9A 3KWMA 1FX4A 3D28A 3DXBA 4ZJOA 4DOZA 5AJ3J 5ETNA 4JI4J 3DYAB 3UNGC 3BR8A 1GMWA 3FFIB 2DXEA 2IC3A 3LP1A 1Q7LB 1FVSA 2BJ7A 2HZCA 2CNKB 4RW4B 1U6FA 2OTLS 2GNKA 3TVKA 3M2RA 1RTIA 2B8PA 1Q5VA 3RB6A 5ITHA 3T19A 2RJZA 4YB5A 3TW0A 3MEDB 5B0EA 2FVRA 5HVHA 4J37A 1TKZA 3M7VA 5KFEA 2MQLA 1RBAA 4IQMA 5SZTA 2LXIA 1FO1A 2RDDA 1KQSR 2PMWA 1FWPA 1DARA 2PEBA 2QLBB 3CJKA 9ATCB 1SJ1A 1U8SA 2QA1A 4USIA 1VK3A 1TL4A 1VCTA 3MMJA 1KFDA 4B17A 4B3RF 4HI2A 3A12A 4RBTA 2HQDA 3T1AA 4UOFA 1XTZA 2CXEA 3QIDA 4DV4F 5DG7A 1REGX 4RU9A 2J76E 2QSFA 3RAMA 4MFBA 3OJUA 4MKYA 4DV6J 5IOLA 1FHTA 4N77A 2XG8A 3JAMU 2AQ4A 4N41A 4RW4A 1H7WA 4ES2A 2FVCA 2CQ4A 1CG2A 1K8AT 1S6QA 1W2BR 1LWCB 1IKYB 2DNKA 1TKTA 3ZZZA 4DL4A 1S9EA 3OSNA 3OR2B 3Q8SB 1SI9A 2FJBB 5FLXY 1KRPA 5HK4A 2E9ZA 1JLBB 2QEXS 2BR0A 2OUGA 4FP9A 1JLGA 2RUSA 2OH2A 1HPZA 1VHIA 2W9CB 4LF8F 4NXMF 1UTAA 4KGZB 3QWPA 4H4MA 4E8UA 2EC2A 2YH0A 2O67A 1X31C 4ZPTR 2JVOA 3MGJA 1I6JA 3QFHA 2GIRA 3HD2A 3MM9A 1X4CA 1S1TB 2VASA 3VTIA 1HQ2A 3W1YC 5KFKA 2VIHA 1S97A 1L5UA 3KLHA 1H98A 2VPYB 2QT7A 1YHQS 3P4UB 3WIVA 4B3MJ 2IFXA 1G7CB 2YWEA 4DR6J 2YNIB 4KGVB 4J91A 3SQGA 4H4OB 4R5PB 4WFYA 3E01B 1P1LA 8AT1B 1AUSL 5F3ZA 2X1FA 1DFDA 5KG0A 1CULB 1RWUA 4IG0B 3QRPA 4OX9F 2YNFA 1SQEA 3B6BA 4TYBA 3AD8C 1JLBA 1SH3A 5DQIA 4DCJB 5C42B 1T95A 1E6VA 4OZ0A 1HPZB 1U1RA 4DQIA 4L6V3 2BZ2A 3KDOA 2I0XA 2J7WA 3DMJB 2OPSB 4CWBA 3VAFA 2KU7A 3Q8YA 3VGVA 2JLEA 2L9WA 1FEEA 1QY7A 5G0RA 3CDBA 5KFPA 1T8EA 1SIWB 1K1SA 4H4KC 4PABA 4G3IA 2EFVA 2C3YA 1U1KA 3W5XA 3RBEA 2GS8A 3BPSP 2DK2A 3UDEA 1NJWA 3T1YF 3UFCX 2WB4A 1TVRA 2PT0A 2B9EA 2YQ0A 4NLRA 4PG5A 4QWDA 3DOLB 4FDFA 4Q44A 1I94J 2NXUA 2LKZA 3AOCA 4QJVA 5H1SV 2FPHX 1V5IB 2E7VA 1RT2A 2DY1A 3IS9B 1MN9A 3QMQA 3R5CA 2E5LJ 4Y2CA 3MCSA 2ZOMA 3D0GE 3ELHA 3TZWA 2DHXA 1OY9A 4KHPJ 2HK2A 5HN0A 5M2UA 4M5MA 4OI6A 2AJQA 3BGRB 2OLWA 5GADI 2DR6A 5HVGA 3HVRA 4B3SF 2D3O1 4CLKA 5D4OA 3H2LA 4M95A 2QMUB 3WX4A 1HHTP 3NMAA 1FXLA 4QWCA 4ANEA 1XQIA 2XWXA 3GR1A 4ITSA 1T7PA 3LGNA 1OSDA 2G0JA 5IT9Y 2CZ4A 1HWIA 5H9EJ 2Z8QA 2MXYA 1WC6A 3IO1A 4NLPA 4WU2A 3RUBL 3BGUA 3KUEA 2H3EB 2DH7A 4OZ5A 5D8HB 1VYAA 2JX2A 4U8YA 2Q1LA 4A8KA 2CJBA 4ZVSB 3G82A 3IS9A 4P2SA 4MIAA 2DNYA 2CPZA 4O3PA 2BANA 4UOCA 2ALZA 2NPFA 3CJRA 2CJ9A 1VRQC 1ZA2B 1TKTB 2P2CB 3FCVA 4OI3A 4BBYA 1CJTA 4DV5F 1OYDA 2R7UA 1UW9A 1Q53A 4LUBA 2VG7A 3K5PA 3DM2B 2V63A 3HFKA 3HULA 3HHDA 5DG9A 4NEZA 3K5NA 3NGTA 3I0SB 3PRVA 1CQMA 1WHYA 3BSNA 1X4DA 2B4OA 4ZPWR 3NGDA 4DR5J 1HBOB 1VJWA 3ISZA 2XNRA 3R2DJ 4GKJJ 2DITA 2OTJS 1EB0A 3PYGA 2DYAA 3J7YI 4JYAJ 1PKUA 4LMZA 2DNOA 2ASYA 4I7FB 3LO3A 1BLUA 3NLCA 5AJ3F 4ED8A 4OJGA 4TKTA 1WD6A 3MTJA 1U48A 3SI8A 4OZ3A 1AZSA 4PG7A 3CMAS 1WOOA 1RZMA 2IBKA 2RAQA 2DCLA 2Q43A 3TVYA 1L3SA 4I69A 3IN5A 1HBNA 3PO5A 3AJ2A 3BBCA 4ZPVR 2H4WB 1M5KC 4ANDA 3N6LA 4KFBA 3DLGB 2W9CA 3RRKA 4A48A 3WHIA 2AGQA 3DN9A 1BQXA 1SPBP 3VAIA 3PRDA 3PW5A 4PXEA 4LQ3A 2IRUA 3JQKA 2ZUAA 2EEYA 4ZVFA 4HH0A 1OJ4A 1VJQA 2R2SA 5ETVA 4KHMA 3POTA 1DY3A 1P1TA 1ULRA 3GYGA 4BC9A 2MKIA 2N4DA 3R8YA 2W8LA 3RAQA 1IVZA 1A6LA 3KLFB 3P45B 3HK2A 1HHSA 4XDDA 2XLIA 4ECRA 2YNIA 3SDEB 4ILLA 3MD3A 4FYXB 1UEUA 2GC8A 2W1BA 2J7KA 5K8PA 1VQLS 4X4NA 2ZM6J 5FJ4A 4IDKB 4CT9A 2BDPA 2QLXA 4J9RA 9RUBA 2J9DA 4YY3F 4G6VB 4GMKA 3HHNB 1Y11A 5CQGA 4RR5A 3VAMA 3TAMB 4DV0F 2DR5A 3ILJA 4DR2J 1NK4A 2OMLA 1RT1B 4EZ9A 3MM5A 3MECA 4RW7A 3K0JA 2NUUG 1K0TA 4TNOA 3SQOP 2DHSA 1ZETA 5G0RB 2HHUA 1JLQB 2GHWA 2CQ3A 4CM0A 4Q43A 3W62A 1U25A 2VQFF 3BF4A 1KOOA 3A8IA 1TVRB 5LM7E 1FKPA 2D3OR 1JXLA 4CO5A 4FF1A 4C8NA 2DGSA 3AAWB 3FKBA 2V67A 4JI4F 4V19J 4X4UA 5AE2A 3C6UA 4CIOA 4ELTA 1IBLJ 4I67A 4ZVUB 2HHHF 1S1UB 3DCAA 2G0CA 1IXKA 4MIBA 4W98A 2HKEA 3WX8A 1U1NA 5B7WA 2E1AA 2KL8A 3BGRA 4XIUA 1UA0A 2UUCF 3D0HE 5KFYA 4B9LA 1NZAA 1LWXA 5GMDA 4IO9Q 3MAHA 5HQMA 3KHRA 1DTQB 1RGVA 2HURA 2HRTA 4ZOSA 1FEHA 4AE5A 2XGPA 4P73A 4JI6J 3MDFA 4UQGA 4DWIA 1N5VA 3BGLA 3I9ZA 3SCIE 2DPIA 2VG7B 4UUWA 4CLPA 3DM2A 3HT0A 2X1AA 2HNDB 2HNZB 1WSVA 1T11A 3Q83A 3W2VA 2XMTA 2CPYA 1VC0A 2WVDA 2Y8WA 5FIIA 1YTYA 3S8SA 1CJVA 5KFFA 3GFHA 3MEEB 2O5DA 1X4FA 2DB1A 3KMQA 1EQ0A 5ETTA 1EETB 5C24B 3IC1A 2XSFA 3G82B 4OJHA 4JI1J 2OFHX 4AXIA 2V4RA 2FHKA 4NCAA 2ZFHA 3VVTA 3ILIA 1AUDA 4JI2J 1EQMA 3BN4A 3UCGA 2C2EA 3C46A 2KZZA 1TL1A 2JWNA 1FVQA 2HQIA 4C2MA 1LK7A 3ZC4A 4OJ1A 3FQLA 3T5JA 3K58A 4YDDB 1SL1A 2RDJA 4F02A 1RLDA 3QGHA 1Y5IB 3FZBA 5IWAF 3T5HA 2UU9J 4LF6F 2IM3A 4Y34A 1FX2A 1KONA 1R3NA 3M4XA 1NHKL 5DM7Q 3CIZA 3C3LA 4QYZK 4LSNA 2FDNA 4YB6A 3MXHP 3W2VB 1RWPB 2B9WA 1ZA1B 3WDOA 4AYBD 3MM7B 2EFQA 2DPJA 2I8EA 1JXVA 1EJ7L 1KFSA 2R9LA 3SCLE 1J27A 4UZBA 2FYXA 1O0PA 1JLCA 2AX0A 2EG2A 1T03A 1WKJA 3PX0A 3MR7A 2XHWA 1HQEB 4YB1P 4DFPA 3CJ3A 5HBMA 4RX6A 3F44A 1JKHA 5ADZA 2PI5A 2O3DA 2NUHA 3R7NB 1WF0A 4LRDA 5EWEA 3UCUP 1ZOTA 4JV5J 4BHQA 2QX0A 4C8OA 4ZIVA 4HVZA 2DH9A 2LQ8A 4W4MA 4N7TA 1I51B 3JTPA 4GVBA 1R0AA 2MHEA 2XI3A 4NI2A 4EUVA 1RXOB 1MNEA 2OPPA 3CCTA 3N4WA 1TFWA 3I87A 3CMQA 4DV2J 2AD9A 1ZM3A 2CPFA 1N5SA 4CO3A 4AXJA 3UR3C 1B3TA 4NCBA 3QAEA 2Z56B 2DIUA 4DV6F 4CLSA 2MZSA 1YBTA 1BQMA 1G6BA 3DLJA 4LF7F 4CNYA 3DLEB 4PPZA 3TARA 1HNXF 4GKKF 2LFVA 4B3TF 2QIFA 1AROP 3O8WA 4I68A 4WJBA 3OJSA 3M8SA 2HMIA 1JJCB 2B5JA 1JKHB 4QBUA 2FC8A 4WBFA 1HI0P 4S0MA 1BC6A 1IQTA 3GILA 1SC4B 3C6UB 1XMQF 4RW8B 4DSKA 4ELVA 2R8IA 4K4ZA 1MSWD 2RHSB 3FSYA 3CW2C 5A8RB 2KZMA 2IDEA 4LF5J 2R7SA 1B0PA 2VDIA 1RAGB 2HQ3A 3RGIA 1N5TA 4DV2F 4X66J 2CQPA 2OPPB 1Q7YT 1HNZF 1LOUA 4MK9A 1URNA 4PYAA 3MEGB 4RW9A 2AGPA 1DTQA 3G71S 2V68A 4HH1A 1VBXA 1XWLA 3QJPA 1N88A 3DOMB 2GMJA 2AX1A 3BZQA 4NA1A 2HBQB 1BQMB 2CQHA 1VC6A 1HMVA 4WTOB 4X4OA 1JJHA 1WG4A 3IBCB 4C0BA 1G1XA 1DQAA 5L9XA 3NNCA 1G2EA 5E3PA 4HYKA 1NDPA 4U9RA 4EWTA 4C0HA 5J2MA 1FK9A 2ZBPA 1GAOA 3R9LA 2MQOA 4ZLPA 5LMNJ 4FXVA 2CJKA 1TUVA 2KFZA 1REVB 3TA0A 1H6KX 3LPEA 3CCJS 1M5OC 3UI3A 3QJLA 3KHLA 4TVAB 1RP5A 1OWXA 2QFJA 5D3GB 2RB7A 3QIPA 3P8BB 4P7VA 3C16A 2VICA 3CGIA 2M8DB 1X4HA 4O44B 1ZPWX 4NYOA 4DHVA 4RUBA 3BPDA 1S72S 4LFBF 3EE3A 3TEHB 1KQKA 4O3OA 5A76A 2DGXA 3PKYA 3QLHB 4DR5F 5IWAJ 1E6YA 2BJEA 1ZZFA 2QSWA 1S1XB 2FC9A 3H90A 3IBFB 1F2HA 4P71A 4WP8A 1FT8A 4HTJA 5JUMA 4ER8A 2F9JA 4DMZA 4OL8A 1T05B 5ETSA 5F8HA 2EXUA 3NP5A 4XDCA 3PYEA 4I2PA 1VMBA 4NMLA 3QO9A 2FJVA 4EI2A 2YPYA 1BUXA 2I38A 3BQ2A 1D9DA 3MM7A 5IQ6A 3Q0AA 4OHVA 3KK3A 2IRYA 3CO9A 1NK0A 3NRBA 3D1QA 1Q16B 3CD5A 4F67A 2YKNB 2UV8G 4WFAQ 3AQPA 3M6WA 4AD6A 2CVIA 2R7OA 3T5LA 1UVIA 2HRUA 2V9WA 2HHSA 4NLVA 1XMBA 2AYMA 3AA8A 4QIWD 5AXLA 3IRXB 2MKHA 2ZZTA 2U1AA 3GSIA 1TTHB 4KSEB 5A6PA 5HBMB 2HG4A 3T6BA 5F9NA 1OO0B 4DL7A 2AEFA 3LAMA 3RB4A 4JI5J 5DRKA 1C0UB 2ZDOA 2JDJA 3A8EA 3PACA 2HVHA 1HR0J 2WSFC 4GVBB 2BA9A 1R0AB 3AD7C 1WEXA 4U7UK 4C6AA 2CQDA 2BQUA 3QFWA 1KN6A 3LW5C 2W4PA 5D4PA 1WHXA 2RIJA 1L3VA 1TUGB 2F9DA 1F3VA 1YRTA 2ZBQA 3OFFA 2VG5A 4M63A 3DGPA 3KLIB 2ZJQQ 1JNZB 5B0DA 2O01C 2AJ0A 2YKNA 3R5AA 2AMCB 3DLEA 2Q6BA 2V2KA 1HBMB 4YDXA 3OFGA 5A6WA 1QSYA 1SBRA 5IC4B 3FBEA 2W9AA 4RUHA 4LFAJ 3AXKA 4I4BA 3NNAA 3HVTA 2ZNYA 1SJFA 1ZPVA 1NCLA 4NI2B 2VFSA 1I3OB 3W9JA 1WC1A 3QT7A 1S10A 4OHXA 2YWGA 3W7BA 4CO2A 5DGBA 3PW4A 4JYAF 3W9HA 4C0OC 2C28A 3FEXB 4DCOB 3J81Y 3E8OA 2M52A 1WG5A 3W8PA 1T9YA 5AE3A 2JJ4D 3R1LA 4KO0B 5DQGA 2IY5B 2MKCA 4C8MA 3T41A 4NYPA 1K0VA 1PJ7A 2PEHA 1SV5B 4BDPA 2QO3A 6FDRA 3EMTA 2YBVA 3FCWA 4B3TJ 2KH9A 2BRLA 2J0QD 4YUDA 3CCMS 2VA3A 4CLLA 4WXOA 4R8UA 1BD6A 2X7IA 3BO2A 1DRZA 4IRDA 4N8OA 2OO4A 2IYIA 3DRRB 4RW8A 1VQNS 1RTJA 4NCGB 4DV1J 1IBMJ 3UVJB 1S76D 4FXDA 3J81U 5L1LA 1KD1T 4U6PA 1HHQA 1YQHA 2UUBF 3AB2B 1S49A 2M8HA 5D3GA 3KHGA 4RNHA 4DF4A 4B3MF 3C16B 4WCEQ 3IR6B 1UETA 3Q8UA 2R42A 1RAAB 1XR6A 2WZ1A 3GR0A 2CAJA 3MAAA 4RBUA 5D4LA 3FRZA 1U1LA 1N0UA 2VJUA 2WOMB 5HP1B 1LQ9A 1B7FA 3MTKA 2DY9A 5BYQA 3G8SA 3D54A 5KFNA 1FWLA 2VL1A 4ZKAA 3TI0A 4JV0A 4PAAA 3O5TB 1VR6A 1Q8BA 1QE1A 2R7QA 5J2NA 1Q81T 5KFTA 2EG1A 3MM6B 3OFEA 2W24A 2XQCA 3FSXA 2HGLA 1N32F 1PYTA 3R5DA 2P5VA 3KK3B 2EK1A 2WVFA 3W3SA 3GFXA 3G87A 1Y9OA 3EJMA 4YR3A 4LSZB 1WF1A 4DSEA 1S0OA 5H9FK 3R97A 2W8KA 2LXUA 2EVZA 3SV3A 3DYAA 4M5JA 4JI5F 3EGZA 3CJTA 3D7SB 4DQQA 2EI5A 2HAFA 3RG6A 2DHGA 3NY0A 3KG1A 2ALYB 2GQCA 3BDEA 5DO2A 4B3RJ 1RHUB 2BM0A 3A3NB 2QV6A 3KUHA 4OZLA 1Q95G 2BYCA 1T05A 1NNDA 1WG1A 3OL9A 2D69A 4N8NA 4XPEA 1U47A 2KM8C 5KFAA 1BWVA 4ID5A 4UZCA 3KK2A 1RAEB 3ET6A 3FK4A 1B0VA 4KGKA 2QA4S 1SC6A 2IJFA 3DRYA 2DRAA 4JI1F 3OLAA 2DNQA 1UJ6A 2DEIA 3MM6A 3QAUA 2Y1JA 1M0SA 1TQLA 1CJUA 2YKMA 4TY8B 4QWBA 4ZCMA 1TK5A 2EKYA 2ZE2A 4UW2A 4DV7J 4U7UD 1Q86T 3VGUA 3D1OA 3OTOF 4MK8A 5KFUA 1PIEA 1QUPA 4DUZF 4O23A 4OYOA 4B9SA 1HBMA 2W2OP 4MKAA 2CKWA 4RPFA 1XJWB 3C66A 2HFOA 1YVFA 2VBYA 2ZITA 3BYRA 3QZ8A 3BM7A 2ZNZA 5KFHA 2J0WA 3D3CJ 3EZ5A 2FB0A 3TUIC 4DLEA 4I0WA 2K3IA 3CDWA 1R6VA 1KQGB 3D6MB 3PXGa 2ZHAA 4JI3J 1RCXB 4QPTA 4ID5B 2UVRA 2D7SA 1FERA 3UW1A 3NOCA 4CH0S 5JJBA 5IZHA 1JLFB 2BABA 3KOAA 2V50A 3MAQA 4B9TA 4PR6A 2BQRA 3C8YA 5A2QY 3GV7B 1NKCA 1WF2A 2RMLA 5LMUJ 4DFMA 3PW0A 2RRNA 2F8HA 2EFNA 1V9OA 1YK9A 1GTHA 4CLYA 2CQ1A 4P10A 2QN6B 5KG4A 3PYFA 4TLQA 3OTOJ 1NSAA 4X66F 3GPAA 5E0OA 1XNQJ 2HVIA 4R25A 2E5IA 4Y2AA 2ZEJA 3H7HB 3US5A 3KLHB 4QIGA 2A6OA 3QBCA 2CWKA 2HLUA 1NJXA 1RQ0A 2MHNA 2XYGB 3M2UB 3BREA 4ZCIA 4A8WA 3DGVA 1ZAVA 2AWZA 3I9V9 2DJWA 3BSAA 3SSRA 4DPTA 2BM1A 2XMAA 2IVFB 2JOQA 4K8RA 4DQSA 3DLBA 3I4PA 3D2WA 3AOAA 3DI6B 1MU2B 4WZQA 2NXNA 2C2MB 4RKUC 4J9PA 1HKAA 2K7JA 2ILZA 4G1QA 4NWBA 4Y3CA 2XBPA 4DL0C 2COLA 3PW2A 4MK7A 3ZTQA 4DV4J 2G2YA 3UN2A 3MAAB 2D3ZA 1UW4A 3IWXA 3NCRA 3BO3A 2FVSA 2BJ3A 1KLMA 4XAKA 3MI7X 2KXNB 4Q2MA 4DDFA 1TK8A 2VU5A 2J9CA 4OYIA 2B6AB 5IV3A 2CQCA 3THVA 1X4BA 1RTJB 4NCGA 5AXKA 3PR4A 2R8HA 4DFJA 2UP1A 4LFAF 2W2PP 2CG8A 2H48B 3DLKA 3HHKA 2DRDA 4URQU 4JI6F 2R2TA 4K2XA 1S57A 2G4BA 3E3XA 3LOUA 4NL5A 4ETZA 1AT1B 1IKXB 4Z7YA 1F9EB 1QDUB 3DOLA 4RNFA 4X4RA 1HQUB 1K44A 2XEXA 2F63A 4OHYA 1RTZA 3I0RB 2LP4A 4A4JA 5IXUA 3K59A 1UPPA 4DSIA 3K17A 2NZ4A 1WUUA 3BR9A 3R7SB 3K57A 5A8KB 3UDCA 4CRJA 1IBLF 2V6AA 5BYSA 3CPWR 1X0PA 1FDAA 3G6XA 3T5KA 3BN7A 2QL5B 1RKIA 3MOZA 3OHAA 3PJWA 1PAUB 2OEMA 4DPOA 5EWFA 1JWWA 4NLTA 4Q7AA 4KJIA 1EP4A 2NREA 4M5HA 3O1LA 2HFZA 3I32A 3MWBA 5DDRC 2E9TA 1X4EA 3JS9A 4CLZA 3IMQJ 1O5JA 4K0KF 3FBCA 5KT5A 2VQEF 4ECTA 2G1HA 4ZVRB 2GQ2A 3PY8A 3G4SS 3HSJA 4AQYF 3AB4B 3PNIA 4RBVA 1HNZJ 4DQPA 1TL7A 4OHWA 1TP7A 4ZPBA 1M1GA 2C2RA 1WELA 3PR5B 4PYDA 2RH3A 2UU9F 2RKIA 4KV8A 2NSBA 3L09A 3QATA 2D9OA 3CWJA 1U02A 2HGMA 2RQMA 3HHEA 4HHUA 4QYRA 1YJNS 4F4AA 2HFNA 1NMEB 3PG9A 2IC3B 3LP1B 4AL7A 3WZ0A 2B51A 2XSJA 3MR6A 4WKYA 2ATCB 3EX7B 1KC8T 3TQEA 4AL5A 2RT3A 3OVSA 1WNEA 2RDIA 1XNRF 4PQAA 3R6LB 1YLXA 2WAQD 1J5EJ 2P6SA 1YJVA 2Y3YA 3RBXA 2YWKA 4BS2A 4TU7A 5B0FA 1JLFA 4FNHA 2OKQA 4I6WA 2GFFA 2GQQA 4B9MA 1AXQA 4ZPAA 2XHCA 3P3DA 5KFSA 3C19A 4C48A 1AW0A 2JVRA 2RKIB 5HJXA 2IDLA 3ZTRA 4W92B 1NK9A 2CYYA 2DO4A 2PO4A 3LP0B 1YRUA 4WK1A 4ES3A 5I3UA 4F4KA 3LP2A 2YH1A 3CO0P 1NSQA 2N82B 3KLEB 1RBOB 3CJ5A 3W5YA 4HR2A 2I2YA 1RHRB 2OSRA 1W2IA 1GXLA 5E5NA 1VLYA 4Y65A 1FRIA 2Z4PA 3CSKA 3S1TA 2ZH2A 1RAHB 2H9ZA 2RHQB 3ICLA 2XY7A 1X9MA 2UUBJ 2XZTB 1SC3B 3FEZA 3GYNA 3IBWA 5E3RA 1NPKA 1V3SA 2VPZB 3POTB 4KY3A 3RB3A 2CQIA 1RWWB 2KT2A 5A0YA 1RACB 4DV0J 1YJ9S 1ACMB 3NG8A 3QGGA 3IA0A 2B56A 3L4BC 2QJ3A 5MAOA 1NLKL 2I5JB 2YY3A 2CA9A 2PIIA 3D6HB 4WE1A 2JEGA 1AFIA 1B99A 3LQVA 4K5RA 1Q1KA 1RUSA 2ZM6F 4ZVPB 1KDNA 3E2EA 1R43A 2QA4G 2WBRA 1DAXA 2WVBA 3H59A 1FXRA 4H4KA 4DZ6A 1KS2A 4OYBA 4ZPDA 2UXDJ 4YOEA 4ZDNA 2B0GA 2GJFA 2QA2A 3ENVA 3HX9A 1U26A 4HACA 3TAMA 5A8WB 5KTQA 5D77A 1UL3A 4HTIA 4F0HA 2C2KB 2RD5C 5C5JA 3V81A 2OIHA 3NAIA 2MQ8A 3GB0A 1EP4B 3ADAC 4KC5A 3TX8A 1X0FA 3MEDA 1D0EA 1FKAF 2R8KA 1UVJA 3TUZC 1TKZB 3DOKB 4DPXA 3TOQA 2LCWA 3I55S 2UUAF 1JK9B 4CLWA 2ZZMA 1YRXA 4DSJA 1XMOJ 4EGLA 2YXLA 3CJKB 2CPEA 3GMGA 1RT6B 2IBOA 4X4VA 2FZCB 3BSCA 4PUOA 5CZVA 2F5GA 4PXDA 3FVYA 2CG4A 2CQGA 3EWGA 1NBEB 1U0HB 1AFJA 1NK6A 3HJVA 2F4VJ 4BCAA 1TMJA 1FD8A 1RT2B 2DHHA 1O6XA 2FD2A 3RB0A 1MROA 3S7RA 1FDNA 2XSJB 4N5SA 4Q45A 3LGHA 1JMTA 1FRKA 4DUZJ 4X2BA 4OYXA 2XCPA 2KYZA 4ZLNA 2ZJRQ 5KFWA 3IXQA 2XS2A 4DN0A 3IWLA 3D5MA 4DV7F 4WFNQ 3OR2A 1KVKA 3VF0B 3P5TL 4U96A 1QUVA 5GMEA 2H54B 1WJ9A 5KFQA 1Y4ZB 2LA4A 1Y3KA 2CZ9A 2HZAA 4P7TA 1G4CA 1F6TA 2C3MA 4IG3B 1J2VA 5JMNA 1RDRA 4DL2A 3I96A 3PKMA 2QE5A 3NS6A 3N5FA 3DU6A 4LRAA 3CXCR 8RUCA 2J5AA 2BV3A 1KTQA 5L1JA 2Z2LA 1NK5A 1FJEB 4LF7J 1KHWA 2ROEA 3HKZD 4CLTA 1S5ZA 6AT1B 3IR5B 4CH7A 3QT5A 4PG8A 3GJTB 1YJWS 1O8BA 2BACA 1VQPS 2P8IA 1NSPA 2DNNA 1AYEA 2WW4A 4WZMA 5EN1A 4O3QA 1NKBA 1NEEA 3FEYB 4NLDA 3K89A 4ZS6A 4FPIA 4HHHA 2LU1A 3OR1B 3F0NA 2AGOA 3OV7A 2BE7D 4USKA 4ED1A 2NPIA 3DNCA 1M90T 2HIYA 3FRYA 2HLTA 3H2UB 2LA6A 1DJ0A 3GG1A 1E6VB 2BKNA 3G2XA 3R6GB 4IYQA 4NRUA 3U1MA 1VIXA 4L3NA 1KP6A 1UPMB 1NPRA 2FHJA 3NBPB 1KLNA 3B4DA 4IOAQ 1UKUA 2V2QA 1IN0A 5D0RA 5A0YB 1SJRA 1DLOB 1HNVA 2EKNA 2HRYA 2V8VA 5J1NA 4FKXA 1JJ2R 3UO0A 4DR4F 4DV5J 3IGVA 5KG7A 1Q82T 1KEKA 1YBUA 4WE1B 5BJRA 1RT5B 2HFUA 3HHLA 3ZZRA 4O0NA 4GRSA 2JLGA 4F26A 2RRAA 1DTTB 5HROB 5GAHI 4LF9F 1J5OA 5SUHA 1RWOB 2FGOA 2Y1RI 2ZH8A 2EK6A 4NZ7A 4Y2MA 5D4NA 1H73A 3H5XA 2UUWA 1VBZA 2RILA 2BQ3A 1U0SA 3EGNA 1K47A 4I2QA 2W01A 1FRHA 2OI2A 4HDGA 2MB0B 2UXCJ 3IFEA 2HHQA 1RU1A 4CTAB 4LFCF 1HD0A 2MGZB 1FFSB 3SBMA 1NAQA 1N5YB 4CCHA 2OD6A 3DOKA 3UWTA 4ED3A 4CYUB 4USTA 2A1BA 5K9FA 2ZKUA 4XO0A 1SL0A 3H4DA 3DLHA 2WHOA 3M1VA 4M5LA 3SDEA 4YFUA 1FRXA 3MMCA 2LQ5A 4MAKA 4JBCA 3RR7A 2NSCA 2VA2A 5D15A 3PJXA 4Y0FA 2YWWA 1GX5A 1TKXA 5DS7A 1I5OB 2IM2A 5HROA 2Y1LB 3O2IA 2DH8A 1UFLA 2JFKA 2EBEA 5CABA 3MPDA 3QGIA 4K4TA 1CBKA 4A8YA 2XB2D 3UD3P 1KSPA 2J8SA 1NK7A 4Z2XA 3B78A 4YMEA 8ATCB 3V2UC 3LPYA 1U2CA 1APSA 1JLQA 1Q5YA 1RK8A 2W7AA 1ZS6A 4CTAA 4YP3A 2FUG9 2E1PA 1Y00A 4DSLA 2WONB 1HR0F 3P96A 2C3OA 1UVKA 2XI2A 2BOPA 5HMZA 4C8LA 2NYHA 3KKFA 3ENAA 3VAHA 2ZWPA 1U0HA 2DGTA 3OPKA 3M9MB 3EPIA 1WTFA 2VG6B 3GIJA 1RWKB 1MROB 2HSEB 1QTMA 1TKXB 1XK8A 4LBPA 2J0XA 3QIPB 4DF8A 2LQ9A 3I6PA 3FSIA 2FGCA 1V5VA 1ZM4A 3D0IE 3GFYA 1R0BG 2KXFA 1CVJA 5C2GA 1NB7A 3GQCA 3M32B 3RW6A 3K5LA 2MLYA 2VC1A 1HBNB 3MOJB 1UZDA 1H0HB 4DS4A 3CD6S 3QZ7A 2L9DA 2UV8A 3Q8QB 1T03B 3ENWA 1VHFA 3EICA 3HF5A 3L7OA 5CYQB 3VZHA 2VODA 3PHTA 3HZEA 4EYHB 3J81j 4B02A 2VD3A 3FZ2A 2M0GB 4I7FA 2HIQA 4NLGA 2QRRA 2XLJA 3NBPA 5RUBA 4I6YA 2A2DA 2LLZA 3HT3A 5J2PA 2XMWA 2ROPA 2O66A 5I3PA 2CNOB 1R0CB 3PTWA 3GLJA 2VF3A 3ITHA 4K4SA 1S6PB 4A8XA 3PYDA 4X64F 3I82A 2L3MA 4U95A 3UD4P 5KFZA 4C9DA 4TN2A 2CDRB 2N4CA 2ZH6A 2ZWOA 4A8FA 1ZH5A 1RWXB 2WBMA 3N28A 4ETXA 4HLBA 4PPDA 3J7AN 2XZDB 1VOMA 3EGWB 3OXGA 3MPYA 2IPOB 1FDBA 2W4DA 1FE0A 5LOQA 1QSSA 5DZ6A 3VWSA 1IBCB 4WFBQ 3LWLA 4JI3F 7FDRA 3L9ZA 4QR2A 7AT1B 1UWAA 2X3DA 3DRSA 4RO0A 1HA1A 4UUXA 1VQ8S 4P2XA 4B9UA 4J5OA 3VGSA 2YKAA 5CCLA 4ZLJA 5KT7A 4MYUA 2LXFA 1N5YA 3H2VE 1RT5A 2R3VA 3HHLB 3LAKA 1TR0A 2MMYA 3QPIA 3R7BB 4OFZA 1U49A 3J7A1 3QT6A 1Y10A 1JLEA 1D8ZA 1RB0A 2AJ4A 3ETOA 1YG0A 3HVTB 1TV6A 3EUNA 3I5CA 3JSYA 3M8QA 3OT9A 4WYLA 3DRXA 5K8NA 3RR8A 3E01A 5HSPA 4LF5F 1CULA 4IG0A 2MKJA 4D3GA 5IT9U 5DLGA 1IBKF 5A2QU 2BEFA 4MIWA 3DHWC 3Q89A 4R0EA 5C42A 3GIIA 4WPAA 4DFKA 2JC1A 3RAXA 1F5CA 1SB6A 5GVQA 2AEMA 1IUJA 3UPFA 2HW3A 4ED5A 4TQSA 1RT3B 4URGA 3DRSB 2Q66A 2V8GA 3B54A 4Y28C 5LSLA 2B4VA 2ZC4A 1D09B 1SV5A 2K2PA 1GT8A 2KRRA 5HATA 4E98A 1GXUA 2ZH4A 3FCHA 1QAIA 4JV2A 1S0VA 1RT4A 1S7HA 3DDIA 2H51B 3JSBA 2MDAA 3DRRA 2P6TA 2MZ1A 2XZWA 2ACMA 2U2FA 4USUA 2CDQA 2FHJD 5EUHA 1NUEA 4ZLLA 3MR3A 2JEIA 1QJHA 4K7QA 3X1LB 4CH1A 1EKRA 4ZHRA 1FRLA 3NEKA 1SJ3P 4JV5F 1RWVB 2V4JA 4KHPF 1PCAA 1AB8A 1C1CA 1Q78A 2A3JA 3W5ZA 4FYYB 2V4QA 1NJZA 2AZ3A 3VR1A 3DFEA 3W65A 4KYZA 2YPZA 1UJ5A 1V3RA 1VQ9S 4GO5X 2VJVA 2C3PA 1S4FA 4HL9A 4OIXA 4DR1J 1RTDA 2BE2A 2HEKA 2KKHA 2RF2B 3BH7B 4KKOA 2YKPA 2NLWA 2HWHA 3FBFA 2MSSA 4NA2A 1UAWA 1CJVB 2CPJA 3TJ9A 5I4MA 3RYLA 1FESA 3NGUA 2J6SA 1RT4B 2XLKA 2F8MA 5IT4A 1FJCA 1Q8LA 1D9FA 4BWMA 3KXDA 2GVDB 5DGAA 1ZAWA 3GJQB 3MMAA 5F0WA 3BH6B 2MQQA 3OBIA 1NSKL 4P9SA 3JAMY 3H40A 3H5YA 5F8LA 4K4YA 1XNRJ 1GH8A 5AXNA 4F0KA 2MQNA 2KFYA 4NXNF 5HMYA 3P6YC 2V4JB 4E2FB 2V8DA 3FDSA 1HBUB 1LKZA 1IBKJ 1D8YA 2XMVA 1R31A 1W26A 2LDIA 2HHWA 1RWMB 1BXNA 4YQWA 4FYWB 3IRWP 4NYZA 3BQ0A 1P9QC 3C6TB 4HKQA 5HLFA 3T1HJ 2RS2A 5CYQA 2VUGA 1HW8A 2BE2B 2RF2A 1SH0A 4KKOB 3M6UA 1TKDA 3KK1A 2GIFA 3MFIA 1PAEX 1TU0B 2X1BA 5ETMA 1KHVA 2E5HA 2IAJB 3N6NA 2VFTA 2YQ1A 4USJC 1ELOA 4JI8J 1WDDA 4LF9J 2YKMB 2GIQA 3KJVA 5LMUF 2G2OA 2GAHC 1OY8A 3THTA 2CJAA 2DT9A 4J9KA 5KG2A 1GMUA 1PC4A 1X4GA 2HFVA 3AT1B 3NAHA 3ZTSA 4U7CA 1CJKA 4RNOA 5LMNF 1FJGF 2I9SA 1NB2A 2AZ1A 2OPRB 3D66A 2F4FA 4DXLA 4M8LA 5ETPA 2X3GA 3C15B 5K20B 2WTFA 2HMIB 1B7YB 1PC5A 4X84A 5DETA 5EHHA 3CCRS 1RHJB 3CDUA 5CHCB 5KFBA 4K4WA 4Y00A 1C0UA 5LJ3Y 4FKYA 2VKZG 3CCLS 5J1PA 1XBWA 1L3KA 4NASA 5DJBA 5FLXU 3M6XA 1NHUA 2ADCA 4DL5A 2V69A 1MWYA 1KNZA 4NE9C 3PFEA 3KLFA 2IJNA 2L08A 3I5AA 3MUTP 4IRKA 2IHR1 5D6GA 3DOMA 1CQNA 1N0VC 2OMOA 2E7WA 1JLEB 2B7BB 4FS1A 1Z2ZA 2Q6CA 4EZ6A 4NA3A 4ZK7M 5J2QA 4N76A 2YNHA 3LALA 4WWSA 3DDNA 3MM8A 3IAM9 4CLFA 4HT5A 5J2MB 2OPRA 2QL9B 1FJ7A 1GMWD 4IUFA 2BKOA 2LDYA 1U1QA 2C2NA 5KFRA 4DX8H 5KOXA 2DR9A 4OI0A 2GMLA 2MPUA 2XY5A 3AOBA 1SVDA 3M30B 3MZIA 1N36J 4M5DA 4UY85 1TFYA 4C8YA 2FVQA 3OTDA 3MEGA 3DU5A 3AA9A 4KGMA 3MM5B 1U2RA 4RW9B 3CDEA 4ZPCA 3HHLC 1X9SA 2QMXA 2OEJA 4I64A 3HLUA 1C0TB 4TU8A 2VPXB 1VIOA 4UQTA 2CQBA 4JI0J 3R5JB 2Z2YB 1O51A 1N33J 1GFWB 1NRKA 2AT1B 1VI7A 2K7KA 3LA0A 4B08A 3Q8RB 4DX6A 3NS7B 3UNYA 3DLKB 3H42A 2XS5A 3QQCD 2GMHA 2XNQA 2QLJB 3LWMA 1LWEA 1T94A 4WFXA 1XN9A 3F41A 1N56A 5KFIA 3MMAB 2DVIA 3AD9C 2F8EX 2DR7A 1S1UA 4LF8J 4NXMJ 1FFWB 4CO1A 1IKVB 3CCSS 2AW0A 3KG0A 3FFIA 4WYWA 2NS1B 1N6QB 2FHOB 3OL8A 2PDAA 3T9ZA 2XMUA 2ATLA 3R27A 1RTDB 2N7CA 3M2RB 3N79A 4ATNA 4X4QA 3G9CA 1LWFB 2J7UA 1FD2A 2DO0A 4J9UE 1VGYA 2AYEA 4JI0F 4I1TA 3DXSX 4AFFA 1JXEA 1F5AA 1HWUA 2UUTA 3VCDA 2R7WA 1KWMA 3FNNA 1QVGR 2E66A 3KHHA 4ECUA 1UP1A 3HM9A 4MH8A 3IR7B 5C2CA 3PVXA 1N34F 1LK5A 1FRJA 2DXDA 1YKWA 2PN6A 3H98A 4JOUA 3W66A 2FLNA 1Q8KA 3NL0A 2KI2A 1IWGA 1HI1A 1RAJA 2BVZA 4K2JA 5GAGI 2R7RA 1UMJA 2LYVA 1XMQJ 4QU6A 2YWFA 3TANA 4QIFA 2E5JA 3GYXB 1QM9A 4KV8B 2CFXA 1IR1A 1BQNB 4IOBA 4LREA 1J5EF 2G0IA 4R0JA 3AXMA 3A1YG 2D41A 3RJMB 3BV8A 3FBBA 4G1IA 1NDLA 3SEOA 5C7PA 5CH7B 3OL6A 4X4TA 4F2RA 4LRCA 1P27B 5E3AA 2HHVA 2WRMA 3C15A 2XCAA 2C22A 4Z37A 2RVJA 3CULA 5F8NA 1PJ5A 3M6VA 2WVCA 1FRMA 1SXLA 2B43A 3SFUA 3GFZA 1OIAA 3I31A 3KJVB 4PWDA 1P6TA 3DGPB 5E7OB 4HT7A 1S59A 3VHQA 1ZTWA 1ZYQA 1YJRA 4FF4A 3ZZUA 2Y9HA 3KNAA 3L3CA 5GADU 1ICEB 1WOSA 4H4MB 1VDHA 1IKWB 2HYIB 1Q79A 3GONA 2LQBA 1HQEA 1JB0C 4IH7A 3RZAA 3T6JA 4RUAA 3MM9B 4ECXA 3TQ1A 1NJYA 1RLCL 3UCZP 2GZOA 2YNHB 4LF2A 1UFWA 2OJ3A 4EK2A 2FZKB 5BR8J 1YSJA 1FNOA 5B0GA 4ZVTB 5H9EK 1P8GA 4Y6IA 5H9FJ 3ZTOA 3ZTPA 3OTBA 2PA8D 2VQFJ 4OLPA 1HYSA 3TUJC 3GCXP 2B7CB 3SQGB 4ES1A 1WDTA 5KFGA 4M5DB 1A9NB 1IQZA 5DZ7A 2CJQA 2OPQA 2KYXA 4TXSA 1RYSA 3CJ8A 3HSZA 2IRXA 4WXWA 4KPYA 4MJKA 3NS5A 2M2BA 4ERDA 4BWJA 2P9GA 4Y2IA 4F3MA 2RS8A 2VV5A 5KFVA 4DX7A 3CD7A 3N9UC 3S6EA 2CJXB 3FJ2A 2BE9B 4DBQA 1HWJA 2OPSA 3NGSA 4YEAA 4GO7X 2HVZA 3N6MA 1UA1A 1IKWA 3N01A 2PC6A 2ACYA 3C14A 1FFGB 4M5KA 1TAQA 3W63A 5KG5A 4M5IA 5T14A 1QE1B 2LVWA 4DV3J 3V6DA 1YDLA 1IJFB 1T9TA 3KG4A 4JI7F 4DUTA 3M2UA 2M7SA 3TWZA 2PMZD 2GCFA 4TU9A 2ABYA 3WC2A 1S7IA 2G1DA 2Y0SD 1QD1A 1U4BA 1ZAXA 1C0TA 1SCJB 5E3CA 4C3MA 4DCPB 3H4BA 4DR6F 5A8WA 2HHXA 3Q24A 4QIEA 4JV1A 1VLOA 1CS4B 3NOGA 1FNMA 4OYWA 1PYSB 3C2PA 2ZD1B 4QOTA 3FQKA 2YVSA 3HD1A 4LR7A 2LEPA 5J2NB 1FF2A 1S1VB 3QSIA 4ZP7A 1M1HA 5G4DA 1S0MA 1LWEB 3KK2B 4ILRA 2Z0GA 4Q2LA 2APOA 1PGZA 4USMA 4B3OA 4RU2A 3W61A 3H25A 1RABB 4K4VA 4PUOB 3NWRA 1OSCA 3VVUA 4WK3A 2Q3PA 2AU0A 3PX6A 1K9MT 3CCQS 2KG1A 2I1RA 2MLZA 2KTQA 5T7LA 1IR0A 1UEVA 2VFVA 5GAEU 4WP9A 1MMNA 1UFKA 3ZZYA 1NDKA 2FLOA 3CJ4A 5DM6Q 3D1HA 4U8VA 1S1XA 2BANB 4Q5VA 1U6ZA 5I42A 5IM0B 2CJYB 3FC9A 3QRRA 2GJIA 3LF0A 4XK8C 2WSCC 3PEJA 2G9OA 3MCNA 3NWGA 2W25A 4KQZA 5JXSA 3QO9B 4YY3J 4DUYF 1HNXJ 3UR0A 2AJ1A 2K3KA 2CNLB 1BMQB 1CJUB 4TY8A 3HHLD 1X60A 4OYZA 3WBZA 4A47A 2CVEA 1S4EA 1HLWA 3I0SA 4CT8A 3CE8A 1XIQA 3BKTA 5LXRA 1JJ4A 1RAFB 2GGPA 3GU0A 4IQXA 4ZIWA 2FLPA 2XWYA 4WKRA 3V6JA 4UTGA 2RQKA 3B82A 3SCKE 1UWBA 1VRUA 2VBWA 3CT9A 3FGVA 1TL3B 4DPUA 3J80Y 3TAQA 1BWEA 1RCOB 2ZJPQ 1RTIB 3CJQA 3CIMA 1BGXT 2C3UA 2KN4A 5T7LB 4WF9Q 3CEDA 1IWAA 2BMBA 4YR0A 3JQMA 3D6FB 3U7JA 4G1PA 1WTBA 1HNIB 2DGOA 1IJEB 1MWQA 4LF4F 2IM1A 4PXCA 3SSQA 2LECA 3BS9A 2QZ8A 3GP9A 3TA2A 1EKSA 3VZIA 1KQFB 2XO7A 1HL6A 2PD1A 3J7Z5 3AODA 1FA0A 5CD4A 4IFVB 3IG1B 1CPZA 2ZVIA 1ZM9A 3EZOA 5CD4H 1RAIB 1FI4A 1TZ0A 1JLGB 3G6ES 1L3UA 1X5OA 4CP5A 3PHEA 2R8JA 1TAUA 2YTCA 1A7GE 2EFGA 3BKFA 4NOHA 1KLMB 4WP3A 4QW8A 2EW9A 4A46A 2Y8YA 3QJJA 4BLGA 1I94F 1D9AA 2KJVA 1T3NA 1TL3A 3T1YJ 5T41A 2HNYB 1QVFR 1HD1A 1R8PA 2YX1A 1MMDA 3PIPQ 3DKDA 1ZM2A 4F0MA 1KOHA 2GAGC 4QZVB 2UXDF 4PZVA 3BBFA 5I3UB 2E1CA 4GKJF 4DI6A 3VGTA 3T9NA 4EU0A 4C11A 5KFJA 1VQOS 2KFNA 2DNMA 1RTHB 2A2CA 4JI2F 5KFLA 2C2ZB 3GCWP 3IP0A 3PZPA 4EBEA 2QGFB 1QAXA 4PXBA 3ZXWA 1F2GA 3IG1A 2QMWA 1D3WA 3PFOA 4OX8A 3UD5A 3TZYA 2KG0A 4DUYJ 2BJ9A 1CS4A 2B6AA 1OPZA 4I2QB 4PWUA 1JLAB 4NXNJ 4OX9J 1FKOA 2ADBA 4M5NA 1UVNA 1P9YA 5CYMB 2RU3A 3DMJA 4DPYA 3KDNA 3G6YA 4UY8T 2ZOFA 1NKEA 4CYUA 3ILOA 1V6HA 3BGOP 5ETRA 3ULHA 2L9NA 2MZJA 5L1KA 4KTQA 2D1CA 3J7YU 1S9GA 2IVYA 1H72C 4CM2A 4DR1F 2DIVA 3KLVA 2YNFB 3RRHA 3OSPA 4FYVB 3WQPA 1NU4A 5HAOA 2KDOA 3OFHA 2HBZB 4EYIB 1UCNA 2HQCA 2NXCA 4FPRA 2HHHJ 5U47A 1NM2A 1QSLA 2DNRA 1WKLA 4CZCA 3J7ZT 1NPPA 2WOMA 4ZN1A 5HP1A 4LBIA 4F4XA 2BUNA 2H65B 1KTVA 5I42B 1T9VA 1JLAA 1W25A 1WI8A 1FKOB 3AJDA 3CDAA 4QR1A 1YIJS 3HSGA 4HDHA 2ASDA 1EIYB 5CYMA 3OVAA 2JZ5A 1FXDA 2J6TA 4KGXB 4TYAA 5EX3A 4OYAA 2FY1A 2FY8A 2HNDA 2HNZA 3GV8B 1S79A 4DR3F 1H7XA 2DRBA 3QSYB 5F8MA 1LFWA 3DLLQ 3MR5A 3T3FA 2FQQB 3WIUA 3MEEA 1LNQA 5LJ5Y 2MKYA 5F8JA 5B0CA 2VG6A 4GVLA 1H2UX 2W4CA 2N3OA 2PSZA 3JXOA 3M05A 1KBRA 1LW0B 2HS3A 1RU2A 1UJ4A 3GJSB 4J9LA 4KBIA 1UEKA 1IKYA 3D6TB 1TL1B 5KG3A 2PFDA 3DC2A 3LP0A 2W7OA 1WEYA 1WORA 4J9SA 3RBDA 3PW7A 2CZVC 4KR0B 2LMIA 2ZH9A 4L73A 4YS2A 3KLEA 2RQ4A 2ZH3A 3GJRB 2CNNB 2J6UA 3WC0A 1KVIA 2FLLA 2VOOA 2FVPA 4IFVA 2B9XA 3MMBA 2E9RX 1DHMA 1A0OB 2OEKA 2WB1D 1SJQA 3UN5A 4X62J 4K4XA 4DL6A 1UVLA 2XS7A 2LU2A 1GQEA 3JQJA 4BC7A 1DQ8A 3AFGA 2FJXA 1S1TA 4GC6A 2RRBA 1V3ZA 4DJBA 2RU9A 1WC0A 4OZ2A 2C2DA 4YR2A 1FCAA 1JLCB 2DNPA 4LJMA 3VQSA 1GEHA 3A3OB 3CJ2A 3A8KA 4KRWA 3HFZB 1HNIA 2DHAA 3ZZ0A 4OHZA 1S6PA 3JYTB 4OZ1A 3V6DB 5K8OA 1S77D 2V5HG 4FNIA 3VAGA 4H4OA 4FF2A 2V9KA 3LUYA 1CJTB 2JNJA 4P72A 3HMJG 2WSEC 3UDLA 2J9DE 1H38A 2A6MA 1LFPA 4O4GA 3OHBA 2XULA 1R8CA 4P75A 4CLUA 3PRBA 4P52A 4EBCA 4KFBB 2AYGA 4NLWA 1VQKS 3P49B 1FWKA 4LVNP 1S6OA 3KJQB 2JH3A 4HACB 2V8HA 1SKSA 2MKSA 3BBBA 2CPHA 4URSA 3PJ9A 1EARA 1R8AA 2MQMA 5FD1A 3W2WA 5GMKa 1C2PA 5HVFA 4TQRA 1RISA 3NCPA 1XERA 3ISNC 4ICLA 4L3KA 4OMFG 4P74A 3BO4A 1CEZA 4X65J 4NLYA 2FJDB 2QG9B 1NH8A 2UVWA 4IRCA 2J8AA 1F60B 2VBZA 3THPA 3W9IA 2RNEA 4EFAC 5M2PA 2ZH1A 2ZHBA 1F5BA 2W2MP 1S9GB 2DNGA 2RE1A 4DU8A 1M1KT 4O3RA 4AT1B 5LSRA 3MUVP 4TLRA 1MU2A 4WIQA 1C4CA 4MMOA 2FJWA 3HVWA 4ZVQB 5BXIA 2YKOA 3B4MA 1BE4A 4EMDA 3EYZA 4A8OA 2F65A 2HQGA 3D9BA 4XTTA 2MJNA 3BQ1A 1VFJA 3GWCA 4AL6A 1TMMA 3LTOA 3KJNB 3LANA 3UQSA 4DR3J 2HFSA 1S99A 2F1FA 2KVIA 2D74B 3MEKA 2CUYA 3TVZA 1RHMB 2HPUA 4DN9A 3MHYA 4F25A 2HK3A 4UOHA 3RTVA 1R89A 1FNXH 1NZ8A 3Q2SC 2Y1IA 1X9WA 4ICLB 1S48A 3NGKA 3PCOB 2UXBF 1VRTB 1N5QA 3K8WA 4ECQA 2CPDA 3RW7A 3CCWA 4OX6A 2ZBRA 5F8IA 1S12A 2KJWA 5F9LA 5KFCA 2POKA 4PCQA 3R2CJ 2N7YA 4IG3A 4DG1A 3HCXA 1FJGJ 3NCQA 2K8GA 2ROGA 2XMJA 3AHPA 4J9NA 2AF6A 2D9PA 1RT1A 1Z4UA 1X7VA 3ZNUA 1VC5A 4F3OA 2UUAJ 3VQTA 4ZITA 3QGPA 2G13A 4PG4A 3VALA 1OPIA 2NCKL 4D3HA 4RJVA 2AJ2A 4MT1A 3M8RA 3SXLA 3GSDA 2KRBA 3M8PA 2R2UA 4DV1F 1IBMF 3OUYA 2C2OB 5KAKA 4OI2A 1WI6A 1OQ3A 3TYTA 5CXTA 2LEBA 3T1HF 1URRA 3EVWA 4I6AA 5F41A 1Y5NB 1HBOA 1TL7B 1R8BA 2HS4A 4I2PB 4KAIA 2OFGX 3CCUS 2W2QP 2GVDA 3CJSA 4ZMMA 3EDQB 1C1BB 2KM8B 1WC4A 5E33A 1SKUB 4MKBA 5ETQA 4RLEA 5HMXA 4PWWA 3U27A 1AZSB 4NLUA 3TX0A 3L7UA 4CNZA 2AEJA 2FZGB 4B9VA 1HWKA 4C97A 1RT7A 3Q23A 4GKKJ 2CADA 1S0NA 1PG5B 2E1MC 4OX7A 3W60A 2AJFE 2M4MA 1S6QB 4G65A 4AQYJ 1LWCA 1Y0HA 1PBAA 5THWA 1S9EB 1QTNB 3IM8A 1Z1ZA 1W7WA 3OR1A 4JUZA 3DLGA 4DZDA 3ONQA 2OHDA 3K8VA 5HMWA 3M32A 3MMBB 2AHOB 1EHWA 4ILMA 4GC7A 4RUCA 2FJEB 5BR8F 4ZVOB 1BHNA 4O4GB 4LSLB 2HBRB 2F7VA 1S1WB 5D0EA 4IH6A 5HJYA 2ZH5A 4KH0B 2VZ9A 3W2WB 1DLOA 1HNVB 2B9YA 1C1BA 3TO8A 1X5PA 2GVZA 2MZQA 2E29A 5FDLA 2NZCA 3KJFB 3ZFVA 3AQOA 1CJKB 4ZJQA 2A0FB 4IDKA 1WACA 3CC2S 3M8ZA 4LF4J 1LW2A 2DGQA 1U7LA 2V2ZA 1RT7B 4C3KA 3G6VA 3AH6A 3LP2B 4ED2A 2DCUB 2E5LF 2V8PA 4MYTA 4W90B 1J5OB 2JLFA 3HFVA 4EO6A 2QL7B 3EDRB 5F3TA 3OXLA 4UT4A 3TR5A 5L46A 4F8RA 4F3QA 3R5BA 3MCMA 5CCMA 1L3TA 5E41A 4F2SA 1N4LA 4OLOA 4FYDA 3MECB 3GG0A 4RW7B 3BEGB 3PDNA 4Y2KA 1N36F 5BYRA 3KUGA 4LSLA 5ETOA 2XYPB 1K73T 4QU7A 2NYIA 1YWXA 1N54B 1DZ5A 1OQ6A 4HI1A 5K5MA 4JB8B 1H74A 5IS2A 1VQ7S 4FZVA 3ZO7A 1FKPB 4FVCA 2H1YA 1I1GA 1HWLA 4KIAA 2ZVSA 3P5BP 1CLFA 1Q8IA 3MMCB 5J2QB 3QWUA 1M5VC 3JTOA 1VRTA 2JEJA 2PI4A 3MM8B 4DQRA 1WKKA 1LW2B 5L1IA 3Q86A 1MWZA 3CTRA 4ZJLA 2RUGA 2BOAA 1RJJA 1PILA 5AT1B 3UE2A 4RNNA 3MURP 1VQ4S 2H5JB 5HO4A 1YJTA 3TA1A 4DG1B 3IWNC 4DR7J 2B4UA 4ZVGA 1XR7A 3CNQP 2DEJA 2K06A 2ZDPA 4J9VA 4NLSA 4OZNA 4DX5A 1U1OA 1NJIT 2PA3A 4Q8FA 3PX4A 2N3LA 2VQEJ 5A8RA 3UDVA 4C7QA 4OI4A 1TUWA 1FTRA 1M5SA 2DXFA 4X4SA 3MF5A 1H3DA 4HEA9 4LBHA 2UZAA 2PMHA 3PEHA 1K1QA 2IVMA 4P2MA 4WIIA 4O3SA 2EFOA 3JTNA 3CJ0A 4RW6A 5DDPC 2B3TB 3GV5B 4PEOA 2NQPA 1ROFA 3TAPA 1EX8A 3JSRA 3M8WA 2WONA 4ANCA 5DG8A 3OUYB 3JSMB 4NRTA 2DTJA 3M8YA 2FIUA 3D3BJ 1F1BB 2B5JB 5J1EB 1YJ7A 2VKRA 2IMOA 5KFOA 1X5SA 4NZ0A 3U02A 4H54A 1SKWA 2HBYB 3D67A 2J0SD 4C4WA 2VBXA 3EVOA 5KT4A 4IOCQ 4KT0C 2NXEA 3Q8PB 3HJFA 1YZ7A 4USHA 7FD1A 2W9BB 2GO8A 4DS5A 4X64J 2K1RB 1REVA 2H5EA 5J2PB 4X62F 4RZRA 2W7PA 2XMKA 4WU3A 3I56S 3TUPA 3DHXA 1AA1B 3NKYA 4ECYA 1N6QA 1R8HA 3M8PB 4J90A 3X3UA 1VQMS 1YITS 2B8QA 4LIWA 3SSSA 1U6BA 2IJRA 2KT5A 1PBUA 2EWHA 2LEAA 1HFEL 2OGUA 3A8JA 3QLHA 4RW6B 5HL7Q 4ZA1A 2ZH7A 4ENOA 1Y7PA 4LSNB 1F0XA 2RQCA 4B9NA 4PRFA 4YB7A 4ZP6A 4EEYA 2QFIA 4F4YA 2EC0A 1TK0A 4IKAA 4F7VA 2BXJA 4NX9A 4OJ3A 3R3TA 4ZP9A 5J1EA 3MPWA 1SUQB 3QNWB 4LIRA 4OV1A 1NK8A 1WSRA 4IR1A 3GE9A 4ALZA 4ED4A 4QYZJ 4WFZA 2MQPA 2G2ZA 4IH5A 4N47A 3ITHB 2ZBIA 2V34A 3ZZPA 2GVZB 4F04B 5KG1A 3H0PA 2K1RA 3NMRA 1VQ5S 5D0HA 4RNMA 1QAYA 1LXJA 3R1HA 4ECZA 2MY8A 1U09A 4LFBJ 1HBUA 1WC5A 5JVGQ 1WHVA 1DBDA 3M8QB 3ENQA 3QT8A 4DPWA 3M9NB 1UVMA 1T3OA 4DR4J 2F3JA 2GV1A 2HWIA 3MPUB 2GJ2A 2P9CA 3S01A 4B3SJ 3C6TA 1S1WA 3D68A 3F56A 3DRPB 3CC4S 1RAOA 2IMWP 1IM6A 2MLXA 2NXJA 3KK1B 2KXHA 2V94A 2DGWA 3HI9A 2X51A 5FDLB 5IFMA 3BJYA 2AP6A 2VH7A 1JIHA 1VK8A 1VBKA 4LR9A 1KVJA 2KVQE 1GK8A 3KNGA 2FJAB 2VG5B 1XR5A 3EXYA 3KLIA 2QLFB 4J9MA 5B0BA 2Z57B 1TV6B 3G8QA 4ZVEA 3HDSA 4J9OA 1N8RT 2Q79A 4NLQA 2BJ1A 1RWNB 2GHVC 1ZBTA 2OD4A 2HAIA 3K2YA 4CO4A 3ISND 4K5SA 5KT3A 4ECVA 5DLFA 4Q0BB 3U1LA 4DV3F 3L7PA 4JI7J 4DR7F 4ECWA 5C25A 1OS5A 3OXFA 3V5RA 4L76A 3GIMA 1RKJA 2E7XA 4FVMA 2M88A 3K5MA 5IQQA 4ECSA 3DI6A 2GO9A 4PG6A 5KFXA 2Z30B 1RT3A 2RSQA 2OPQB 3V4MA 5IV4A 1JX4A 1HNWF 4PQUA 1M5PC 3HKWA 1OYEA 4ED0A 4LFCJ 1GXTA 1SC1B 2QYGA 1NHVA 5KG6A 5CYJA 3SMZA 2ZC3A 5IT0A 4KO0A 1OY6A 1RE1B 1SIZA 3BGFA 1RSCA 2VPWB 2JL9A 4QIVA 3OLBA 3VAKA 4K50A 1VISA 3MFHA 3BDPA 1C4AA 1FK9B 2E44A 3VAJA 3HVAA 4K0KJ 2JHEA 2MY7A 3W64A 2BJDA 4ZHRB 1SL2A 1IR2A 2UVUA 1T9XA 3SYZA 4L74A 1VBYA 1H2VZ 1VS3A 2EBGA 2HGNA 5KFDA 2DR8A 5C25B 2W9BA 1XEZA 5CAAA 4TY9A 5B08A 4N56A 4L72B 5D0GA 3OW2R 1JNRB 5IC6B 4ID8A 1YBAA 4LVOP 2KT3A 3N5BA 5A8KA 1E6YB 2CPIA 2VFUA 3VV2B 2CPXA 2I6WA 3JSMA 4OYPA 1EZZB 2DKOB 3AJ1A 3SV4A 4ZN3A 4NLXA 2UXBJ 5K14A 5KFMA 2EFPA 4L75A 3MCOA 2BW2A 1U45A 3JB9k 3OL7A 2ZUGA 4M1KA 4KE5A 2JSXA 5CA5A 1NO8A 2L41A 2WK4A 3G86A 4U67Q 1EETA 4NMXA 5C24A 4FBTA 3BB5A 2BBEA 3CVKA 4DR2F 3A3PB 4C98A 1G3OA 2DBBA 3EXCX 5F0UA 1CC7A 1MW7A 4MKVA 5F8GA 4RWWA 4F36A 4USWA 3OTCA 1R27B 2HWTA 4Z7CA 1Z2LA 1GNKA 3OD2A 4PWDB 2V0NA 4Q8EA 3LGMA 1HNWJ 4IFYA 4CI0B 3H8YA 2QYCA 4J9QA 1U2FA 4FXWA 4FBUA 3HZGA 5E2QA 4O3NA 1UZHA 3TRGA 5AE1A 3MUMP 1EAYC 2XO6A 3M9OB 3E51A 1SUQA 4A8MP 1N34J 4JP8A 2YNGA 2C1EB 2KO1A 3M2VB 4I56A 3SFGA 5EGYA 1H2TZ 3GZ7A 2L48A 4QPXA 3HXMA 3CCZA 4ED7A 4KH1B 3PO4A 2ZBCA 1X4AA 1GTEA 2IIHA 4CDIA 4ED6A 3FUYA 1MG7A 3GIKA 2PE8A
chains in the Genus database with same CATH topology
1VRUB 2ZE2B 2VC0A 3MD1A 2ZOGA 4MTPA 5GAGU 4O0IA 5EWGA 1T02A 1WEZA 1X5TA 4OQJA 5LT5A 4QR0A 5LXYA 2A18A 2E1RA 3DRPA 1RI7A 4WTYA 1XMOF 1VQ6S 2QLWA 4IFYB 3V4IA 3PIOQ 5LSOA 4RWXA 2C42A 2F40A 3M30A 2KHDA 5EX0A 2EPIA 4JI8F 2CQ2A 3Q2TC 3KLGB 2VB6A 1MMLA 1M5HA 3I5BA 1LV5A 1U24A 5B09A 1SKRA 2JEFA 2MSTA 2DNHA 5B0AA 2R8GA 2IA0A 3CD0A 4QWAA 4R8UB 2YX4A 2M3DA 2GW8A 3Q22A 1ZZNA 2ASLA 4K59A 4Q0BA 2VFRA 1TL5A 3NNHA 2B4PA 2JFDA 3DDKA 3N0VA 5MLCV 5L8RC 3I4HX 3LH2S 3MPVA 3H5UA 1PSDA 3CC7S 4PQUB 4C11B 4X4PA 5DDOC 3K7RA 2XC9A 2MJUA 2MZTA 2R7TA 3CUNA 2DD8S 4A8QA 1RYRA 1NH7A 4G1QB 2DGVA 2YKQA 5DDQC 3OTEA 1LWFA 2GHPA 5EDWA 3OVBA 3V81B 2NR0A 4P6QA 1HMVB 1Y5LB 1XNQF 5AXMA 2IYGA 1LXNA 2GX8A 2DNZA 3IAS9 3CCES 2J9EA 4DLGA 5KOWA 1VQYA 2ZZNA 2DNLA 2PGCA 3EZUA 3L95X 4LT6A 1XC9A 1Q4RA 2CRLA 1RT6A 4OI1A 1IKVA 5KT6A 4QW9A 1N48A 4FF3A 3KTQA 2VOPA 2OSQA 2OAUA 2XY6A 4M94A 2AV5A 4K4UA 2MZRA 4C3LA 3KMSA 1C1CB 2MYFA 4O44A 3I0RA 5D78A 1D1UA 1QAJA 1FTCA 2M70A 2SXLA 5K14B 2R7XA 1SH2A 3ZZTA 4QWEA 3HPOA 5M2RA 5GAHU 1NJIT 3CF5Q 1IM4A 3O44A 3V6HA 1N33F 4HHJA 4E0DA 2ZD1A 2X1GA 3IGNA 2LQJA 5KT2A 3EPGA 2R2UA 2YNGB 3M2VA 1S9FA 2ZHOA 2YX7A 2KB2A 4IO1A 2HHPA 2M9KA 1RA6A 2OP5A 3CB4A 3MR2A 1QLNA 4C8ZA 2E5GA 1BQNA 1YGYA 3G8TA 4B3OB 4FN5A 1FE4A 1VQSA 1HW9A 4AUKA 1QTMA 5L39A 4DSFA 3SZ2A 5DQHA 3KYLA 1LW0A 2DGUA 2Z2MA 3IRXA 2FTRA 2DISA 3CCVS 4F50A 3RU0A 4CO0A 4CQ1A 5I3QA 2AYBA 4MFBB 1CSJA 3FMWA 3HP6A 5HLFB 5CZXA 1SJ4P 2JC0A 2BRKA 3V4IB 1B64A 1HYSB 5GAEI 1GX6A 1Y3JA 3V6KA 2IAJA 2IA6A 2F4VF 2GA7A 4ZVHA 4EBDA 2ERRA 4O4RA 1S6UA 3OQ2A 2GGPB 4LQ9A 4NLOA 5L9NA 3FMBA 1YJUA 1UWBB 3G96A 4F4WA 4A8SA 3CMES 2ZKTA 3JYTA 4ZCLA 4M95A 4DEZA 5LL6d 2M5YA 3HO1A 3RRGA 2WW8A 4KB7A 4PKDB 2ASJA 2XGQA 2V9WA 1N52B 2R4FA 3TP2A 1DTTA 5HQ8A 4KHRA 1R7IA 3O6QA 1DURA 3BSOA 3KLGA 3PV8A 2P9EA 4NZ6A 1ZTTA 2CQ0A 4IR9A 4FS2A 4ELUA 2ILYA 4QCLA 3H20A 4ZCKA 1PO6A 2HS0A 4V19X 2IM0A 2O1PA 1B0TA 3TNVA 3ZZOA 2YWHA 1S1VA 2MGZA 2R2RA 2XMMA 4ZP8A 2JRSA 2HHTA 4YHHF 4XPCA 2CIMA 3B8HA 2HNYA 2KHCA 1IKXA 4X65F 1X8DA 3M1VB 1HARA 2UXCF 2I5JA 3AY0A 1HQUA 1U1PA 3O3LA 4R5PA 5L38A 1DQ9A 3QYYA 4DL3A 1RA7A 1WHWA 1R6YA 6FD1A 1YI2S 1U1MA 3F73A 2R7VA 2YQ3A 1WWHA 2A10A 4NPOA 1RTHA 3K5OA 5JVHQ 3U1NA 1F9FA 1HI8A 5IM0A 5HI7A 4OZJA 3SCJE 5E3QA 1CC8A 1FDDA 2MKKA 2VONA 2UVVA 2FHMA 2WCXA 3KFWX 4QQBA 1KR4A 1BY9A 4EO8A 5K8MA 4F4ZA 2D3UA 3PM9A 3KWMA 3D28A 3DXBA 4DOZA 3DYAB 3UNGC 3BR8A 3FFIB 2IC3A 3LP1A 1Q7LB 1FVSA 2HZCA 4RW4B 1U6FA 2OTLS 2GNKA 3TVKA 3M2RA 1RTIA 3RB6A 5ITHA 3T19A 2RJZA 4YB5A 3TW0A 3MEDB 5B0EA 2FVRA 5KFEA 4J37A 1TKZA 2MQLA 4IQMA 5SZTA 2LXIA 1FO1A 1KQSR 1DARA 3CJKA 1SJ1A 1U8SA 2QA1A 4USIA 1VK3A 1TL4A 3MMJA 1KFDA 4B17A 4B3RF 4HI2A 4RBTA 1XTZA 3QIDA 4DV4F 5DG7A 4RU9A 2J76E 2QSFA 3RAMA 4MFBA 3OJUA 4MKYA 1FHTA 4N77A 2XG8A 2AQ4A 4N41A 4RW4A 1H7WA 4ES2A 2FVCA 2CQ4A 1CG2A 1K8AT 1S6QA 1W2BR 1LWCB 1IKYB 2DNKA 1TKTA 3ZZZA 4DL4A 1S9EA 3OSNA 3OR2B 3Q8SB 1SI9A 2FJBB 5FLXY 1KRPA 2E9ZA 1JLBB 2QEXS 2BR0A 4FP9A 1JLGA 2OH2A 1HPZA 2W9CB 4LF8F 4NXMF 3QWPA 4H4MA 4E8UA 2YH0A 2O67A 4ZPTR 2JVOA 3MGJA 1I6JA 3VTIA 2GIRA 5KFKA 3MM9A 1X4CA 1S1TB 2VASA 1L5UA 1S97A 3KLHA 1H98A 2VPYB 2QT7A 1YHQS 2IFXA 1G7CB 2YWEA 2YNIB 3SQGA 4H4OB 4R5PB 4WFYA 3E01B 1P1LA 5F3ZA 2X1FA 1DFDA 5KG0A 1RWUA 4IG0B 4OX9F 2YNFA 1SQEA 4TYBA 1JLBA 1SH3A 5DQIA 5C42B 1T95A 1E6VA 4OZ0A 1HPZB 1U1RA 4DQIA 4L6V3 2BZ2A 2I0XA 2J7WA 3DMJB 2OPSB 3VAFA 2KU7A 2JLEA 2L9WA 1FEEA 1QY7A 5G0RA 3CDBA 5KFPA 1T8EA 1SIWB 1K1SA 4H4KC 4G3IA 2EFVA 2C3YA 1U1KA 3RBEA 2DK2A 1NJWA 3T1YF 3UFCX 2WB4A 1TVRA 2PT0A 4NLRA 4PG5A 3DOLB 4Q44A 2NXUA 2LKZA 4QJVA 5H1SV 2FPHX 1RT2A 3IS9B 3QMQA 3R5CA 4Y2CA 3MCSA 2ZOMA 3D0GE 2DHXA 5HN0A 5M2UA 4OI6A 2AJQA 3BGRB 2OLWA 5GADI 3HVRA 4B3SF 5D4OA 3H2LA 3WX4A 1HHTP 3NMAA 1FXLA 4QWCA 5IT9Y 2XWXA 3GR1A 4ITSA 1T7PA 3LGNA 1OSDA 2CZ4A 1HWIA 5H9EJ 2Z8QA 2MXYA 3IO1A 4NLPA 4WU2A 3BGUA 4OZ5A 2DH7A 5D8HB 2JX2A 2Q1LA 4A8KA 2CJBA 3IS9A 4P2SA 4MIAA 2DNYA 2CPZA 4O3PA 2BANA 4UOCA 2ALZA 2NPFA 2CJ9A 1TKTB 4OI3A 4BBYA 4DV5F 2R7UA 1Q53A 4LUBA 2VG7A 3K5PA 3DM2B 3HFKA 3HHDA 5DG9A 3K5NA 3I0SB 1CQMA 1WHYA 3BSNA 1X4DA 2B4OA 4ZPWR 3NGDA 1HBOB 1VJWA 3ISZA 2XNRA 2OTJS 2DITA 3J7YI 2DNOA 2ASYA 4I7FB 3LO3A 1BLUA 3NLCA 5AJ3F 4ED8A 4OJGA 4TKTA 1WD6A 3MTJA 1U48A 3CMAS 4PG7A 2IBKA 1L3SA 2DCLA 2Q43A 3TVYA 4I69A 3IN5A 1HBNA 3PO5A 3AJ2A 1M5KC 4ZPVR 3N6LA 4KFBA 3DLGB 2W9CA 3RRKA 4A48A 2AGQA 3DN9A 1BQXA 3PW5A 3VAIA 3PRDA 4LQ3A 4PXEA 2IRUA 4ZVFA 4ECZA 4HH0A 2R2SA 4BC9A 4KHMA 3POTA 2W8LA 1P1TA 1ULRA 3SI8A 3RAQA 2MKIA 2N4DA 1A6LA 3KLFB 3HK2A 1HHSA 4XDDA 2XLIA 4ECRA 2YNIA 3SDEB 4ILLA 3MD3A 1VQLS 1UEUA 2GC8A 4X4NA 2J7KA 5K8PA 5FJ4A 4IDKB 4CT9A 2BDPA 2QLXA 4J9RA 2J9DA 4YY3F 4G6VB 4GMKA 3HHNB 4DV0F 3VAMA 3TAMB 2DR5A 4EZ9A 1NK4A 2OMLA 1RT1B 3MM5A 3MECA 4RW7A 3K0JA 2NUUG 1K0TA 4TNOA 1ZETA 2DHSA