2MY7A

Nmr structure of unfolding intermediate state of rrm-3 domain of etr-3
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
97
structure length
97
Chain Sequence
GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CUGBP Elav-like family member 2
publication title NMR Structure of unfolding intermediate state of RRM-3 domain of ETR-3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 4
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2my7A00
3S7RA 3CULA 4QU7A 2O3DA 2MGZA 1NO8A 2MKSA 5CA5A 1OIAA 2DGSA 2E5JA 4PR6A 3UE2A 1DBDA 3I55S 3CPWR 2LECA 3CC2S 2DHAA 2GO9A 2AYEA 2ZJRQ 2MPUA 1SJ3P 2M52A 1U1MA 2F3JA 2KM8B 1VBYA 2XNQA 1X5OA 1VBZA 2MQMA 2CPDA 1U1RA 4V19X 2AYMA 3US5A 1FJ7A 2CQCA 4UQTA 4TU9A 5JVGQ 5LXYA 1P27B 1PGZA 1KD1T 2HGNA 5LXRA 4QQBA 3SMZA 2MMYA 2XS7A 3VAGA 4FXWA 1N8RT 2DNYA 2FPHX 2X1AA 2MZSA 3P3DA 1YTYA 2CQ0A 3BEGB 1X4CA 3CCJS 2KI2A 2QFJA 4WFNQ 1X0FA 2MJNA 1FJEB 1SXLA 3UD3P 1Q86T 3MUTP 5GADU 2Q79A 1X4GA 5LSLA 2RQ4A 2RT3A 1YI2S 2DNRA 3U1MA 3UCZP 5IFMA 1D8ZA 4LMZA 2AYGA 3UCGA 3UD4P 2DNNA 2KH9A 3CMES 2MQNA 3HI9A 2DNQA 2CQ4A 2D3OR 4C4WA 1U6FA 2PE8A 2M0GB 1ZH5A 1YWXA 1M90T 2PEHA 1R8HA 3NNHA 2M88A 4TLQA 2E5IA 2L9WA 3BO2A 2CQGA 2DNZA 1RK8A 2MB0B 3BO4A 2KRRA 1WG5A 2LXUA 4WFAQ 1UAWA 1VQ4S 3R1LA 1YJNS 1CVJA 1H2TZ 1U1LA 5FJ4A 2FHOB 2NLWA 2CQHA 1VQOS 1WI8A 3RW6A 2F9JA 3P5TL 4YB1P 2DITA 2E44A 3H2UB 1VQ9S 1DZ5A 3CC4S 1L3KA 1K73T 1YJWS 1B7FA 1D9AA 1YHQS 1VQNS 3TO8A 2DGVA 2BZ2A 3J7ZT 3CCLS 5LSOA 1SJ4P 4QU6A 4A8XA 1VQ5S 2J76E 1H2UX 2MQLA 4YOEA 1X5SA 2D9OA 4LIRA 5GVQA 3VF0B 3VAHA 3VAMA 2YTCA 2ZJQQ 1S72S 4WF9Q 2KG0A 1N52B 2JRSA 2MGZB 2M2BA 2KVIA 2DISA 1DRZA 3VAKA 2L41A 2CQ2A 3ZZYA 3CCUS 4U67Q 5DDRC 1SJRA 1ZZNA 2OTLS 1OWXA 1U2FA 1FNXH 2LQ5A 2ERRA 2DH7A 3EGZA 2M4MA 2KXFA 3G96A 1FJCA 2DB1A 3FEXB 3TP2A 3EX7B 3PIOQ 2DK2A 2HVZA 1PO6A 4UY8T 1M5KC 1RKJA 2D9PA 4F02A 5DM6Q 2I38A 1HL6A 1Q82T 1WEZA 5DETA 3CCMS 2FC9A 1N88A 2XB2D 2KYXA 1WEYA 2MJUA 1AUDA 3Q2TC 2LEBA 3K0JA 4IOCQ 3UCUP 3IWNC 5D78A 3HHNB 2XS5A 4ERDA 5JVHQ 5DDPC 2G1DA 1WF2A 2DH9A 3G71S 5CXTA 5D77A 3IRWP 2OIHA 3CTRA 1U1NA 1HA1A 2G4BA 3RW7A 3P6YC 2WBRA 3CC7S 2LEAA 2QA4S 1K8AT 2DO4A 3JB9k 3MD3A 1VQKS 1OO0B 1M5PC 3VAFA 2N3LA 3FEYB 1WG1A 5H1SV 2N3OA 1WG4A 1WHWA 3V4MA 1U6BA 3N9UC 3BO3A 2NZ4A 3MI7X 1A7GE 2DIUA 5GAHU 2KN4A 4F25A 2DGOA 3R27A 2VONA 4Z2XA 1H6KX 2B0GA 1M5OC 3TYTA 2DNHA 4P6QA 1QVGR 1JJHA 2HYIB 2M7SA 1X5PA 3NNCA 4ZKAA 2CQBA 2DNKA 1S79A 3G6ES 2AYBA 2YH1A 4ED5A 3ULHA 3MUMP 2LA6A 3S01A 2CQ1A 1VC0A 2V94A 2DNGA 3G8SA 3CCES 2VODA 2KRBA 1OPIA 2LA4A 2KU7A 2FC8A 4W92B 4PKDB 2HGMA 1A9NB 2CPYA 2DO0A 2MKHA 5IQQA 4WFBQ 2MKKA 1UW4A 2A3JA 2OSQA 2CPXA 4CQ1A 1HD0A 2DGTA 5IM0A 3MD1A 2MY7A 1UFWA 2OTJS 1IQTA 1FXLA 4WIIA 2G0CA 1Q7YT 2XS2A 1JJ2R 1X4AA 2N7CA 2FY1A 1WHYA 1M1KT 2DNOA 3G9CA 5HL7Q 2DGWA 3MOJB 2LYVA 2RUGA 2J0SD 2MXYA 2JWNA 3UWTA 2CPZA 2M8DB 4C0OC 3SXLA 1VQLS 1VQ7S 2CJKA 2DNLA 2RS2A 3LQVA 1UP1A 2SXLA 1WEXA 5BJRA 4LJMA 2KXHA 5LJ3Y 3NMRA 1X4EA 2KG1A 1K9MT 1XN9A 1VBXA 1X4DA 4J5OA 2MQQA 1VQ6S 4W90B 2MYFA 1FO1A 2DHXA 3S6EA 3CXCR 2UP1A 2QEXS 2RVJA 1WELA 1WF1A 4CIOA 2KFYA 2MKCA 2MZJA 4FXVA 1WHVA 4CH1A 3PIPQ 2KM8C 2JVRA 2ADCA 1WWHA 2KT5A 4QPTA 4OZ0A 3CCRS 2MSSA 2RU3A 1YIJS 2I2YA 1X5TA 1YITS 2EK1A 3THTA 2XSFA 4TU8A 1NU4A 1QM9A 3SDEA 1WF0A 3H2VE 2M8HA 2YH0A 3VALA 5GMKa 4IUFA 1H2VZ 1VQMS 1VQ8S 2KHCA 1M5VC 2ZJPQ 3VAJA 2LKZA 4RU2A 2MQPA 2MZTA 1U1PA 2MZRA 2KXNB 2VOPA 3CUNA 1F9FA 3G4SS 2M70A 2K8GA 2DNMA 2LMIA 2CQ3A 2RQCA 2M9KA 5GAGU 3NS6A 5DDQC 1WI6A 1O0PA 3BS9A 1VQPS 2DIVA 1U1OA 4BS2A 2MZQA 2DGQA 1VC5A 1SJFA 5EN1A 3CD6S 2DNPA 1QVFR 2N82B 1W2BR 3MURP 1U1QA 2J8AA 5HO4A 1FT8A 2HGLA 1N54B 1G2EA 1BY9A 4Y0FA 3DXBA 2CPEA 2BOPA 1KC8T 3LPYA 1KOOA 2CQDA 2DHSA 2OSRA 4YUDA 2XNRA 3R1HA 1WTBA 4CH0S 4TU7A 2RNEA 2RRBA 5DDOC 3Q2SC 1VC6A 1WHXA 1U1KA 1JJ4A 2CPFA 2MY8A 5IM0B 3NNAA 4IOAQ 2CPIA 4OZ1A 2L08A 3J7YU 2U1AA 1JMTA 2LXIA 5CYJA 2YWKA 2MSTA 2F9DA 2E5HA 2GHPA 3P49B 3CCSS 2EK6A 3G8TA 2DGXA 1X4BA 2J0QD 2CPJA 2U2FA 5DM7Q 2MHNA 2MKJA 2K3KA 3CMAS 3ZZZA 3OW2R 2ADBA 2YKAA 1KQSR 4Y00A 3L3CA 1YJ9S 2MKIA 3MDFA 1FHTA 1Q81T 3B4MA 2X1GA 3U1LA 4M5DB 2RRAA 1X4HA 1KOHA 1ZZFA 2VOOA 4F26A 5MLCV 4IO9Q 2OJ3A 3CCVS 3I56S 3EGNA 4C7QA 3B4DA 4PRFA 1NJIT 5LJ5Y 3CCQS 1R8PA 5GAEU 3VAIA 2HZCA 3NS5A 4WKRA 1SJQA 2JVOA 5ITHA 3CF5Q 2CQIA 2X1FA 2LCWA 2DH8A 2DHGA 2MZ1A 1DHMA 2CQPA 2AD9A 4EGLA 1HD1A 2JX2A 3MUVP 3S8SA 2EVZA 1X4FA 2DGUA 2RS8A 2CPHA 2MQOA 4WCEQ 1P1TA 2E5GA 3THPA 1URNA 2X1BA 3MXHP 3DLLQ 3SDEB 3D2WA
chains in the Genus database with same CATH superfamily
5F3ZA 3HDSA 1F2GA 1B99A 1RU1A 1YSJA 4IRDA 2ZD1A 4PABA 1HNZF 3R5AA 3M8RA 4ZPBA 5M2RA 1RHJB 1VBZA 5LMNJ 1IBLF 4WTYA 1Q95G 1C1CA 4QWDA 3PW2A 4N8NA 3E3XA 4JUZA 3LGNA 1HBUA 4AT1B 3DGVA 2IVYA 1XR6A 1R3NA 1R0CB 1FFWB 4X65J 3HFKA 5L1LA 4F0HA 5KFYA 2YNIA 5KFJA 1RCOB 1FA0A 3T6JA 3OXFA 3QFWA 3RAMA 4FXDA 1HQUB 3RBDA 4RUHA 4I1TA 3KTQA 2XO6A 1HARA 1PC5A 1K0VA 4ATNA 3OXLA 3NS7B 3Q8UA 3GFYA 2UUCF 1NPPA 4CZCA 1UZHA 1TR0A 1VQYA 3J81Y 1HMVB 1WI8A 3RW6A 4N76A 3H2UB 1DJ0A 2RRNA 4RLEA 2DGVA 3IFEA 1SJ4P 3BGOP 4DF8A 2QLFB 3W5YA 2FY8A 5GMEA 4YP3A 2YTCA 1UETA 1N52B 4DR7J 3PV8A 3BR8A 1CQMA 2X7IA 1NK5A 1FFGB 1RWOB 3I5BA 2QA4G 3ISND 2NXJA 3P96A 1OS5A 1GX5A 3QZ7A 3FEXB 2CVIA 3GCWP 3PIOQ 1RAAB 1T03A 2H5IB 1OPZA 2FVSA 4U7CA 1F2HA 1D0EA 1JXVA 4OI4A 5AJ3F 4DSKA 3K0JA 1RADB 2EI5A 3HHNB 4ERDA 1WF2A 2DCUB 5JMNA 3B82A 1HA1A 4FF1A 2HAFA 2C1EB 1Q4RA 3GJSB 1T9TA 5C42A 4IQMA 1TKZB 1WOOA 2YVSA 4DI6A 1HBNA 1EB0A 4MT1A 2VZ9A 3V4MA 4P71A 3SZ2A 5GAHU 4EYHB 4P6QA 3AAWB 2GIQA 1B0PA 5FLXU 4ZN3A 3F41A 3Q86A 4KV8B 2AJ4A 4QWAA 3KHGA 1CQNA 1GMUA 3M2UA 4CYUA 3NGKA 1IUJA 1NKEA 3W2WB 4USIA 3FKBA 1BWVA 2CPXA 2DXDA 2ZOGA 1QE1A 2DXFA 4DN0A 3W2VA 2HHPA 3KUEA 1FXLA 2G2YA 1JJ2R 2Z0GA 3HVRA 2WONA 3M8PA 5I42A 3PYEA 4TYBA 3O3LA 4MJKA 4YS2A 4ITSA 1UPMB 2CJKA 3BKUA 5BJRA 3TVZA 3A3NB 1JXLA 2JZ5A 3SQGB 4AD6A 3FBCA 2VFUA 3HF5A 2DHXA 3CXCR 2WSFC 2J5AA 4J9RA 2KFYA 1RT2A 1RAHB 2KT5A 3CVKA 2RU3A 3SSSA 4ZJQA 1N34J 2XY5A 4IDKA 4ECVA 4NLQA 3Q8VA 1RAEB 4Q8EA 1KTVA 1RHUB 3EZOA 3ILIA 4M5MA 2MZRA 3VZHA 3OTEA 1F9FA 1IKWB 2RD5C 2V50A 4XAKA 1ZM9A 2DIVA 1FESA 2HFZA 4UUWA 1SJFA 3KNGA 1SC3B 4M1KA 1QVFR 4X4NA 2HVIA 4ZLLA 1F3FA 1GX6A 3D54A 3LP2B 3VQTA 1EJ7L 3C6UB 4DV3F 4B9UA 5IM0B 1Q5VA 1JMTA 4DUZJ 1HQUA 1GFWB 2QIFA 1RTDB 3HT3A 2ZH2A 1KQSR 1HNWF 3W1YC 3ISNC 1RYSA 1NZ8A 3KLGB 1NDCA 3J81U 3B4DA 3CJ8A 2QE5A 2HZCA 2HLTA 1HMVA 1SCJB 2OAUA 2BDPA 1LKZA 2ROEA 5EX0A 1U4BA 2DH8A 3ENWA 2ALZA 4LIWA 1ZS6A 4QJVA 2XG8A 2MQOA 4O0NA 2BRLA 2FJWA 1SI9A 1KVIA 3HMJG 5ADZA 4WPAA 4BWMA 1AXQA 4LF4J 2GO9A 5IOLA 2AYEA 1N4LA 1RB0A 2HBZB 2HG4A 2VB6A 1JNRB 2AJ2A 1N36F 3GQCA 3BQ1A 3N0VA 5F8MA 3PYGA 2R3VA 1N8RT 2VC1A 5KAKA 4YR2A 1CBKA 1UKUA 3NOCA 4CO2A 3ENQA 3MUTP 4DR4J 5G4DA 4NXMF 4XK8C 1TKZA 2LU1A 3KLIB 4ALZA 4PXDA 1PJ6A 4K8RA 1IWAA 3GYNA 1UTAA 2FJVA 1M1GA 1KQGB 3GB0A 1TAQA 3L7OA 1Y5NB 5H9EJ 2AGQA 4NCGB 1N5QA 2UUAJ 3EGVA 2ZH9A 1GK8A 1WG5A 4HL9A 1CC8A 3SCLE 4QZVB 4KV8A 2R2SA 3R1LA 3IM8A 4OV1A 3PDNA 3W2WA 2DBBA 4A48A 2XMAA 1PYTA 2KDOA 4N56A 4HHJA 1FTRA 2J6UA 2EG2A 1E6YB 4YOEA 1RUSA 2JC1A 2ZJQQ 4EU0A 1FK9B 2XSJB 1G1XA 4RW9B 2BW7A 1BQMB 2C3PA 2I6WA 3SSRA 2B4PA 5F0WA 3IWLA 2OFGX 1CC7A 3MTJA 3LUYA 1Z1ZA 2ERRA 3MPDA 3HCXA 1S77D 4JV5F 3SQGA 4P73A 4KHPJ 4LR8A 2V68A 3TI0A 3PY8A 3DHXA 3I5AA 2DPIA 3UCUP 1U09A 2BKOA 2BQ3A 1HI8A 4ZPVR 5FD1A 2QN6B 2XS5A 4ZOSA 2G1DA 5IWAJ 1NLKL 3P8BB 1VRTB 3W8GA 3UDCA 2GIRA 4XTTA 1SQFA 4I6AA 1M5PC 2XHCA 2XZWA 1IKWA 1WC1A 2XY7A 3FSXA 4WYWA 2OH2A 3TX0A 3DNCA 4Z2XA 1C4AA 4B3OB 2HYIB 3MAAB 2CQBA 3GSIA 1S79A 5CD4A 2UXDJ 4C3KA 1G3OA 4JI7F 1BQNB 2H4YB 4DSLA 2KU7A 3N6MA 3R3TA 2MKHA 3V4IB 3MFHA 4OZLA 5U47A 3LP2A 4G1PA 5KFWA 2ZWPA 2VPZB 3C6UA 2A10A 1ZA1B 4OZJA 5IM0A 2X3DA 1JKHA 5M2PA 1C0UB 2AEJA 5KFQA 4U96A 2D3ZA 3KLGA 4MKYA 4MIWA 3PEHA 4F4YA 2GC8A 4LVOP 2E66A 1U6ZA 2F4VJ 1H7XA 2HKEA 4CO1A 5J1PA 5ETNA 3MZIA 5F9NA 3C19A 2UP1A 4DX8H 4LF5J 3W66A 2R2TA 1REGX 4NLDA 4RUCA 1KDNA 5L1IA 2W2OP 2LLZA 2IJNA 1YITS 3NG8A 4DU8A 4DQRA 1FKAF 2UUBF 4E8UA 1S76D 2YKQA 2NPIA 5ETSA 1H2VZ 1VQMS 4A8KA 1S1XB 2MQPA 3FCWA 3P45B 3KJFB 1KWMA 4Q0BB 2LMIA 3BB5A 4AE5A 1L3UA 3AHPA 4LBHA 1ICEB 2CNLB 4ZDNA 2PA8D 2PMZD 3IMQJ 1U1QA 3K8VA 2PA3A 4ZLJA 2XNRA 3X1LB 4QIEA 2RRBA 3NAHA 5B09A 1VC6A 1QSYA 3QO9B 3KLIA 5F0UA 1NJXA 8RUCA 1S59A 4J9PA 3PZPA 4F4KA 1NK8A 2R2UA 3D0IE 4DV7F 3ZZZA 3GYXB 5HJXA 2EKYA 3EMTA 4DR6J 4NCGA 4I4BA 4M5DB 1XEZA 2CJAA 4HI2A 2W7OA 1RP5A 1XK8A 4MK8A 9RUBA 4KQZA 1TZ0A 2Q6CA 3TAPA 2QYCA 2B6AB 3EYZA 5AXKA 2X1FA 2FZGB 5BXIA 2H4WB 4IO1A 1RAOA 3ITHB 3RAQA 5B0BA 1E6YA 3UDLA 2EBGA 4FYYB 1FK9A 2XSJA 3CULA 4JI5J 4RW9A 2J9CA 1BQMA 4NMLA 3GJTB 1ZM3A 1TAUA 1V6HA 4ID5B 3CPWR 2DHAA 1RA6A 5F3TA 3HX9A 3IG1B 3GZ7A 2F8EX 3HHLB 2VBWA 5DGBA 2VICA 4V19X 2PI5A 4LF7F 1OMSA 1V3SA 3OBIA 2XTJP 1NK0A 3NGSA 5LXRA 3W62A 5K8OA 1VFJA 4I0WA 3DOLB 5L9XA 3E8OA 4NCAA 1YTYA 3HHLD 3UI3A 5DLFA 2HHTA 1VRTA 4HHUA 5L9NA 5LSLA 3LO3A 2RT3A 4LMZA 3CIMA 5F8JA 2DR8A 2UXBF 1Q8IA 3UD5A 3NCQA 5B0FA 3H25A 2M88A 2PIIA 4OI3A 1IKVA 4LRBA 3V81B 3ICLA 2C2DA 3MGJA 4B3OA 3MAAA 4EO6A 1R43A 4P2SA 4JI1F 4P7VA 3AJ2A 2G2ZA 2D41A 1VQOS 4JYAF 4LBPA 2QJ3A 4TKTA 3CC4S 3V4IA 2W2PP 1SC1B 4DV6J 1WKKA 1C0UA 2KG0A 1L5UA 2BR0A 4LT6A 4CO0A 1OWXA 4LF5F 2P6TA 3IBCB 5ETQA 4HTJA 3G96A 1CEZA 3QGHA 1FD8A 2AMCB 4B3SJ 4K4ZA 3AB2B 2A18A 1S4EA 2C3YA 3NGDA 3OL8A 1H7WA 2XB2D 3CE8A 2R7OA 1WEYA 2ZUAA 5EHHA 4Z7CA 5D78A 1QSLA 2C2NA 2GW8A 5LOQA 4NWBA 5D77A 3IS9B 2XMWA 3M2VB 3F44A 5DQHA 4YB5A 4JV2A 2ILZA 3PX0A 4RX6A 2HQCA 4CTAB 1S1XA 1PAEX 3FEYB 1WHWA 1GT8A 1U6BA 2DIUA 4F25A 3ZNJ1 4L73A 3VGUA 3FGVA 4P74A 4FP9A 3JQKA 2AYBA 2IYGA 4ED5A 2FZCB 2ZZNA 3PYDA 3PW4A 2KRBA 4RBVA 2JLGA 5IQQA 4ZPDA 4AQYF 2LQ9A 1LFPA 3EGWB 4J9UE 2IIHA 4DFKA 4PWWA 2IPOB 3QO9A 2DGTA 3MD1A 2HWHA 2OEMA 2XS2A 2FHJD 7FD1A 1T7PA 2XZTB 5FIIA 3M6XA 3W9HA 2O67A 5KFHA 3A3OB 1N5TA 4N5SA 5HQ8A 1FEHA 3ENAA 4M5DA 5IT0A 1FJGF 2FYXA 3B6BA 1RTJB 4LJMA 1FWPA 2A0FB 2A6MA 3NMRA 1VIOA 3E51A 2V69A 2FJXA 2B6AA 1FO1A 1XMQJ 4X62J 4DV5F 4CIOA 5KFSA 3HHLC 2XWXA 4JI6F 3ITHA 4OX9J 2F63A 1PC4A 2EK1A 1QTMA 4USUA 4Y2IA 1NSQA 5HVGA 2W9CB 2GGPB 4S0MA 1NCLA 2YH0A 3VALA 3UVJB 4OZ3A 4N41A 1FDDA 3G4SS 3IG1A 1XNRF 5DG7A 1B3TA 3RGIA 4B9MA 2MZQA 2DGQA 4ZP6A 2VFRA 4ECWA 2FQQB 1LV5A 4CLFA 3H59A 2UUWA 3DOLA 2CPEA 1HKAA 5KT4A 5DDOC 1V3RA 4FYVB 1D1UA 5DZ6A 4OI2A 3TA0A 1NMEB 1VCTA 2L08A 3J7YU 1RWUA 5IC4B 2HBYB 2DTJA 2W9BB 5E3PA 3GILA 1DURA 4DPUA 5DM7Q 1KSPA 2CJQA 2QRRA 1Q8KA 1T9YA 3MEGB 1FRHA 4RWWA 3WZ0A 1LOUA 1KRPA 3IM9A 4DUTA 1RT7B 3CCQS 3VHQA 3VGSA 5EX3A 3QPIA 4WKRA 2D3UA 2VHGA 2UXCJ 4RUBA 4I7FB 4ETZA 2NXCA 1H3DA 2MQ8A 3S8SA 5IQ6A 7AT1B 2VFSA 2DGUA 4YR3A 2YX4A 3CDWA 4DFMA 4NZ0A 2E9ZA 1FRLA 2GO8A 4KGZB 3C14A 1OIAA 4DR3F 3IAM9 4NLWA 4KYZA 3CC2S 2XLKA 5KFIA 2VDHA 2RKIA 1H72C 4O23A 2ASLA 3L09A 1NSAA 3Q24A 2CPDA 1IJEB 1XNQF 4F3MA 1H98A 4DUYJ 2VD3A 2HGNA 4QQBA 2MMYA 3M7VA 3O6QA 3UDVA 2JOQA 2FPHX 2APOA 1FF2A 3IS9A 3C3LA 3M2VA 4LF8J 1CJVB 1TU0B 2GMHA 2ZH3A 4CTAA 5CZXA 2PO4A 1CG2A 3KLHB 1NK9A 3GFHA 3W61A 2DVIA 2EFVA 4LFCJ 3I82A 2I0XA 3FFIB 2KZMA 1MU2B 4A8QA 4DX6A 3M8QB 1CVJA 3IA0A 2NLWA 3CD5A 4F67A 1N33F 1U2CA 3OJSA 3T19A 4PAAA 1XMOF 1VQNS 3TO8A 2XMMA 1VIXA 1Q8LA 2AJ1A 2R7VA 2C3UA 4F0MA 4C8ZA 2HK2A 4CI0B 4ECRA 2ZEJA 2VASA 5KFEA 2HVHA 2RH3A 1UEKA 4JI0F 2WOMB 2AQ4A 3AY0A 3TX8A 1AZSB 4NYZA 1CJUB 1VGYA 2E1RA 1RT4B 1RTJA 3MEEB 4UY8T 2D9PA 4I6YA 1W26A 4HDHA 3BREA 3CCMS 5F8LA 3TUPA 2UUTA 1NSKL 5HANA 2A6OA 4QIGA 4CWBA 3CTRA 1JLCB 1RWKB 2GGPA 4XDCA 1RT6B 2LEAA 4OHZA 2V8VA 3D68A 1I94J 1TL3B 2YNHB 3GV8B 4KAIA 1JLQB 2VUGA 4NLSA 3WC2A 3CNQP 3QBCA 1JJHA 3CWJA 1MWQA 1NK6A 3R7BB 4KHMA 2LA6A 3DRYA 5CD4H 1XMBA 3G8SA 5CHCB 3H20A 1TL7B 2CRLA 4NZ6A 2QFIA 2MEWA 2OSQA 4ES1A 1S1WB 5HMWA 3BM7A 2C42A 4FDFA 2CJYB 3BSCA 5KG6A 2G0CA 5HQMA 3NOGA 2N7CA 5JXSA 1WD6A 3G9CA 3RB3A 2W9BA 5C24A 3WX4A 1PYOB 2MXYA 2JJ4D 2PDAA 3UWTA 4OMFG 1F6TA 3SXLA 1VQ7S 4X4VA 3IRXB 2DRAA 3QT7A 2B56A 4RL1A 1MN7A 1VBXA 2HK3A 4A4JA 1AYEA 4I7FA 1HR0J 4NI2B 3RAXA 4QPTA 2ROPA 3L95X 2P9CA 4HTIA 1ZM4A 5C2GA 2V67A 3ZTSA 3FBEA 2NXNA 4IUFA 1Y0HA 3VAJA 1JQGA 3ZZPA 3EVMA 3PO5A 2RQCA 2M9KA 5E3RA 4ELVA 1PSDA 2YQ1A 4ECYA 3E2EA 1HNXJ 2FD2A 1N54B 1BY9A 5IXUA 1KOOA 4NLUA 3QRPA 2MLXA 1CJVA 5D4PA 2Z2MA 1LQ9A 4O3OA 4Y28C 2Y9HA 1L3VA 2CPIA 2FLOA 4PG7A 2E5HA 3MR7A 2ZNZA 3KLHA 3RJMB 4DQSA 3K57A 4QWEA 4ED4A 2DY9A 3FFIA 3QQCD 2X3GA 3ZZTA 3PR5B 2F5GA 1MU2A 2QLJB 4J9MA 1GNKA 3JSYA 1NJIT 2ABYA 2JFDA 2W1BA 5DG9A 1S6UA 1UWBB 2AIRB 4X4TA 3TRGA 2AD9A 2IA6A 3MUVP 1ELOA 3G6YA 5ETKA 4ZVHA 3F56A 4K4WA 1GTHA 4JI3F 4WKYA 1CJKB 3SDEB 3W64A 5GAHI 2B9YA 4NCBA 3KWMA 3U02A 2MKSA 3Q8QB 3GIRA 2WOMA 1AZSA 3Q83A 2B51A 1SJ3P 1CJUA 3FEZA 3HKWA 4KE5A 2ZC3A 3MEEA 1IKXA 2AYMA 4ED0A 2CQCA 2IA0A 3JS9A 3OLBA 5KFTA 3SMZA 4DMZA 2HWIA 3ETMA 2FLNA 2VPXB 4IKAA 3GIIA 1RT3B 4LF9J 3FC9A 1JLCA 3UD3P 5B0CA 4M63A 2VF3A 3BBBA 1VMBA 1RT6A 1U02A 5IFMA 1TL3A 2YNHA 4RNHA 2GZOA 2KVQE 5KFXA 2PT0A 3QAEA 2EFGA 1IWGA 1P9QC 3KOAA 1JLQA 3AOAA 4XIUA 4EO8A 1RWMB 4K0KJ 3FZ2A 2LXUA 1RWXB 5DJBA 4WFAQ 2W24A 2WB4A 1SKUB 3AH6A 3K59A 4WWSA 2VPYB 4OYWA 3DI6A 2F8MA 1TL7A 5M2UA 1VQ9S 2BXJA 3GR1A 3H4DA 2ALYB 1D9AA 4QYRA 4XPCA 3CCLS 1S1WA 1UFLA 2FB0A 5CZVA 5HAOA 4JV0A 4JI8F 2D9OA 1XBWA 4KTQA 3VAMA 3UO0A 3U27A 2JRSA 3K5NA 4QBUA 5BR8F 3IRXA 1MWYA 2JFKA 2ZE2B 4DR1J 3MPYA 1HHSA 5KG7A 1M5KC 4F02A 2JEGA 4DSIA 2H51B 3M1VB 2HVDA 2KYXA 2YWFA 4F4ZA 4PPDA 2FLPA 4NI2A 3D3BJ 1A6LA 1NRKA 4KB7A 2HS4A 1TTHB 2J7WA 2Q3PA 3VQSA 3OTOJ 1I1GA 2HQGA 1TUWA 3AOCA 1VQKS 4ZLPA 3CJ4A 3LWMA 1F9HA 3A8JA 2IJFA 2WW8A 3N9UC 3QZ8A 4J7CA 1A7GE 4BLGA 5EWEA 3M6WA 5D15A 2KB2A 2XYHB 2ZM6F 2VQFF 2B0GA 3KLFB 3QSYB 3MM8B 4X4SA 5IZHA 5B0EA 3G6ES 5DRKA 3GPAA 2AV5A 3PO4A 3G86A 1VC0A 4RNNA 2DNGA 1T9UA 2MTLA 3PACA 1N5SA 2R7TA 1HHQA 1S7IA 1N6QB 4CQ1A 1TFWA 4RW6B 3NGRA 1MNEA 2D74B 4M5GA 3KK2B 2K7JA 2DGWA 4IG3B 4HH0A 4FYWB 2IMOA 1R6VA 2M8DB 2RMLA 3R2DJ 2V6AA 4OHYA 4AUKA 4CLKA 3HFZB 2BJ1A 2XBPA 1UP1A 1YJVA 5KFNA 3UFCX 4ECXA 1T05B 2KJWA 1UWBA 2PFDA 4UZCA 3GIJA 3HJFA 2ZUGA 4HH1A 1Q0NA 3G8QA 3KDOA 3R8YA 3K5OA 2ZVSA 1CJKA 3SDEA 1VLYA 3MM5B 1WDTA 1EIYB 4ZVPB 2LFVA 3LGHA 4E2FB 5C5JA 1Q16B 3CUNA 3BBCA 2HQ3A 4J90A 3IBWA 4FS1A 1LW0B 4OLPA 4G1QB 1KNZA 1YZ6A 4YY3J 1GAOA 1XTZA 3W5XA 2VKZG 2ZH4A 3RRGA 1YGYA 5J2QB 4PG5A 2IDEA 4OYIA 3T5HA 2EFQA 1QSSA 4RBTA 5DZ7A 1G2EA 1Q7LB 3MTKA 4PXCA 1S49A 3GTYX 5KFBA 1HYSB 4K50A 2OP5A 4F3OA 3PX6A 3KMSA 1RI7A 4KY3A 4PXBA 1TL4A 4LRDA 2NS1B 4FKXA 5AXLA 3UR0A 2MHNA 2B9EA 3RBXA 4F04B 2R7WA 4J37A 4DSFA 1YDLA 5HQLA 1Q53A 3AT1B 4CP5A 3TZYA 4WJBA 4FYXB 4ZCIA 1RACB 3VAIA 2ZH8A 2AW0A 2BKPA 1T9VA 2LCWA 1UPPA 1G4CA 5J2NB 3HSDA 4X64F 2Z4PA 3QT6A 4FKYA 5KT3A 1KLNA 4A8YA 2IFXA 2BM1A 4QW9A 5KFAA 4RW7B 4LQ9A 4NLYA 4X4PA 1U45A 3H98A 4DLGA 1U1MA 2KM8B 3PCOB 4O44B 4EBDA 3AFGA 2ZE2A 4J91A 2DEJA 3CJ5A 5LXYA 4DS5A 3M1VA 3R5BA 3TJ8A 5E3QA 3BGRB 3VAGA 4FXWA 4TY8B 2X1AA 5HBMB 3T9ZA 1S4FA 4JI4J 3J80Y 2AJFE 5GADU 1S97A 3M8WA 3MAQA 3MFIA 3UN3A 4ZPAA 2MQNA 1NSPA 3FBFA 2HZAA 2PE8A 1ZH5A 3PXGa 1R8CA 3FDSA 1NPRA 1B0TA 3KLFA 1DQ8A 3MM8A 1VQ4S 3I0RA 4DCPB 5FJ4A 4YB6A 3QATA 4G65A 4LF2A 1Q79A 5HI7A 4LF6J 2RQKA 1WKJA 5CH7B 5KFDA 1N6QA 3J7ZT 3I4PA 2A2CA 4RW6A 4WXWA 1AW0A 4IG3A 1DARA 2DISA 3VZIA 4GVBA 3OFHA 3LAKA 1IJFB 3HK2A 3T1HJ 4LRAA 1JNZB 5THWA 4TQSA 3T1AA 2BA9A 3KG1A 1KS2A 2GQ2A 2HVZA 5MAOA 2ZH5A 2H3EB 1ZAVA 2DRBA 2FC9A 4F3QA 1AUDA 1RA7A 2UV8A 4Q7AA 1P6TA 1SKWA 1GH8A 4A8FA 4FYDA 2D1CA 2HHHF 4DPOA 2WBRA 1OY6A 3MM5A 5SUHA 2QA4S 2DO4A 4M5KA 1GTEA 2F8HA 1U8WA 2FVQA 1LW0A 3KLVA 5D0HA 3ZFVA 4YMEA 4G1QA 2NZ4A 3MI7X 3SSQA 3OXGA 5G0RB 1N32F 3KUGA 5J2QA 3H5XA 3MHYA 2GHVC 2YWHA 4G1IA 2B9XA 2V94A 4NEYA 4UUXA 3I4HX 3NGTA 4W92B 4PKDB 4RO0A 4B17A 2VFVA 5KOXA 2HMIB 4PG4A 3FZBA 2CYYA 3IGVA 1HD0A 4DCOB 4DPWA 4YHHJ 2C28A 1Q7YT 2HHXA 2DNOA 1FRJA 3KDNA 3PJXA 3BGLA 3O2IA 2RS2A 4M5HA 2SXLA 3FUYA 2BOAA 2ZBQA 3W60A 2GV1A 1X4EA 1HBOB 3IWXA 3QLHB 2QEXS 5AE1A 2KM8C 4CH1A 2I8EA 4QR0A 4OZ0A 3RYLA 1D9DA 5J2MB 1FNOA 3R5CA 3T1YF 3IR5B 1WC3A 2FJAB 1HWIA 4RW7A 2XULA 4RU2A 2ZITA 2VG6B 3B78A 4O44A 2R7SA 3NS6A 1FDAA 4EZ6A 2MDAA 1O0PA 2AZ1A 4KKOA 3WQPA 2JEJA 5HO4A 3M6UA 4M95A 1V3ZA 1RXOB 1EARA 3BGRA 2LEPA 1S0MA 4TY8A 3J80U 2CQDA 4DG1B 2OSRA 1KR4A 4QWBA 1R31A 1WTBA 4C8LA 2RNEA 3D6MB 2QC3A 4OYOA 3NNAA 1OQ6A 3BN4A 3PHEA 1QLNA 4C11B 3PFOA 3N4WA 2XZDB 3L3CA 2E9RX 1FHTA 3TQEA 1BGXT 2V4JB 4IO9Q 2ASYA 1J2VA 4GKKJ 1GXTA 3HT0A 3QAUA 1UJ4A 1VJWA 4F2SA 2AT1B 1S6PB 1PBUA 1VDHA 4DN9A 5JUMA 1BE4A 4X4OA 4ZK7M 4B9TA 4B3TJ 2E5LF 4EGLA 1SQEA 1CJTB 4JI2J 1S5ZA 2X1BA 2ZOMA 2CA9A 2YQ3A 4I56A 4NASA 3NRBA 3CJ0A 2VBXA 1EHWA 4DPTA 4J9KA 2OGUA 4URSA 3NCPA 1U7LA 3JTOA 2R8IA 1PGZA 1HNZJ 4YQWA 5A8WA 4BBYA 3KK3B 3GSDA 1L3SA 1J5EF 2DKOB 1IBLJ 1MN9A 2MZSA 2CQ0A 3BEGB 3BKFA 2Y8WA 3A1YG 3M8YA 1K1QA 3QYYA 1FJEB 2Q79A 5HVHA 1KFDA 1FWLA 2RHQB 4C4WA 2QO3A 3VV2B 3NCRA 3NMAA 1YWXA 4KGVB 2PEHA 4DR2F 4C0HA 3C2PA 1RK8A 2MB0B 2VG7A 5KFMA 2QX0A 5AT1B 3GLJA 1O5JA 4YB1P 2V4QA 1B7FA 4B3RF 1JLFB 3GIKA 2HMIA 3SQOP 1VQ5S 5HK4A 2AX1A 1X5SA 2VDIA 2HBRB 4OV6A 4ED6A 4QIFA 1EKSA 4ANEA 5E5NA 2DB1A 4Q2LA 2ZH7A 1RKJA 1UVKA 5DQGA 1HBOA 4KC5A 3KK1B 1XR5A 3PRVA 1FX2A 2BJ3A 3LPEA 3QLHA 3LH2S 3Q2TC 2Z2LA 4OYPA 4BC7A 1ACMB 3J7YI 1HW9A 5JVHQ 5CXTA 1JXEA 5AJ3J 4DCJB 3RW7A 5J2MA 4MTPA 1IR0A 3N79A 5IT4A 3CC7S 2YNGA 2W8KA 1K8AT 3MD3A 3TVKA 1LEOA 2VG6A 1KVKA 2Y1LB 2ZHOA 1DLOB 2GJFA 2DNHA 3IC1A 1Y3KA 4MH8A 4B9VA 4KJIA 3JSBA 3MUMP 3EWGA 3S01A 1YLXA 4EBEA 4DG1A 3NL0A 1A9NB 3N5FA 3QFHA 4DV4F 4Y2MA 1HIYA 1UFWA 1IQTA 2V63A 3ZTPA 2XI2A 3I5CA 1DFDA 1GMWA 5GAGI 5D0EA 3N28A 2V4JA 4NPOA 3LQVA 1WEXA 3PW0A 1FDBA 3DDNA 3NEKA 3HLUA 2FGCA 4LSZB 1PIEA 3U1NA 3KUHA 3PM9A 3OLAA 5EGYA 2MLZA 4EI2A 1H73A 3E01B 1OY9A 3JSRA 1CJTA 3THTA 4P9SA 4M5NA 4TU8A 2B8PA 1NAQA 2L9DA 5ETTA 2BUNA 1S99A 1GQEA 4RZRA 1TK5A 4HACB 4U95A 2QL7B 2MZTA 1GEHA 2HEKA 2V8PA 1NDLA 4X66F 4LR7A 3BPSP 3LALA 1U26A 3KK3A 4FF2A 3CB4A 2ACYA 4R0EA 1S6OA 3QNWB 3HZEA 3IXQA 2HNZB 2G0IA 2OFHX 2OPSB 2XMVA 4TU7A 1T0TV 3D1HA 1SIZA 3M32B 1Q78A 2IJRA 2YWKA 3EVOA 2YKMB 3D1OA 1T9WA 2J9DE 2YBVA 3PVXA 4DV3J 2EK6A 2ZKTA 1PYSB 2K3KA 3O44A 2BYCA 3MDFA 4OJGA 3PW7A 4LFAF 1S12A 2O1PA 3B4MA 2R9LA 4NXNF 2E29A 4C8OA 4KGKA 1J27A 4GO7X 5ETLA 3AODA 3LGMA 2WSEC 1HNWJ 4ZN1A 2QA2A 3MMCB 4J9OA 3CCWA 2JVOA 1SJ1A 2B5JB 1F5CA 1JLFA 3HPOA 1NB7A 1WOSA 3IP0A 3KKFA 4R5PB 4RU9A 3S7RA 4CLUA 5KFLA 4TNOA 1UJ5A 1TQLA 5CA5A 4ZVQB 1SIWB 2E1AA 1FTCA 2B4OA 2Q66A 4ILLA 4DL2A 2UU9F 2MKYA 3ONQA 5KOWA 1T3OA 2B4UA 4NE9C 2QV6A 3TW0A 1J5OB 3KK1A 3HD2A 3I0SB 1VRQC 3OFFA 1N36J 1N0VC 2MJNA 4B3MJ 3CGIA 2HSEB 4ECTA 2Z30B 2ZBCA 2HFSA 3MPWA 2Z57B 2CAJA 3L7UA 3UD4P 1MW7A 3G87A 4P2XA 1PAUB 3CJ3A 4NXMJ 3D0GE 1UWAA 1UCNA 2HS0A 3RG6A 1DQ9A 3UNYA 3BO2A 2DCLA 1DLOA 2DNZA 2Q6BA 1VHIA 4M5LA 4ANCA 4IRKA 4X4UA 2IMWP 1KHWA 3ADAC 3TWZA 1YJNS 3OUYB 2FHOB 4HKQA 3FCHA 1SQGA 4DSEA 3OVBA 5RUBA 4A8SA 4WTOB 2CJBA 3DKDA 4M94A 3FMWA 4LIRA 1C1BB 1VJQA 2XLIA 2G2OA 3RB0A 3F73A 1SL2A 2G9OA 2F40A 2CQ2A 3CCUS 3PW5A 1D09B 4MK9A 1S10A 2IM2A 2QSFA 3DHWC 4GO5X 3TP2A 1OYDA 3EX7B 1PO6A 3ETOA 5K8MA 2JLFA 1IVZA 2YKNB 4PG6A 2MLYA 4Z37A 1N88A 4JV5J 4RUAA 3DOKB 3LP1B 3E01A 5T7LB 2G4BA 1HI1A 4UQGA 3N01A 2HRTA 4FBTA 3KHRA 1V5VA 1LXNA 9ATCB 1LK5A 1X31C 4HACA 4EMDA 4KH0B 3UW1A 4IG0B 4PWUA 1LW2B 4DV0F 1WC5A 3EJMA 1DTTB 2IBOA 2YWEA 4OL8A 2B43A 5B0AA 4WP9A 3W63A 1YQHA 1FKPB 2WVBA 3WC0A 2BVZA 2HNZA 1B7YB 2QLBB 3CDEA 4JI7J 2OPSA 2BJ7A 3C15B 5I3PA 1SC6A 4WZMA 5A8RB 2FY1A 1RHRB 4OQJA 3FRYA 2YKMA 2FDNA 2KFZA 3BGUA 2M5YA 1AT1B 1SV5B 4CM0A 4P2FA 1G7CB 2DR9A 4ECSA 1MLAA 5HP1B 1ZYQA 2KG1A 1K9MT 3MMCA 4J5OA 4YDDB 3KYLA 4W90B 5EUHA 2B5JA 1YVFA 4I2QB 3L4BC 4B02A 4UOFA 2ADCA 2AF6A 3HSZA 2DRDA 3H5YA 4USWA 1MWZA 1X5TA 2CJ9A 2W7AA 2XSFA 1NU4A 4R5PA 4MKAA 4QR2A 4IH6A 2K1RB 1K1SA 2ZJPQ 3MM9B 2RAQA 4L76A 2YWWA 2UUBJ 4K4XA 1FWKA 1K44A 2J7KA 1WI6A 4X4RA 3WIVA 4B3MF 1J5OA 2NQPA 4RNOA 3BSOA 3I0SA 3BV8A 1W2BR 4WU2A 3AQPA 1FT8A 4DFPA 3VTIA 2EFOA 2X51A 3THVA 4BDPA 3TQ1A 3G2XA 1YG0A 4K2XA 1F5BA 1RWPB 4W98A 4U8VA 1U1KA 1RTHB 3P5BP 1SKSA 2VBYA 2E7WA 4AL7A 4N77A 3DMJB 1P8GA 2D3O1 4MK7A 1JWWA 4C48A 2JEIA 3SIPB 4CNYA 1VHFA 4DV7J 4V1Ak 3CCVS 1JB0C 3PEJA 2J6SA 1S48A 3GJRB 3OUYA 2VQEF 1R8PA 2CDRB 2Y0BB 3BKTA 3MEKA 1SL1A 3NS5A 3RR7A 2UV8G 1LFWA 2DHGA 4CO4A 1CPZA 2JNJA 2GJIA 3NXZA 4WZQA 2PD1A 1C1BA 4AXIA 3V2UC 3TVYA 1S6QB 1ZETA 2R42A 1LWFB 1IBKF 5BYRA 2LECA 1UJ6A 1OY8A 2YX7A 3RBZA 2P2CB 3CMQA 1S0OA 1RSCA 2ZBIA 2HW3A 4O4GB 4Q44A 3B54A 2MQMA 2ZZMA 3DRXA 5H9EK 3BQ0A 5KT5A 1MSWD 1UFKA 2YKNA 3ZXWA 2D69A 3KMQA 2KZZA 2G13A 4LF7J 4OIXA 5F8IA 3LP1A 3OJUA 1VR6A 2E7VA 5T7LA 1LK7A 1TMMA 2VG5B 2LU2A 4WFNQ 1Q86T 4ED7A 1YI2S 2XLJA 4ZCKA 5KFFA 4FNIA 5J2PB 2QMWA 1TFYA 1YKWA 1PJ5A 1LWEB 3QIDA 1X9WA 4IG0A 3AXMA 1JJCB 1LW2A 4TLQA 1RAGB 4K4UA 2UXBJ 3BSNA 4MFBB 1TKDA 3M6VA 1UAWA 1KHVA 1HHTP 2HNYB 1H2TZ 1FKPA 1XWLA 3OSPA 4JI1J 4JB8B 3C15A 5A2QY 3N5BA 4EWTA 4JYAJ 4WYLA 4ELTA 1RTDA 3KFWX 1SH2A 1TKXB 4WF9Q 2RQMA 3N6LA 1DRZA 3CJKB 1QAIA 4U67Q 2GMLA 1DQAA 1FNXH 3ZZOA 4Y2KA 1SV5A 1CULB 4NRUA 5HVFA 1WNEA 5EWFA 5HP1A 3ZC4A 3OV7A 2C2RA 2FZKB 2RUSA 1WEZA 4YEAA 2P5VA 4I2QA 4IOCQ 3OFEA 3AOBA 3LW5C 1VYAA 2C2MB 2CXEA 2D7SA 2IM3A 1U1NA 2XC9A 1RWWB 1S0VA 2ZVIA 4R8UB 2LQBA 2K1RA 3R97A 1UVLA 1SC4B 1R8AA 1OO0B 4C9DA 3MM9A 4UF4A 3MCMA 2YNFB 3MPUB 2N3OA 1WJ9A 1PJ7A 3ILOA 4DR5F 1X8DA 2ZDPA 2UVWA 2A2DA 3EUNA 3QWUA 3C16B 5CYMB 1T95A 2QL5B 2DNKA 4WFZA 2B9WA 2RF2B 1QAXA 1LWXA 3DLHA 3CDBA 4WFBQ 2MKKA 1UW4A 3GCXP 1NJYA 4CT8A 3G6XA 1RTHA 4NLVA 3IGNA 4AQYJ 3JQMA 1GXUA 2BV3A 3DMJA 1Y00A 1RWVB 4NA2A 4Q43A 1WTFA 1VI7A 1C0TB 3MR2A 1R7IA 4QIVA 1TVRB 3QRQA 2DNLA 3W65A 2MQQA 4C3LA 3PNIA 1FJGJ 2PSZA 2MYFA 5GADI 5I4MA 3BN7A 1AUSL 2MZJA 4K5RA 3PIPQ 2BABA 1RDRA 2Z58B 4PXEA 4DV5J 2WBMA 5KFVA 2FGOA 1S6QA 3H2VE 4JI6J 2CNKB 2EPIA 3FRZA 1LWFA 5GMKa 4GKJF 4BCAA 5KFCA 4PQUB 4X2BA 1Y9OA 1U8SA 4RJVA 2XMKA 4LF1A 1TL1B 4O4GA 5DDQC 3OT9A 1U1OA 2ZC4A 2QLWA 1XNRJ 1FRXA 3M30B 3H5SA 2AU0A 4EBCA 4D3GA 4LFBF 4DZDA 2Y8YA 4ZCLA 2VG5A 1NH7A 1VQSA 4ZITA 5J2PA 2PMWA 1FX4A 2GHPA 1NM2A 1LWEA 2HHQA 2U2FA 2W8LA 2CUYA 3A8EA 1XJWB 3A12A 1N5VA 1BQNA 4K2JA 4MFBA 2FUG9 2HNYA 3UQSA 1REVB 4DS4A 3OL9A 5A2QU 4L75A 4TXSA 2CQIA 3OR1B 2RJZA 3O1LA 1UW9A 3K7RA 3K8WA 3QGGA 4M5JA 3WX8A 1TKXA 4WCEQ 2W25A 3SFUA 4Y2CA 1U48A 3CJKA 4PR6A 3UE2A 4CO3A 5L1KA 5C25B 1NH8A 1CULA 4MYUA 2F3JA 2NXUA 1X5OA 1HBNB 3I87A 4DR3J 5ETRA 3CJSA 2NR0A 1U1RA 3EE3A 5J1EB 5JVGQ 5JJBA 3D6FB 5H9FJ 1W7WA 3D3CJ 2XS7A 3CDAA 2J7UA 2EC2A 2YWGA 4UOGA 1XNQJ 2K3IA 4NX9A 2OD4A 2YXLA 2W4PA 4OJ1A 1SXLA 1TP7A 4R8UA 1Q5YA 3QMQA 3MMJA 5KFRA 1RWNB 5D4LA 3UCGA 4Q0BA 2DNQA 4DPYA 3W2VB 1YBAA 2Z56B 1FEEA 1APSA 2WONB 3C16A 5CYMA 3DRRB 1C4CA 1TL5A 5T41A 3M9NB 2RF2A 3D1QA 1RTIB 1OSCA 1YJWS 4OI1A 2FVRA 4OYAA 5F41A 1N33J 1KFSA 4K4TA 2BZ2A 5LSOA 1XMOJ 1A0OB 4GVLA 1ZPWX 1FRIA 3ILLA 4FF4A 5DG8A 2DYAA 3HZGA 3OR2B 2IVMA 3GU0A 1C0TA 4DWIA 1TVRA 3H7HB 4JI0J 2M4MA 1FJCA 3PTWA 1N48A 4KHRA 4UOHA 1KTQA 4ED8A 3POTB 5LMUF 3VR1A 4NLRA 4E0DA 2ZKUA 1XR7A 2GAHC 4N7TA 3ZNUA 3VGVA 3IRWP 4GC6A 2ZH6A 4P10A 4DV1F 4ID5A 4LRCA 4ZJOA 3UNGC 3TOQA 1RCXB 4MIBA 3AQOA 4IQXA 3TJAA 3T5JA 3HHLA 4PQUA 2HHUA 2Q43A 4ZVGA 5H1SV 1ITPA 4QWCA 1V5IB 3L7PA 1TL1A 2VONA 4N8OA 1RTZA 1SPBP 4NZ7A 4ZKAA 3SEOA 4FNHA 3M30A 3T9NA 1WSRA 4KSEB 2LA4A 4QW8A 1E6VB 2CPYA 3LAMA 1VS3A 2XI3A 1MG7A 4W4MA 5E3AA 1NPKA 2R8GA 3EVWA 3D6TB 4YB7A 4C8KA 4H54A 3V81A 3MOJB 1NDKA 5L39A 2XMJA 1OJ4A 5C7PA 1IBMF 1F1BB 3NGUA 4A8WA 2PMHA 4L6V3 2V34A 3OFGA 2V2KA 4ANDA 1FI4A 1REVA 2QZ8A 3WBZA 3CSKA 3HHKA 4H4MB 5I3UB 1R89A 3S6EA 3OR1A 2JVRA 4HLBA 1T3NA 2DJWA 2FJBB 1NBEB 3CJRA 4DFJA 3TAQA 1UEUA 4V19J 3FJ2A 3M9OB 1AA1B 4CLYA 3DRPB 1NK4A 1PILA 1BD6A 2KHCA 4U9RA 2LKZA 2H5JB 4RR5A 4WP8A 5C25A 2KFNA 4Y65A 4WIQA 4F50A 3HP6A 4F8RA 2ZDOA 2K8GA 2DNMA 3VCDA 2CQ3A 5GAGU 4IH7A 1XIQA 4ZJLA 3BS9A 2WAQD 2CVEA 5J1EA 3ILJA 1RLCL 1F9EB 4H4OB 3JSMB 2R7XA 3MMBB 2P8IA 3LPYA 2BE9B 1S7HA 5F8NA 3DYAB 4CLZA 2V4RA 4CLLA 3ZO7A 3Q2SC 3HHDA 1WHXA 2GNKA 2KKHA 4Q45A 3BZQA 3W9IA 4O3SA 3G8TA 1CSJA 2YKAA 4WBFA 2MKIA 4ZVSB 4KT0C 2FHJA 1IM6A 4Y6IA 4G6VB 4AXJA 3DRRA 3MR5A 1JLEB 2EEYA 1S9GB 5LJ5Y 1SJQA 1RTIA 2XMUA 4CH7A 3CF5Q 3GMGA 4YN3B 3Q89A 4Y34A 2RS8A 2Z2ZA 1UA0A 3D2WA 3FNNA 1EZZB 2BJ8A 1YJUA 2HQDA 3OR2A 1Y3JA 1TUGB 1MMDA 4JI3J 3KJQB 4C8YA 2JEFA 5LMNF 3T5KA 3UDEA 5HMXA 1VBYA 2VBZA 5D0GA 2MHEA 4BC9A 1FJ7A 3NWRA 2WCXA 3KG0A 3ZZRA 4X65F 3R5JB 3POTA 1HI0P 2F4FA 3W7BA 2JHEA 2CDQA 1YZ7A 2W9CA 2R8KA 4FS2A 2WVDA 3CCJS 2W9AA 2YKOA 4P75A 2WHOA 3D7SB 3UVJA 5KT2A 4DL7A 3R6LB 2HZVA 2HBQB 4KBIA 2QYGA 4NEZA 1NB2A 4P2MA 2OKQA 5DLGA 4IFVB 1U6FA 2HIQA 1M5SA 1M90T 1JKHB 4IR1A 1HWUA 3EDRB 4OYBA 2V2QA 3O8WA 3RRKA 3GG1A 1Z2ZA 3FVYA 2AP6A 3DLEB 4C8MA 4OLOA 3ET6B 4ES3A 2IAJB 3ZZUA 1E6VA 3BQ2A 3BDPA 4MYTA 4QU6A 3OVSA 2UZAA 3HD1A 2B3TB 4MAKA 1GMVA 4DR7F 2MQLA 1S72S 3OPKA 3MEGA 3LP0B 4LSLB 5ETMA 4JI8J 1NHUA 1SJRA 3CO9A 4CO5A 1RT7A 2IM1A 1T8EA 1R6YA 3IBFB 5BR8J 4NLGA 4LQ3A 4ECQA 1I3OB 4IFYB 3NLCA 3W9JA 1HL6A 3QJJA 4H4MA 5I3UA 3AD7C 2N4CA 2VU5A 1QAJA 4KFBB 3N6NA 1CS4B 2QL9B 5E41A 4TQRA 2ROGA 3GV7B 2E1CA 3W5ZA 3DRPA 5IT9Y 2IHR1 1HBMB 3Q8PB 2PC6A 1ZAXA 3DU5A 5A0YB 4J9LA 5T14A 3T6BA 3BO3A 3SYZA 5KFGA 3CJQA 4UOCA 1QVGR 3MAHA 1I5OB 5AE3A 3MCOA 2YH1A 3ULHA 3MMAB 1RAIB 4H4OA 2CQ1A 2ZM6J 2HPUA 3JSMA 2VQFJ 2FLLA 3MMBA 3CCES 2EFPA 2F65A 2COLA 4DPXA 1R0BG 3DYAA 4O3QA 2AJQA 4ENOA 1X9MA 2CZ4A 4WIIA 3OHBA 1U24A 2OD6A 4Z7YA 5A6PA 2JC0A 1FE0A 1LXJA 2JWNA 4I6WA 2CPZA 1VRUB 2BJDA 4DEZA 3DFEA 3A4TA 2BEFA 3M8QA 3AJDA 2K2PA 4WE1B 2O01C 2KXHA 3T3FA 5LJ3Y 1JLEA 2XGPA 2WW4A 3FCVA 5EDWA 3SI8A 2RHSB 1S9GA 1XN9A 4ZVUB 1X4DA 4C0BA 3MM6B 3PKMA 2NREA 1NHKL 1N34F 2I9SA 1WELA 3HM9A 1WWHA 1LNQA 2I2YA 3AXKA 2LQJA 3TNVA 2BACA 2XYGB 2RDJA 4I69A 4ECUA 5ETPA 2NSCA 5A8KB 4RKUC 2UVUA 1RT4A 1X60A 1B64A 1U1PA 3A8KA 2WSCC 2HFVA 2M70A 3JXOA 4A46A 2LDYA 4CT9A 1ULRA 4U7UD 2VPWB 2DNPA 1XQIA 2OPRB 1IKVB 3LA0A 2J8AA 2HWTA 3I31A 2IRYA 1W25A 2HQFA 4C3MA 2H1YA 3HSGA 4KH1B 4LUBA 3K17A 4DUZF 4B9LA 1EETB 1JJ4A 2XY6A 3CDUA 1JIHA 1ZPVA 3LOUA 1FNMA 3RZAA 4IFVA 1GXLA 2V9KA 5KFKA 1HLWA 1ZTWA 2OPPB 3UPFA 3I56S 3EGNA 1NXIA 3DLEA 3DXSX 5GAEU 3ET6A 1DAXA 2IAJA 1FRMA 2AKWB 1RHQB 2QLXA 2OO4A 2CQPA 1YRXA 4XO0A 1P1TA 2W2NP 4LF4F 4RNFA 4EK2A 2BE2B 2O3DA 4MIAA 2OLWA 3LP0A 2DGSA 4X64J 4LSLA 3F0NA 3I55S 3BSAA 5KFUA 3QWPA 4USVA 2DR6A 4YFUA 2GQQA 2HFUA 3V6JA 3JAMY 2KT3A 2ZZTA 4IFYA 4UQTA 4URQU 1HW8A 4DF4A 5AXNA 2DNYA 4KFBA 4DR4F 1R0AB 3P3DA 1X4CA 4CLPA 2BM0A 1CS4A 2BJEA 5IT9U 2J0WA 2JSXA 3UN2A 2HFNA 3DOMB 4DXLA 1U25A 3H4BA 3TJ9A 1NJWA 1FDNA 1HBMA 4OX7A 2AGOA 3HI9A 4KRWA 5A0YA 2UUAF 1YBTA 2W2MP 3DDIA 1OYEA 2DR7A 1R8HA 2RE1A 3NNHA 1RISA 2DXEA 5E0OA 3KJNB 2C3OA 2R8JA 3MMAA 2HQIA 4NRTA 2EBEA 2WVFA 2Y0SD 3R2CJ 1L3KA 2R4FA 1YHQS 1ZAWA 4DJBA 4IH5A 1H74A 2HLUA 1IR2A 1Y10A 1T11A 5GVQA 3VF0B 2OHDA 4Q5VA 2KVIA 3VAKA 1VRUA 5DDRC 1M5HA 3ZZ0A 4KHPF 2DH7A 3OTBA 2V2VA 3IR7B 4WE1A 4B9SA 5K14B 5D4OA 3Q23A 3MM6A 4FPIA 4USMA 2FTRA 1SKRA 1SL0A 5IWAF 3QJPA 2LEBA 1BQXA 2BRKA 3OD2A 5KFOA 1NJZA 2RU9A 2DH9A 3JYTB 5B08A 1LWCB 3D67A 3BBFA 3SV4A 2P6SA 1NNDA 3HKZD 3JB9k 3MOZA 5A8KA 2HHHJ 4DLEA 1RU2A 2L48A 3CCZA 4DL3A 8ATCB 3SV3A 4DV2J 3MECB 1KKHA 2ZHBA 3DC2A 4EYIB 2M3DA 4WU3A 3SCIE 2UXDF 2KN4A 2DGOA 2HHVA 4M5IA 3CW2C 3J81j 4EZ9A 1X5PA 2Q1LA 3ZTOA 1RT3A 1WDDA 2OPRA 1N32J 8AT1B 2HRUA 5L1JA 4ZA1A 2KTQA 1B0VA 2P9GA 3FMBA 5CCLA 1EETA 2GMJA 4KR0B 1VK8A 2J8SA 4EEYA 2R7UA 5K9FA 3H40A 1WC0A 4C0OC 1RT5B 2F4VF 3NP5A 3GIMA 2OPPA 3C14B 1SH3A 1S1TB 4ZVTB 2PN6A 4C2MA 1U49A 2J9DA 4WFYA 2RKIB 3Q0AA 3WDOA 4EUVA 2V8DA 3VVUA 1HNIB 1TK0A 2J9EA 2POKA 2MKCA 1R27B 4ICLB 4QPXA 2XCAA 2MSSA 3D5MA 5EWGA 3EXCX 1TUVA 3AJ1A 2YQ0A 2BE2A 1BLUA 6AT1B 3VGTA 4RPFA 3HVAA 4ZP7A 3T1YJ 3UN5A 1OSDA 3CJTA 3JAMU 4C97A 3M9MB 1Z2LA 4DZ6A 5CCMA 4RBUA 1QJHA 2F1FA 2PI4A 1VC5A 5EN1A 3TZZA 3CD6S 1UEVA 2N82B 3C6TB 2IYIA 3ZTRA 4Y0FA 2NUHA 2BOPA 5K20B 1R0AA 2VA3A 4YUDA 4JP8A 1URRA 4C8NA 3DOMA 2CNOB 3B8HA 3SFGA 2GQCA 5K8PA 4K4VA 5A6WA 5E3CA 4QIWD 4IOAQ 3LWLA 2UVRA 3HULA 4URGA 1VISA 1HWLA 4HYKA 3RB6A 3CCTA 4DR6F 3P49B 4ER8A 4ED2A 1FVQA 1U47A 2MKJA 3DCAA 3CMAS 1HWJA 1F0XA 2QSWA 2CG8A 2IRXA 2BW2A 4FPRA 2KYZA 4F26A 5MLCV 3ZTQA 3DLJA 2EW9A 3TARA 2RIJA 1UMJA 1CLFA 2UVVA 5ITHA 4DX7A 1RGVA 3CD7A 2HNDB 3CIZA 2MZ1A 2AZ3A 3BYRA 4JI5F 3KK2A 3MF5A 1X4FA 1BXNA 1P1LA 1B70B 1NKBA 2E5LJ 4QU7A 1RAJA 2Z8QA 4F36A 3DRSB 1VOMA 1T05A 4ID8A 2EXUA 4DL0C 2Y1IA 4P7TA 5CYQB 2Z2YB 5K14A 4UY85 4PEOA 1P27B 4ES2A 1WORA 2CG4A 3KLEB 1UVNA 1H0HB 1W2IA 2YY3A 4AL5A 3QIPB 3QJLA 4ZHRB 2HURA 4HDGA 2P9EA 1RBLA 2O5DA 1TMJA 3JYTA 4DV2F 4GMKA 1J5EJ 4KPCA 1LWCA 4X84A 4ZVRB 3IN5A 4HVZA 4OYXA 3UCZP 3KNAA 2ILYA 4OHWA 1X7VA 2CQ4A 1NKCA 2FIUA 2NXEA 2A1BA 2L3MA 3MECA 2V9WA 4LREA 1XERA 4CLTA 1UA1A 3C8YA 5C24B 4KGXB 3BYPA 4FF3A 1D8YA 4KO0B 4K4SA 2KJVA 2CNNB 1HYSA 4DR2J 3T41A 1ZOTA 2CQHA 4TN2A 2XCPA 3T5LA 5LSRA 2E1PA 1TELA 4DV6F 1K73T 2GVZB 4NYOA 3TR5A 3K58A 2YKPA 4B3RJ 3WIUA 3RU0A 2XM3A 4OFZA 4B9NA 2HIYA 3ZZYA 2V0NA 1RT5A 1ZZNA 2HRYA 5HROB 4B3SF 2HFOA 5HATA 4OJHA 4Q8FA 4I67A 1S1TA 2ACMA 2DK2A 4ED3A 5DM6Q 3G82B 1RAFB 1Q82T 3AA8A 2W4CA 1HNIA 2W4DA 4MKBA 2MJUA 5J2NA 4KGMA 2PEBA 3I32A 4ICLA 5DDPC 2QT7A 1RLDA 3G71S 2OUGA 3P6YC 4GC7A 2OMOA 4DDFA 2WRMA 1IXKA 2FJEB 3GFXA 2F7VA 3MPVA 2IRUA 1HWKA 4ZCMA 1RT1B 3D9BA 3J7AN 3RUBL 3D28A 1ZTTA 1NK7A 3R7SB 5D3GB 1IM4A 5SZTA 5HBMA 5LL6d 3C6TA 2L9NA 4DL6A 2VA2A 2VODA 2C2OB 2AEMA 1OPIA 3PR4A 1SUQB 1HNVB 1MROB 2A3JA 3I96A 1HPZB 2RDDA 2QGFB 4Y3CA 4DV4J 2CWXA 3TA1A 3BPDA 2RUGA 3NBPB 5L38A 5KG0A 3TEHB 5IV4A 2BQUA 3A8IA 4ZVOB 5KG4A 3NAIA 4ZIVA 4A8MP 2GS8A 3PG9A 1XMQF 4X62F 2J0XA 3M05A 4BWJA 1VQ6S 4OX9F 3FQLA 1IKXB 2RVJA 1WF1A 2HNDA 4NLTA 4FXVA 3X3UA 4U7UK 1KN6A 1YJRA 4RW4B 1QM9A 1K0TA 3TUJC 2B8QA 4HT7A 1VQ8S 3DRSA 1RJJA 2AJ0A 1KBRA 2EKNA 4ETXA 1F3VA 5CYQA 1QTNB 4IYQA 3EZ5A 1AROP 2AX0A 5HMZA 1Y7PA 3KLEA 3MURP 4OHXA 2XYPB 3QIPA 2HGLA 4ZHRA 4X66J 1RE1B 2XWYA 1VBKA 1KC8T 3R1HA 3DI6B 1WUUA 3R9LA 2CPFA 1FRKA 2U1AA 2LXIA 4CM2A 2HHWA 5G0RA 2C22A 3CCSS 2DGXA 4NA3A 4HI1A 3H5UA 2CJXB 3OW2R 4FVCA 5F8GA 1N5YB 2X1GA 2RRAA 2VOOA 1FCAA 4KO0A 1SB6A 3GP9A 4DL5A 2UXCF 3A13A 4LFAJ 5LT5A 1UVMA 4NXNJ 4QR1A 4RNMA 4DQPA 2GVZA 3PJ9A 2J6TA 3KHHA 3GJQB 2RILA 1QUPA 1S9EB 2ATCB 1U0HB 5HN0A 4ZPTR 3MXHP 4OX8A 1S0NA 2NZCA 2E5JA 1WC6A 3BH6B 5K5MA 3QT5A 2ZJRQ 5HROA 5D6GA 2M52A 4LBIA 2XNQA 4DOZA 4DUYF 1EX8A 3US5A 3G82A 2UU9J 1KD1T 2CWKA 1IN0A 4PWDB 3TUZC 1F5AA 4AL6A 1HFEL 4LF8F 4USJC 2KI2A 2QMXA 4CCHA 3GWCA 3H0PA 1YRTA 1X4GA 2RQ4A 4USKA 4DHVA 4UW2A 2GA7A 3CMES 3PRBA 4LFCF 1RYRA 4ZIWA 1RT1A 2D3OR 2HS3A 4LRFA 1QAYA 2L9WA 2Y3YA 3TA2A 5D3GA 4ZP9A 2Y1JA 2GVDB 1YX2A 4DSJA 4RW8B 2NCKL 4F4WA 1QDUB 2F9JA 2B4VA 1DZ5A 1SUQA 1HNVA 1MROA 2WB1D 4C11A 2EC0A 2H9ZA 1HPZA 4ZMMA 3VAHA 2V2ZA 3NY0A 4I68A 5J1NA 3WHIA 1KLMB 5F9LA 2BX6A 4NA1A 1C2PA 2L41A 4WXOA 2OMLA 3NBPA 2VH7A 3GYGA 3RBEA 2FVPA 3EGZA 2KXFA 1S6PA 1TKTB 2NYHA 3MWBA 5KG3A 2E1MC 3R7NB 2I38A 4F4XA 4NYPA 2H48B 3I9ZA 3DGPB 4HEA9 2GIFA 3IWNC 2JDJA 1YBUA 2OIHA 3AA9A 1I94F 3SCJE 3RTVA 2RSQA 4RW4A 3GE9A 3TZXA 4ZPWR 2ZWOA 2HVEA 3GONA 5AXMA 2VJVA 4J9NA 3HVWA 1T94A 1WG4A 5KG2A 1I51B 3R27A 1S1VB 1S57A 4ILMA 1M5OC 2BKNA 2VFTA 4L72B 4DV0J 1S1UB 3EPIA 1WC4A 1FKOB 2HAIA 4J9VA 4GRSA 2N4DA 4USTA 2AEFA 3FSYA 3FQKA 5F8HA 2BJ9A 1SBRA 3HHEA 3H90A 1WHYA 1M0SA 1YJTA 3JQJA 1HQEB 1DY3A 3GG0A 4L3NA 3RR8A 4TLRA 1D3WA 2CFXA 1N5YA 1SVDA 3C46A 4F2RA 3I6PA 5AE2A 3OSNA 3OL7A 1JLBB 3LF0A 1R8BA 1N56A 5B0GA 2RB7A 1JLAB 2VL1A 3SBMA 1HR0F 1VK3A 1O8BA 4JV1A 1SH0A 4ED1A 1AFIA 2R7RA 4LVNP 3CCRS 2R2RA 1S9EA 1H38A 4ZPCA 4UT4A 4WK1A 1U0HA 1WF0A 2ZHAA 2K7KA 4QCLA 1BMQB 5B0DA 2CZVC 3IO1A 4FZVA 1V9OA 3U7JA 4OYMA 1HNXF 1VQPS 2CADA 4PWDA 3FK4A 1PCAA 1FXRA 1RBAA 3I0RB 4IRCA 4B08A 4K7QA 5FDLB 2C2ZB 2EG1A 2MY8A 2WVEA 2IM0A 1BC6A 5CYJA 2V8GA 5DO2A 2BBEA 2WTFA 4MMOA 1X4BA 2CPJA 1K47A 2EFNA 4HT5A 4PQAA 1MMNA 3U1LA 3P4UB 2YPZA 2GVDA 4GVBB 1EQ0A 3LTOA 4C7QA 4RW8A 3MEDB 3IAS9 1Y11A 4O0IA 4OZ5A 2VQEJ 5DS7A 2FHKA 2B7CB 3J7Z5 1DHMA 2G1HA 3KG4A 3QGIA 3Q8RB 4YDXA 1AFJA 2CIMA 1B4SA 2E5GA 3KHLA 3AD8C 3S1TA 1FXDA 2XO7A 1URNA 1KLMA 1NO8A 4WK3A 2VV5A 2XHWA 5KTQA 4U8YA 1O51A 2DEIA 1DBDA 3BF4A 3MCNA 3VWSA 2DY1A 2MPUA 1IBKJ 4USHA 1TKTA 4JOUA 3L9ZA 4TVAB 5HSPA 3SCKE 4LF9F 4O4RA 3HVTB 2GX8A 3DGPA 4R25A 1Y5LB 1FE4A 5ETOA 4I2PB 4NOHA 4PZVA 5HMYA 3PX4A 4H4KC 2YX1A 3BGFA 3MM7B 5KT6A 2LVWA 1UL3A 3HFVA 3U1MA 2W2QP 3HXMA 4A47A 2DNNA 4CNZA 1NDPA 2NYIA 5LM7E 2DD8S 1YRUA 3K2YA 4K0KF 4PPZA 2M0GB 2BANB 4NLXA 4DU7A 1S1VA 3BO4A 2KRRA 2AHOB 2E9TA 4H4KA 1S1UA 4C6AA 2QG9B 4G3IA 1FKOA 2EWHA 5IV3A 1PG5B 2E44A 3M32A 3O5TB 3D66A 3GR0A 4A8XA 2J76E 2XMTA 1H2UX 4OX6A 1HQEA 1TV6B 2R8HA 2MGZB 2C2EA 2YPYA 3BH7B 4DR1F 1RQ0A 1M1HA 4HHHA 1U2FA 4N47A 4ECZA 3KJVB 4XDDA 2O66A 5BYQA 1JLBA 2ZBPA 3PJWA 3EZUA 1JLAA 1T02A 2JL9A 3OHAA 2W01A 3TAMB 1YJ7A 1HQ2A 5DETA 2FHMA 1FERA 4KKOB 2GAGC 3DM2B 3OTOF 4DQQA 1N0UA 3LANA 1Z4UA 1WKLA 1KQFB 3EDQB 2PGCA 3MR6A 2IY5B 3H42A 1IR1A 3VAFA 1JLGB 3K89A 4TYAA 1Q8BA 3HJVA 5GAEI 4AFFA 1QY7A 4DR5J 4BHQA 4XPEA 1UZDA 4ILRA 4DX5A 3V5RA 1RABB 1RKIA 2HGMA 4ZS6A 2W7PA 2DO0A 5KFZA 3DN9A 4DBQA 5FDLA 2JH3A 4ELUA 1X4AA 2V5HG 5ETVA 5HL7Q 5DQIA 4ZVEA 5K8NA 3Q22A 2LYVA 2J0SD 1EAYC 3OTDA 3CO0P 1VQLS 3HSJA 3HO1A 3IR6B 5B7WA 2OEJA 4QYZJ 4UTGA 2LP4A 4ZLNA 3J7A1 3MEDA 2GHWA 5C2CA 2OEKA 2LDIA 4HR2A 3PYFA 2RDIA 4F7VA 1WHVA 5I3QA 2WK4A 5A8WB 1YIJS 4DQIA 5CABA 2OPQB 2PFFB 1KQKA 3Q8SB 3DLBA 4L74A 4ZP8A 4A8OA 3OTCA 5E2QA 2M8HA 4OYZA 4E98A 2FJDB 3PHTA 4J9SA 3ENVA 4YY3F 3RRHA 4FN5A 5A76A 2KXNB 4GKJJ 3UR3C 1JK9B 5E7OB 4JBCA 3I9V9 2XGQA 3CJ2A 4D3HA 3MR3A 2IC3B 4YR0A 3DOKA 1NEEA 3EXYA 2AWZA 2WZ1A 3HVTA 3CT9A 3DLKB 2KT2A 4F0KA 2GCFA 2VG7B 3TZWA 2XEXA 2DPJA 3W3SA 2VC0A 2NSBA 4I2PA 2KO1A 4QYZK 1X9SA 3QRRA 4LFBJ 3MM7A 4M8LA 3G6VA 3OVAA 1NZAA 4OJ3A 2MSTA 2F9DA 5IC6B 1DTTA 4U6PA 2N7YA 3V6KA 3EM1A 1RHMB 4UZBA 2BANA 2ADBA 1X0PA 1BUXA 4Y00A 1U2RA 1T9XA 4F4AA 3CD0A 4LSNB 3AB4B 2OJ3A 4WFXA 1QD1A 4PRFA 4Y2AA 1Y5IB 2CZ9A 2KL8A 5D4NA 2WVCA 5IS2A 2DHHA 3Q8YA 5A8RA 3AD9C 1OQ3A 3M2RB 2I5JB 1HD1A 2ZNYA 2JX2A 3K5PA 4EFAC 2EVZA 2CPHA 1G6BA 2I1RA 1TV6A 3V6DB 1ZM2A 2MGZA 1JX4A 4O3RA 2YNGB 3KJVA 1EQMA 1ZBTA 1DTQB 2VIHA 2ZOFA 4PCQA 4TU9A 4MKVA 3TAMA 4FVMA 4QOTA 5HLFB 1L3TA 4JI4F 3DM2A 3TUIC 4O3NA 4OZNA 5D0RA 1XC9A 2QFJA 3MCSA 3R6GB 1X0FA 6FDRA 4K4YA 5GMDA 1IKYB 3DDKA 2DNRA 5KG1A 1D8ZA 2AYGA 2VJUA 3QSIA 4X4QA 2KH9A 2ASJA 5L46A 1WACA 1JLGA 5KFPA 3TANA 2IVFB 1WSVA 3D4JA 4K5SA 4R0JA 3EPGA 5BYSA 2E5IA 2KHDA 2CQGA 2K06A 2G0JA 4FBUA 4PYAA 4L3KA 1WOPA 1UVJA 1Q1KA 1QUVA 2GFFA 4O3PA 2CKWA 4PUOB 3GFZA 3DLGB 2ASDA 1U1LA 2IDLA 1EP4B 4LF6F 3M8SA 2QMUB 3P5TL 2DITA 1D9FA 5E33A 3RB4A 3EICA 2C2KB 3ELHA 1GMWD 1BWEA 4ZVFA 2GJ2A 1PKUA 3T1HF 3TEGA 2M2BA 4OI6A 5KT7A 2NUUG 1EKRA 1TK8A 2OTLS 2B7BB 2LQ5A 2ZD1B 2OELA 1UVIA 3PKYA 3CEDA 3ISZA 2XQCA 4KIAA 2E7XA 1C1CB 3NKYA 4OZ2A 1I6JA 2HHSA 3VVTA 1IQZA 1HBUB 2JLEA 1ZA2B 2LXFA 7FDRA 1KVJA 2Y1RI 1VLOA 2OPQA 5LMUJ 2NPFA 1FFSB 4OHVA 3JTNA 3OQ2A 2YNIB 4DL4A 1PBAA 2R7QA 2ZBRA 4CLWA 4DV1J 1KONA 2N3LA 2QTWA 3R5GA 1S9FA 1WG1A 4I64A 3JTPA 2IBKA 1U0SA 1BHNA 1H6KX 2IC3A 3TYTA 1NHVA 2M7SA 3NNCA 2BQRA 1RBOB 1RHKB 3DLKA 2LQ8A 3H2LA 2FC8A 4YHHF 2UUCJ 2BE7D 2ZFHA 4NMXA 3FSIA 1O6XA 4Q2MA 2MY7A 3BR9A 2OTJS 1M1KT 4P52A 3QT8A 3R5DA 1FD2A 4RWXA 2DR5A 2H5EA 1P9YA 1YK9A 4CRJA 3FBBA 4LSNA 4CDIA 4LR9A 3D0HE 1KEKA 1AB8A 1T03B 1IBMJ 1F60B 3BJYA 1KP6A 4AYBD 3M2RA 4PYDA 2I5JA 4NL5A 5CQGA 5CAAA 1IBCB 3K5MA 3M8ZA 2AGPA 4OI0A 4P72A 5C42B 3QGPA 1MMLA 3V6DA 3NWGA 2H65B 4J9QA 4NLPA 2QA1A 4TY9A 1M5VC 2DT9A 1FVSA 2VOPA 4IOBA 2ATLA 5DGAA 1DTQA 4BS2A 5HJYA 3C66A 3K5LA 3W8PA 1Y4ZB 2ZH1A 5HLFA 5FLXY 4K59A 3DXBA 3M2UB 4CYUB 5L8RC 2DHSA 2OI2A 1RZMA 3PFEA 4CH0S 2FVCA 3M4XA 2C3MA 2VKRA 1IKYA 1QE1B 1NUEA 4NLOA 4CLSA 2YNFA 5D8HB 4OZ1A 3DU6A 4WP3A 3D6HB 3V6HA 3BDEA 3M8PB 5I42B 2J0QD 3H8YA 3OL6A 2H54B 2V8HA 1YJ9S 4GKKF 1Q81T 1X4HA 1KOHA 1ZZFA 4PG8A 4C98A 5KG5A 4PUOA 3DLGA 3PRDA 2BMBA 1EP4A 3KXDA 4IR9A 4B3TF 4KPYA 4JI2F 5H9FK 1RT2B 1ROFA 6FD1A 3A3PB 4IDKB 3THPA 3GV5B 3DLLQ
chains in the Genus database with same CATH topology
3TVYA 1S6QB 1ZETA 4QU7A 5GAHI 2B9YA 4NCBA 3KWMA 1LWFB 3U02A 1IBKF 5F3ZA 1RAJA 2MKSA 2Z8QA 3Q8QB 3HDSA 3DRSB 2WOMA 5BYRA 2LECA 1UJ6A 1VOMA 1T05A 4ID8A 1F2GA 2B51A 2YX7A 1SJ3P 3FEZA 1YSJA 4IRDA 3HKWA 2ZD1A 4DL0C 2Y1IA 4P7TA 5CYQB 3R5AA 3M8RA 4KE5A 5K14A 1S0OA 1HNZF 4ZPBA 5M2RA 2HW3A 2ZBIA 4O4GB 2ZC3A 4UY85 4Q44A 3MEEA 2MQMA 1VBZA 2ZZMA 1IKXA 3DRXA 2AYMA 4ED0A 2CQCA 3BQ0A 1IBLF 4WTYA 1P27B 1C1CA 4ES2A 4QWDA 5KT5A 3PW2A 1MSWD 2YKNA 2IA0A 2CG4A 4N8NA 3E3XA 3KLEB 4JUZA 3OLBA 3LGNA 5KFTA 1UVNA 1H0HB 1W2IA 2YY3A 3SMZA 3KMQA 4AL5A 1HBUA 2G13A 2KZZA 3QIPB 2IVYA 3QJLA 4ZHRB 1XR6A 4DMZA 4OIXA 1R3NA 2HWIA 4HDGA 5F8IA 3LP1A 3OJUA 2FLNA 2VPXB 4IKAA 2P9EA 2O5DA 5T7LA 3GIIA 1RT3B 3HFKA 1LK7A 2VG5B 3JYTA 4GMKA 5L1LA 4DV2F 2LU2A 4WFNQ 1JLCA 1LWCA 3UD3P 4X84A 1Q86T 5KFYA 5B0CA 4M63A 4ED7A 1VMBA 2YNIA 5KFJA 1RT6A 3IN5A 1FA0A 3T6JA 1YI2S 2XLJA 4HVZA 3OXFA 4ZCKA 3UCZP 5KFFA 4FNIA 3KNAA 5IFMA 2ILYA 1TL3A 4OHWA 5J2PB 2YNHA 4RNHA 1X7VA 3RAMA 2QMWA 1TFYA 2CQ4A 4FXDA 1HQUB 3RBDA 1NKCA 2FIUA 5KFXA 2PT0A 4RUHA 3QAEA 1LWEB 4I1TA 3KTQA 2EFGA 1HARA 3QIDA 2A1BA 2L3MA 3MECA 1PC5A 1K0VA 1P9QC 2V9WA 3KOAA 1XERA 1JLQA 4IG0A 1X9WA 1UA1A 4XIUA 1LW2A 4TLQA 4EO8A 3C8YA 4K4UA 4ATNA 3BSNA 3OXLA 5C24B 4MFBB 3GFYA 3FZ2A 1TKDA 2UUCF 4FF3A 2LXUA 3M6VA 1D8YA 4WFAQ 5DJBA 2W24A 4KO0B 2KJVA 4CZCA 1UAWA 2WB4A 4K4SA 1KHVA 1TR0A 1HYSA 1VQYA 1HHTP 2HNYB 3AH6A 3K59A 1H2TZ 2VPYB 3J81Y 3DI6A 1ZOTA 2CQHA 4TN2A 1FKPA 1HMVB 1WI8A 2XCPA 3RW6A 3T5LA 1XWLA 3OSPA 5LSRA 4N76A 2F8MA 3H2UB 5M2UA 1VQ9S 1DJ0A 2BXJA 3GR1A 3H4DA 4DV6F 1K73T 1D9AA 2RRNA 4RLEA 2DGVA 4QYRA 4NYOA 3TR5A 3K58A 5A2QY 2YKPA 3N5BA 4EWTA 4XPCA 3CCLS 1S1WA 3IFEA 1SJ4P 1UFLA 4WYLA 4ELTA 2FB0A 1RTDA 3KFWX 5CZVA 4DF8A 1SH2A 1TKXB 4JV0A 4JI8F 2D9OA 4YP3A 1XBWA 4KTQA 3VAMA 2YTCA 4WF9Q 1UETA 3U27A 2RQMA 3RU0A 1N52B 3N6LA 2JRSA 1DRZA 4OFZA 4B9NA 3CJKB 1QAIA 3K5NA 3ZZYA 2V0NA 4U67Q 3PV8A 4QBUA 3BR8A 1RT5A 5BR8F 1ZZNA 2GMLA 1DQAA 1CQMA 2HRYA 1FNXH 3ZZOA 5HROB 4Y2KA 4B3SF 2HFOA 1SV5A 3IRXA 1MWYA 2JFKA 4OJHA 1NK5A 3I5BA 4Q8FA 4I67A 4NRUA 2QA4G 3ISND 1S1TA 3P96A 1WNEA 5EWFA 1OS5A 2ZE2B 1GX5A 3MPYA 3QZ7A 1HHSA 3FEXB 2CVIA 5KG7A 3PIOQ 5HP1A 2DK2A 3ZC4A 1M5KC 4ED3A 1T03A 4F02A 5DM6Q 2JEGA 4DSIA 3OV7A 2C2RA 1OPZA 1Q82T 3AA8A 2FVSA 4U7CA 1WEZA 3M1VB 2W4CA 1HNIA 2W4DA 1D0EA 4OI4A 4YEAA 2KYXA 2P5VA 2YWFA 4MKBA 2MJUA 4PPDA 5AJ3F 4F4ZA 5J2NA 4I2QA 4KGMA 3K0JA 4IOCQ 3I32A 3OFEA 2FLPA 4ICLA 2EI5A 3LW5C 3HHNB 4ERDA 2D7SA 5DDPC 1A6LA 1WF2A 2DCUB 2IM3A 2QT7A 1NRKA 3G71S 4KB7A 3B82A 1HA1A 1U1NA 4FF1A 2HS4A 1Q4RA 2XC9A 2J7WA 3P6YC 1S0VA 4GC7A 2Q3PA 5C42A 4R8UB 2LQBA 2K1RA 3VQSA 1I1GA 4IQMA 2OMOA 1UVLA 4DDFA 1TKZB 2WRMA 1IXKA 2FJEB 1VQKS 3GFXA 4ZLPA 3CJ4A 2YVSA 2F7VA 3LWMA 1R8AA 1OO0B 4C9DA 1HBNA 3MM9A 3MPVA 2IRUA 1HWKA 4ZCMA 1RT1B 2YNFB 2N3OA 2IJFA 2W9BB 2VZ9A 3V4MA 4DR5F 1X8DA 2WW8A 2ZDPA 2UVWA 3N9UC 3QZ8A 3SZ2A 1A7GE 5GAHU 5EWEA 2A2DA 3M6WA 3D28A 2KB2A 4EYHB 3EUNA 1ZTTA 3QWUA 1NK7A 2ZM6F 2VQFF 2B0GA 4P6QA 3KLFB 5D3GB 5CYMB 3AAWB 2GIQA 1B0PA 1IM4A 1T95A 3MM8B 5IZHA 4X4SA 2DNKA 5B0EA 3G6ES 5SZTA 3F41A 5HBMA 5DRKA 2AV5A 5LL6d 3PO4A 3G86A 4WFZA 3C6TA 4KV8B 2AJ4A 2L9NA 4QWAA 3KHGA 4DL6A 1CQNA 4RNNA 1VC0A 2VA2A 2B9WA 2RF2B 2DNGA 1QAXA 3M2UA 2VODA 1OPIA 3PR4A 3PACA 1SUQB 1N5SA 1HNVB 3NGKA 3DLHA 2R7TA 1IUJA 1NKEA 3CDBA 1MROB 3W2WB 1UW4A 4WFBQ 2MKKA 1NJYA 2A3JA 4USIA 1N6QB 2CPXA 2ZOGA 4CT8A 1QE1A 3G6XA 4CQ1A 3I96A 4DN0A 1HPZB 1TFWA 3W2VA 1RTHA 2HHPA 4Y3CA 4NLVA 3IGNA 4RW6B 1FXLA 1JJ2R 1GXUA 1MNEA 2D74B 2BV3A 3DMJA 3KK2B 2K7JA 1Y00A 2DGWA 2Z0GA 4IG3B 3HVRA 2WONA 3M8PA 3TA1A 4HH0A 5I42A 2IMOA 2RUGA 4NA2A 4Q43A 2M8DB 4TYBA 3O3LA 4MJKA 3NBPB 1WTFA 5L38A 2RMLA 1VI7A 5KG0A 1C0TB 4ITSA 3MR2A 1R7IA 2CJKA 4AUKA 4QIVA 1TVRB 4OHYA 2BQUA 2DNLA 2XBPA 1UP1A 1YJVA 5KFNA 5KG4A 3NAIA 3UFCX 4ECXA 5BJRA 3TVZA 1T05B 4A8MP 1JXLA 1XMQF 2JZ5A 3SQGB 4X62F 2J0XA 2KJWA 2MQQA 4C3LA 1UWBA 3PNIA 2VFUA 3M05A 4BWJA 1VQ6S 2PSZA 4OX9F 2MYFA 3HF5A 2DHXA 3CXCR 3FQLA 3GIJA 5GADI 5I4MA 1IKXB 2RVJA 2WSFC 3BN7A 2J5AA 4J9RA 3HJFA 1WF1A 2ZUGA 2HNDA 4NLTA 2KFYA 1RT2A 2MZJA 4FXVA 4K5RA 3PIPQ 4HH1A 2BABA 2KT5A 3X3UA 3CVKA 3G8QA 1RDRA 4U7UK 4PXEA 2RU3A 3SSSA 1KN6A 1YJRA 2XY5A 3K5OA 2ZVSA 4IDKA 4ECVA 4NLQA 4RW4B 1QM9A 1K0TA 2WBMA 3SDEA 1VLYA 5KFVA 2FGOA 1S6QA 3H2VE 3MM5B 3TUJC 4HT7A 2EPIA 3FRZA 4Q8EA 1LWFA 5GMKa 4GKJF 4BCAA 1KTVA 5KFCA 1VQ8S 3DRSA 4PQUB 5C5JA 4X2BA 1RJJA 2AJ0A 1Q16B 1Y9OA 1U8SA 2MZRA 4AXIA 3VZHA 3CUNA 2HQ3A 3OTEA 1F9FA 3IBWA 4FS1A 1IKWB 1LW0B 2RD5C 2XMKA 4ETXA 4OLPA 4G1QB 5CYQA 1KNZA 1TL1B 4XAKA 1ZM9A 4O4GA 5DDQC 1GAOA 1XTZA 1U1OA 4IYQA 2DIVA 2VKZG 1FESA 2ZC4A 2ZH4A 3RRGA 1YGYA 2HFZA 2QLWA 4UUWA 5J2QB 4PG5A 1AROP 3EZ5A 1SJFA 3KNGA 2AX0A 5HMZA 1Y7PA 3KLEA 4M1KA 1FRXA 3T5HA 1QVFR 2EFQA 3M30B 3MURP 4OHXA 3QIPA 3H5SA 1QSSA 4RBTA 2HGL