2MY8A

Nmr structure of rrm-3 domain of etr-3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
97
structure length
97
Chain Sequence
b'GSHMQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CUGBP Elav-like family member 2
publication title NMR Structure of RRM-3 domain of ETR-3
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 7
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2my8A01
4V19X 1VQ8S 2N7CA 2OIHA 4IUFA 2DGWA 1X4AA 2CQDA 2HGNA 1WWHA 2KXHA 1X4DA 3UCUP 3CC4S 1X4CA 3NNCA 4WF9Q 2LXUA 1FNXH 2LEAA 2KXNB 3Q2SC 1IQTA 4UQTA 3BS9A 5ITHA 1ZH5A 2ZJQQ 2RUGA 3H2UB 4Y00A 5LJ3Y 2MZQA 2LECA 3SXLA 2KG1A 2MXYA 2DK2A 1X4EA 2CQ4A 2ERRA 2FC8A 2J76E 2DNNA 3HI9A 1VC5A 1WF1A 2E5IA 4P6QA 4PKDB 3SMZA 1ZZNA 2XS5A 2AYEA 5IQQA 1DZ5A 3CCRS 2YWKA 2DNHA 3IRWP 3THTA 5JVHQ 3VALA 2DIVA 3G9CA 4CQ1A 4OZ0A 2A3JA 2M8DB 1A9NB 3G71S 4ERDA 4W90B 3CCSS 2LXIA 3MI7X 1CVJA 1ZZFA 1R8HA 5LJ5Y 3I55S 5CXTA 2DO0A 4YB1P 5BJRA 2KVIA 2LA6A 1W2BR 1N52B 2MHNA 3VAGA 1UAWA 2MSTA 1X5PA 2FHOB 2LMIA 1WG1A 2MQLA 2DH9A 1U1RA 4QQBA 2DNOA 4J5OA 4A8XA 2KM8C 1NO8A 1S79A 2OSQA 5DETA 3HHNB 2CPHA 4CH0S 2DGXA 2J8AA 2DH8A 1N88A 3RW7A 3D2WA 2DNMA 3R1HA 2EK6A 1YTYA 2M0GB 2MGZB 2MZTA 2MKIA 2V94A 2M2BA 1M5OC 3MXHP 3P5TL 4TLQA 2RS2A 3S6EA 2LQ5A 2AD9A 1VQLS 1G2EA 3TP2A 3JB9k 2CQHA 3CCQS 5LXRA 5GVQA 5CYJA 3J7ZT 3THPA 5JVGQ 3UD4P 4YUDA 2CPZA 2MZJA 2CQGA 4LMZA 2MJUA 5IFMA 2DH7A 1VQ6S 1NU4A 1JJHA 2K3KA 2MY8A 3CXCR 3VAHA 3VAKA 2YH1A 2MGZA 3R1LA 3TYTA 5IM0B 2CPFA 2RS8A 1X4BA 1XN9A 4UY8T 1FXLA 2N3LA 1OPIA 2CPIA 3MUMP 2FC9A 4C0OC 1X4GA 5D77A 3UCZP 3L3CA 3VAFA 2L41A 1Q82T 3UCGA 2HGMA 1VQNS 2CQCA 2DNPA 2JWNA 1YI2S 2DGUA 1PO6A 1WI6A 2MJNA 1QVFR 2BZ2A 4IO9Q 1U1NA 1OO0B 2RVJA 1OIAA 2AYMA 3NS5A 3RW6A 1VBZA 3DLLQ 1NJIT 1X5TA 5IM0A 2D3OR 3G8SA 1B7FA 3UE2A 5DDRC 2DGOA 1WI8A 4U67Q 2CPEA 2DO4A 2YKAA 1WHWA 2XNRA 1DHMA 3ZZYA 2X1BA 2M70A 3R27A 5GAGU 3EX7B 1WHVA 5CA5A 4PR6A 3MUTP 2DHXA 3VAIA 3BEGB 1Q86T 1HL6A 3CF5Q 4QPTA 4W92B 2XS2A 1U1KA 2JVOA 2MKSA 2U2FA 2LA4A 2M7SA 3G4SS 4IOAQ 1WHYA 3NNAA 1X4HA 1VQ7S 2E5HA 1FT8A 1JMTA 2DGTA 2WBRA 3VF0B 2VOOA 1QVGR 4C7QA 2KI2A 1U1PA 5GAEU 2HYIB 2JVRA 2DNQA 4YOEA 1UP1A 1SJQA 2RNEA 2K8GA 2KYXA 2N82B 1M5PC 1WG5A 3UWTA 3I56S 2M8HA 5HL7Q 2RT3A 2MQQA 1N54B 2MB0B 5GAHU 1HD0A 3NMRA 2L9WA 2KXFA 3CCVS 5DM7Q 1YJWS 2CQ3A 1FJ7A 5LXYA 1K9MT 2I38A 5FJ4A 3Q2TC 3EGZA 1YJ9S 1WHXA 1L3KA 2M52A 1X5OA 1URNA 1YITS 2KT5A 2EK1A 4BS2A 3CULA 2CPJA 3IWNC 1KC8T 2CQ2A 3FEYB 1A7GE 2DNRA 3P3DA 2DNGA 3PIPQ 3K0JA 2NZ4A 3S8SA 1WEZA 2E5JA 3VAJA 3CMAS 3ULHA 3MURP 1VQ4S 1HD1A 1D9AA 4ED5A 2M9KA 1WG4A 2MZRA 1VBYA 2KG0A 3MDFA 2CQ1A 3CTRA 1WF2A 3S7RA 3G96A 4FXWA 3CPWR 2DNZA 1U1MA 1H2VZ 2MQOA 3G8TA 5H1SV 1DBDA 3NNHA 1KD1T 4TU7A 1U1QA 2HZCA 4LJMA 2F9DA 1F9FA 1VQOS 2F3JA 5EN1A 4WCEQ 2KM8B 4WIIA 2CQ0A 2LEBA 2MZSA 2LCWA 2DNKA 2DHAA 1VQKS 4F25A 2M88A 4TU8A 3J7YU 2DNLA 2VOPA 2KHCA 5HO4A 1M1KT 2YTCA 3UD3P 2AYBA 2D9PA 1AUDA 4IOCQ 2HVZA 1SJ3P 1OWXA 2X1AA 1M5KC 2EVZA 2QFJA 2YH0A 5DDOC 2KRBA 1X5SA 2I2YA 1U6FA 2ADBA 2RU3A 4C4WA 1H6KX 2E5GA 2SXLA 2OTLS 1K8AT 2KU7A 1M90T 2CPYA 2JX2A 4ZKAA 2DIUA 2AYGA 2PE8A 2UP1A 2MY7A 4WKRA 3VAMA 3LPYA 2CQPA 4QU6A 3N9UC 3CC7S 1SJRA 2MKKA 2Q79A 3ZZZA 4CH1A 2MYFA 3LQVA 2L08A 3P49B 5MLCV 5DM6Q 3EGNA 2D9OA 1U2FA 2CPXA 3B4DA 2MPUA 1M5VC 1WTBA 1FJEB 3MD1A 2QEXS 2CJKA 2E44A 2XB2D 2CPDA 1WELA 1BY9A 1JJ4A 2J0SD 2GHPA 2RRBA 3CCMS 1YIJS 2N3OA 2MZ1A 2KRRA 2MKHA 2MQPA 1X0FA 1U1LA 2DGQA 4F26A 2G1DA 1RKJA 2KN4A 2DHSA 3S01A 2OJ3A 3BO3A 2B0GA 2MKCA 4Y0FA 3MOJB 3B4MA 1S72S 1H2UX 1KQSR 2DNYA 2JRSA 1UW4A 3CMES 2DITA 3SDEB 3CUNA 1VQ5S 2HGLA 4QU7A 2RQ4A 1UFWA 3US5A 2DB1A 2FY1A 1D8ZA 2XS7A 3CCJS 2X1GA 1DRZA 2DISA 2J0QD 1JJ2R 4FXVA 3DXBA 1WEXA 3BO2A 3TO8A 1FO1A 3OW2R 2CQIA 2MQNA 1KOOA 1VC0A 1VC6A 3U1MA 1YHQS 4WFAQ 5LSLA 1U1OA 2DGVA 5GMKa 2FPHX 1SJ4P 1VBXA 3P6YC 4Z2XA 2KH9A 1WF0A 2LKZA 2OTJS 2KFYA 4OZ1A 1H2TZ 1RK8A 1PGZA 4CIOA 4F02A 3BO4A 1P1TA 3SDEA 2ADCA 3NS6A 2G0CA 1QM9A 1K73T 2XNQA 4TU9A 3PIOQ 2MMYA 1Q81T 2DGSA 3U1LA 3H2VE 4WFNQ 1VQMS 1VQ9S 2G4BA 1HA1A 1O0PA 1YWXA 2ZJRQ 3G6ES 2CQBA 3CD6S 5LSOA 3MD3A 5GADU 1U6BA 2NLWA 2O3DA 3FEXB 3CCES 1P27B 2LYVA 4WFBQ 2QA4S 4RU2A 4PRFA 3V4MA 2RQCA 1KOHA 5DDQC 4LIRA 1Q7YT 5D78A 1YJNS 3CC2S 1FHTA 3MUVP 2VONA 2RRAA 2X1FA 2GO9A 4M5DB 2MSSA 2U1AA 2PEHA 1FJCA 1VQPS 1WEYA 2XSFA 2ZJPQ 3CCUS 1R8PA 2MKJA 2BOPA 2VODA 2M4MA 2MQMA 1X4FA 2DHGA 1SXLA 5DDPC 4EGLA 1N8RT 2F9JA 2OSRA 3CCLS 1SJFA
chains in the Genus database with same CATH superfamily
3PO5A 1FDDA 3IS9B 1YBAA 3MMBA 2FJXA 3CC4S 4OV6A 3MPYA 4YDXA 1P8GA 3PJ9A 3QAUA 4DV7J 4OQJA 3FBFA 2Y0SD 4DR4F 3OHBA 1QAYA 4X4RA 4MFBB 4AE5A 2CZ4A 3CCRS 4OX7A 3FGVA 5C2CA 2LXIA 5LJ5Y 4JI0J 4QWDA 2MHNA 3UN5A 3SV4A 2LEPA 2DNOA 3QJLA 3PW7A 5K5MA 4CH7A 2XO6A 1UEKA 4N7TA 3C46A 2E1RA 2CPHA 4G65A 2E1CA 3GLJA 3J81j 1P6TA 3IR7B 4PG4A 4UOHA 3BDEA 1BHNA 2E7WA 4WE1A 1NKEA 5IT0A 3KLHB 2KT2A 3MCSA 3RRHA 2HZAA 3O1LA 1H73A 2BUNA 2DXDA 2UVWA 3BGRA 4IFYB 2MZJA 1DY3A 2PFFB 1EZZB 4DPWA 1SQFA 3M7VA 4I6YA 3R1LA 4DR2J 2OMLA 2RS8A 3TW0A 1Y3KA 4ZHRA 2CPIA 3D6HB 3GMGA 1VQNS 2CG8A 2GMJA 1RWMB 1RISA 1OYDA 3NCQA 1ZPVA 2NXUA 3DLLQ 1FX4A 3T5HA 2YKPA 2X51A 2OP5A 4ANCA 5K14A 4YY3F 4NA3A 2GHVC 4LF1A 2W8LA 1A6LA 1Y11A 1LK7A 3DKDA 3M9OB 2ALZA 2V9KA 2VQFF 4LF9J 1LXJA 4I2QA 3BSAA 2GJFA 1P9YA 1TKXA 2VB6A 3GQCA 3TAPA 2QA2A 3HJVA 5IWAF 3RBXA 2P9GA 4DUZF 2DNQA 1C0TB 4DPOA 3B82A 3CE8A 4U95A 4DSFA 2RT3A 1NJYA 2FHMA 1N5YA 2HNYB 3AD8C 5FJ4A 3NGKA 4N47A 4OYBA 1VHIA 1AB8A 2EEYA 2IYGA 3CJ3A 2AW0A 2IA6A 1PSDA 2DNGA 3PM9A 2E5JA 4Q2LA 4DPTA 3IRXB 1ZETA 2BQRA 3WQPA 3U1NA 3GTYX 1RT4A 1H2VZ 4JI0F 4WP3A 3JYTB 4TU7A 3P8BB 3D7SB 2MZSA 3V4IB 4CTAA 4NASA 1T3NA 2PMHA 3D9BA 2IDLA 1MU2A 2OPPA 5DQGA 1OWXA 4N8NA 2ZBRA 2YH0A 1RTIA 4QR0A 1LFWA 2J6SA 3D4JA 4C4WA 1KHWA 1PYOB 3LP1B 3OTBA 2EFOA 3PFOA 4O44B 2QLWA 1RP5A 2COLA 2JLGA 4K4VA 3HULA 1UCNA 4DR2F 2LU2A 1SQEA 2CPDA 3GSDA 3SQGB 1GTEA 5MAOA 4DPUA 4U7CA 4TYBA 3OT9A 1S6QB 4ZVOB 2DHSA 3A3PB 3AJ1A 3O2IA 1Y5NB 4MIWA 3C16A 3GV5B 4RNNA 4LF9F 4Y2IA 3OW2R 4MIAA 3U1MA 2P8IA 4DX8H 3QATA 4Y2AA 3UN3A 1WF0A 2QG9B 1V3RA 4ID5A 2J6UA 1F1BB 1HBNA 2GVZB 3OV7A 2XNQA 2GW8A 3U1LA 1AZSA 4DPYA 2VFTA 3DU6A 3K5OA 4ZIWA 2QIFA 3D67A 4CO0A 5KFDA 4AUKA 1U0HB 1UVKA 2RU9A 3UFCX 3G82B 2GJIA 5T7LB 5FLXY 3GCWP 3OUYA 2U1AA 3PW0A 1WEYA 3AOAA 3TNVA 2WCXA 2UVRA 1ZPWX 4BC7A 2VODA 4AXIA 1X4FA 4EGLA 2EBGA 3RBEA 2CNKB 5K8PA 3T1YJ 9ATCB 1B0TA 2AV5A 3F0NA 2LXUA 1FNXH 4CLUA 3A8KA 1IQTA 3I0RB 3E01A 4CM0A 2YNHA 3D1QA 2H3EB 1VC5A 4CNYA 2B6AB 3CIMA 3C15B 3AB4B 4LF8J 4QYZJ 2XLJA 1KHVA 3NWRA 1ZZFA 1F9EB 3MF5A 1D9DA 5BJRA 1ICEB 3HK2A 4G3IA 2MSTA 5A76A 3BB5A 1SUQA 3A8JA 2V63A 1C1BA 2G2ZA 2V8HA 4OZ2A 2AJ2A 1VRTB 2ZBCA 1NH7A 2UZAA 1RHUB 4EUVA 2I6WA 2ZNZA 3R1HA 2EK6A 3FRYA 5HLFA 1HQUA 1N33J 3M6UA 3H98A 1RTJA 3ETMA 3N4WA 3BSOA 1KTVA 1RYSA 2LQ5A 5I42A 1NRKA 2HRUA 3OFFA 1KKHA 4WXWA 3W9JA 4UOGA 2C2ZB 1O6XA 1VFJA 1VGYA 3FSIA 4URGA 1VQ6S 5HVFA 3PHTA 3MGJA 1HQEA 2V4JA 4ECWA 4I7FA 2PSZA 2J0XA 1Y7PA 3V81B 2DCLA 2NR0A 1OS5A 3QPIA 2HGMA 2XGPA 4WU3A 4K4UA 2BZ2A 2OEJA 3ZZTA 1SKWA 2AYMA 2HNZA 2XMJA 2XSJA 2OO4A 2Z2MA 1FDAA 2DGOA 4CLWA 2D41A 2ALYB 1WHVA 3HKWA 1T9VA 4ZVHA 1Q86T 1IBCB 4QPTA 3BDPA 3TZYA 2CNNB 5EWEA 1IKVA 1NKBA 4FBUA 2RD5C 4ELTA 3GV7B 1KDNA 1SV5B 2DGTA 3EDQB 1QVGR 1MSWD 4EFAC 3HHLD 2H48B 3J7A1 2RILA 4X66J 1F3FA 3ZZOA 4NYZA 1KLNA 2FHJD 2MB0B 2MLXA 3POTB 1CC7A 3EDRB 4USWA 2PC6A 3T1YF 2I38A 3EGZA 4D3HA 3OXLA 3R5DA 2DNRA 5LOQA 1WEZA 1HMVB 4X4UA 3MAAB 1JLBA 3LW5C 1UW9A 2M9KA 3VGTA 4F36A 5IS2A 3CDEA 3G96A 4ZA1A 3M8PB 4OIXA 1XR7A 3BGUA 4CDIA 3T9ZA 3EM1A 4LJMA 2EFNA 1TV6A 4WIIA 5HN0A 2LCWA 3RYLA 2EBEA 4LVOP 2JC1A 1VQKS 4TU8A 1RAGB 5ETRA 2WVBA 3QT6A 2PDAA 4WK1A 2UXDJ 2E9RX 4Y28C 4M5MA 1NAQA 2KRBA 3T5JA 4JI7J 1TVRB 5GMDA 3SSSA 2OPRB 3GONA 2HHWA 3V5RA 2J9CA 4O4GA 2IIHA 4ZITA 2ZD1A 4DU8A 2Q43A 4A8WA 2HBYB 1JLAA 4ZVTB 4DXLA 4UUXA 4F3QA 3DMJA 4PYDA 1RT3B 2MKYA 3V6HA 4C8YA 3PY8A 1QD1A 5BYQA 2XB2D 4CLFA 2QV6A 2ASJA 4JI2F 1F5AA 1U1LA 3T3FA 2RH3A 2F4FA 3WIVA 3HJFA 2FVCA 1RCXB 2KN4A 1UKUA 3MOJB 2RHSB 1BQMA 1S72S 1FK9A 2H4WB 3CMES 3RU0A 4B9TA 2HQDA 5FDLB 5D4LA 5F8JA 1D8ZA 3HPOA 4IG0B 2ZM6F 5B08A 1O8BA 3W7BA 3B78A 2V2KA 4YDDB 4NA1A 1R8BA 3R2DJ 2YKMA 1H7WA 1VBXA 1ZTWA 4ENOA 4ES2A 4C11B 2WRMA 1SI9A 3NS6A 2AX0A 2G1HA 2HQCA 3KLFA 3ENAA 3PIOQ 1Q0NA 4X66F 1O0PA 4QZVB 1U6BA 3SSQA 1D09B 2O3DA 1HWUA 3M8SA 3BF4A 3JTOA 5D78A 2LU1A 2ZZMA 2CNOB 2XMWA 2B7BB 2BW2A 2HHPA 1SC6A 1FJCA 2AHOB 1RBAA 3KLIA 1FRXA 2M4MA 1K47A 2CWKA 1SXLA 3MM5B 4Y34A 3HM9A 2W4DA 3HKZD 2EPIA 2CIMA 1WWHA 4KV8A 3OR2B 4M5GA 2F8HA 2WVDA 4B3SJ 4UQTA 5K8NA 4M63A 5IZHA 3QGHA 3MM7B 4FBTA 2HVHA 1VDHA 4NLTA 3KJVA 4UOCA 1U2RA 4R0JA 1NZAA 4K4SA 5IQQA 3DRRB 2UXDF 4WFYA 1ZTTA 2XMTA 3OVAA 4TNOA 2V0NA 1UWAA 4IG3A 4JI7F 3AH6A 1SL2A 2I9SA 5J2MA 3IWXA 3BPSP 4OI4A 2WSCC 3FFIB 3RB6A 5M2PA 2KYZA 3OFHA 3B6BA 2R7SA 3BKFA 3NL0A 3H2LA 2D69A 4OLPA 1EETB 1R43A 3KJFB 2XM3A 3DFEA 4C3MA 1REVB 5L46A 1G2EA 5J2QA 3GJRB 2Y8YA 2IC3A 4CTAB 3OLAA 3JB9k 1LFPA 2CQHA 5LXRA 5CYJA 3I5AA 3M8WA 1JB0C 4X4QA 2UV8A 3W9HA 2AZ1A 4X4NA 1RT6A 3DLJA 1YRUA 2VA3A 1ACMB 3PX4A 1QY7A 3ZZRA 3VAFA 3I5CA 4GKJJ 3DOMA 3GPAA 3W9IA 1Q82T 3T1HJ 4F4ZA 3CWJA 5ETMA 3Q8YA 1G4CA 3QJPA 2DNPA 4ICLB 2DXFA 2QZ8A 3MFHA 4WTOB 1QLNA 1WUUA 5H9EK 1QE1B 1MG7A 1HPZB 1WI8A 1MN9A 2A6MA 4HH1A 1ROFA 1YQHA 2XI3A 4DFKA 2KJWA 1VR6A 3HFZB 4KRWA 3G4SS 2C2DA 1C1CA 5F8LA 2JFDA 1FT8A 1W26A 1HNVA 1R3NA 4C7QA 3DCAA 4XK8C 1S9EA 1JLEB 1LW2A 1OSDA 2HAFA 1RWUA 1BQNA 1RSCA 1EB0A 4BBYA 1JXVA 2FJVA 4I2PB 1IWGA 3CULA 3LF0A 3IWNC 1KC8T 1UVNA 2BABA 3DRPB 5L9NA 6FDRA 2RQKA 3U27A 3FVYA 1VBYA 5E7OB 1Y4ZB 1RCOB 5K20B 4W4MA 3GSIA 4E2FB 3LWLA 1CJUB 2YKNB 2DBBA 2OFGX 4NZ7A 4NI2A 2K1RA 5B0CA 3DHWC 1JLCA 2E5LF 2R7XA 1IM6A 3PV8A 1S99A 1VK8A 1QUPA 3QGIA 3TA0A 2PMWA 1N36J 2NSBA 4ZCKA 3PHEA 1JWWA 4X65F 1XWLA 2XYGB 4NX9A 1S6OA 5KFQA 2NUUG 3CW2C 3KHLA 3BBBA 4B9UA 1O5JA 3JS9A 4TQRA 4Y2MA 1NSKL 2BANB 1UJ6A 3PDNA 5HATA 2YNIA 2V50A 3GYXB 4Y2CA 4NE9C 1BXNA 2HWHA 2FGOA 1TKTB 5D0GA 1U2FA 3T1HF 1CJKA 2UU9J 3C6TA 1RBLA 2J8SA 2QFIA 2DT9A 4P10A 1D3WA 2OJ3A 1JXLA 3BO3A 3E8OA 2JRSA 2E29A 4RO0A 2GA7A 3RAMA 3CUNA 1VRUB 1IJFB 1KS2A 2CJQA 4ITSA 4LBIA 5KFTA 4UOFA 1UVLA 2ZH4A 2PFDA 2ZC4A 1FXDA 5ADZA 3A3NB 3MM9B 4F4XA 1R27B 2HHSA 5KFAA 2OTJS 3RJMB 1BD6A 3KHGA 3VZIA 1P1TA 2HS0A 1M0SA 5HQMA 2HVDA 3CD6S 2CQBA 5LSOA 1U02A 4RW8B 1YDLA 2IA0A 3Q8QB 3PYGA 2LYVA 1IBKJ 2DEJA 4PQUA 3DOKA 3PTWA 2IBOA 4JI6J 1M1GA 1XC9A 3PJXA 1PBUA 3OQ2A 2H9ZA 2AJFE 1PILA 3IM8A 2L9DA 2DHGA 2CKWA 1FWPA 3AODA 2W1BA 4BCAA 2DGWA 1S0OA 1VIOA 3DLKB 1CULB 2LEAA 2MQ8A 4DR5J 5D4NA 3PRVA 3CSKA 4ER8A 2KG1A 5B7WA 5EX3A 1MMDA 2W8KA 1JLQB 2LLZA 1X4EA 2ZBPA 2B5JB 2V4QA 3W3SA 5DQHA 1Y9OA 1N36F 5AJ3J 2DNHA 1C2PA 1NJZA 4CQ1A 3DRXA 3QLHB 3R7SB 4AT1B 5L1KA 2M8DB 3CDAA 1YZ7A 3D28A 3L9ZA 2HKEA 5KOWA 4C8MA 3PR4A 2P2CB 1X8DA 2YNGA 3BYPA 4R5PB 3TJAA 2DH9A 1JLBB 4DV1J 1OJ4A 5G4DA 3TVZA 1NO8A 3MAQA 3LANA 2YPZA 4L76A 3KYLA 3LGNA 4NZ6A 3D2WA 4ELUA 4USHA 2YQ1A 2RRNA 3EICA 1TZ0A 1SIWB 4ZVFA 1FVQA 2AF6A 3MEDB 2UU9F 1FJGJ 2QGFB 1TELA 3K8VA 2V6AA 3ILIA 3GYNA 2VKRA 2A1BA 2NSCA 4XIUA 2B56A 1NK8A 2BXJA 3KUGA 1FD8A 3CXCR 5ETVA 3O8WA 2VG7B 4YR2A 3M2VB 2OPSB 2RE1A 1FKAF 1OPIA 2FC9A 5D77A 2C2KB 1N6QB 1X9SA 2R7TA 1FX2A 4DFJA 1OY8A 1PO6A 3OHAA 1OY9A 4DQIA 5IXUA 3DLGB 4H4OB 1NXIA 1IXKA 1N48A 3J81Y 3A8IA 5KFBA 2GAHC 4RUAA 4OI6A 3T5KA 1H3DA 5CA5A 2P5VA 4USKA 3OL6A 1GX6A 3VAIA 3CF5Q 2DD8S 4LREA 3H90A 3G2XA 3M8QA 3N6LA 2O66A 2XS2A 1XQIA 3GIKA 1LWEA 4JI6F 1NB7A 1X4HA 3N6MA 3BKTA 2HFOA 3K58A 4GKKF 2XY7A 1YRTA 4HT7A 2WSEC 2RNEA 2K8GA 3MEGB 4PWDB 1WTFA 1AYEA 1O51A 1YJWS 5KFGA 1MN7A 1FJ7A 1AT1B 3O5TB 2M3DA 3ADAC 4DR5F 4NOHA 1JJCB 3CD5A 3H25A 2HPUA 3DU5A 2RQMA 3PIPQ 2VPXB 4WKYA 4ED5A 4F67A 2NZCA 2KG0A 4CT9A 2JEFA 2R4FA 5KFLA 4DCJB 2V2QA 2WVEA 4LFBJ 1KD1T 1MROB 1RTDA 1CBKA 1V3ZA 3G8QA 4IFVA 5E41A 1Q1KA 5D0HA 2KHCA 4F2SA 3HFKA 1JLGB 2QL7B 9RUBA 1AW0A 2NXEA 2ZH2A 2QFJA 1IQZA 5EHHA 3WZ0A 1HHTP 1FEEA 5JJBA 3AXMA 4BWMA 4M5IA 2YVSA 4PPZA 1M90T 2LQJA 2J7KA 2JX2A 2MDAA 5F8NA 4H54A 1XMBA 4RR5A 3LQVA 1T7PA 3QQCD 2VG6A 1CJVA 1RAEB 3MD1A 4LVNP 2UUAJ 3SV3A 2FB0A 4FYWB 1RKJA 3H5SA 4PPDA 3W5ZA 5AXMA 4DEZA 4Y3CA 1S10A 3EE3A 1FRKA 3JSMB 1FRLA 2FY1A 2BR0A 2ACMA 2XWYA 5IOLA 3LALA 1JJ2R 4ECZA 2ATCB 2HFNA 3ENVA 3VWSA 5LSLA 3F56A 4CLZA 1K0TA 3BO4A 3MM8A 3SDEA 4A48A 3FQKA 3QT5A 4TU9A 1Q81T 1HA1A 4DQQA 4D3GA 4OMFG 3A13A 4W98A 2HRTA 2DEIA 4Z7YA 2QA4S 3V4MA 2FDNA 2HBZB 2R7QA 3ZZUA 3UI3A 2X1FA 2KFNA 2GO9A 3QWUA 3RBZA 3MPUB 2XSFA 3BR9A 4OYAA 3M1VB 4X84A 1UPMB 2RDIA 2PIIA 3DLEB 2BW7A 5HMWA 2EWHA 2F5GA 1XEZA 3S1TA 3OVBA 4LFBF 2HGNA 3Q23A 1Q16B 1X4CA 3W61A 1HWLA 3UNGC 2MXYA 3RB3A 2ZH5A 2HMIA 3J7AN 5LL6d 4FNIA 4LFCF 2UUWA 4F0MA 5EWGA 1NDPA 4M5JA 1UA1A 4L3KA 3OJUA 5AT1B 4W90B 1RT2A 2H5JB 3M6XA 4LUBA 2KVIA 1W2BR 1UVJA 1XJWB 2DR6A 3AA9A 2V5HG 4PG5A 1S79A 2H5EA 2HBQB 5DETA 2DGXA 3A1YG 2DH8A 4DN9A 2IM2A 3HT3A 1YTYA 2Q1LA 2IM3A 2IRYA 3MWBA 1S4EA 1N5TA 3M30B 4K8RA 4OYXA 3MR5A 4EWTA 2UUAF 4ED6A 3GR0A 4OZJA 2QJ3A 3CCQS 2DPJA 3Q22A 4MKAA 4NLYA 1EP4B 3WC2A 1NU4A 4E98A 2R2UA 3D6MB 4FVMA 3IAM9 3MEEA 4PQAA 1RT7A 5CYMA 3GCXP 4PABA 1NPPA 3M6VA 1N5QA 2XO7A 2HHHJ 3KFWX 2XQCA 2VH7A 2DGUA 2QMXA 1QVFR 4ZN1A 4LF4F 1U1NA 4URSA 1OIAA 5D8HB 3X3UA 1GH8A 3WC0A 2CPEA 5D6GA 1R8CA 1JKHB 3ENQA 1PCAA 2E7VA 3VV2B 3Q89A 3H0PA 4PXDA 3HD1A 4XDCA 2M7SA 3GR1A 3GFZA 2QL9B 4IOAQ 2JC0A 2WBRA 4KO0B 4F4KA 1NCLA 1U1PA 1RA7A 3GFHA 1T03B 1DURA 5D0RA 1SJQA 1WOSA 1T11A 1S1TB 1N54B 3UDVA 3P4UB 2KXFA 3PVXA 3NKYA 1ZA1B 4ECTA 4DS5A 1YITS 3IP0A 4ZDNA 2CPJA 3TAMB 4B3TF 3P3DA 2AIRB 4Y2KA 2MTLA 4F4YA 5DS7A 3VAJA 3OXGA 3NRBA 2GMLA 1WG4A 5ETPA 5HBMB 4P75A 2R7UA 2POKA 1VI7A 1RACB 3EVWA 3LUYA 4K0KJ 1F3VA 2GNKA 4Q43A 2AJ0A 4DV4F 2LFVA 1CC8A 4ECUA 5L8RC 4FF2A 2AP6A 3QZ8A 4MK9A 4N77A 4JI4J 1M5KC 3LP0A 4TY8B 1UJ5A 4U7UD 2ADBA 4YB5A 1TU0B 1TUGB 1NDLA 1RWXB 1IR2A 3CJKB 1S1XA 5DG8A 4LR8A 2Q79A 1GX5A 2BJ9A 3MPWA 2B4PA 3KLEB 3PCOB 2VD3A 4MH8A 1Z2ZA 3KTQA 1BC6A 1SQGA 2HHHF 3NY0A 4P74A 2GHPA 1YIJS 1NK5A 3Q8PB 1ITPA 2ZHAA 2W9BB 3MPDA 2G9OA 1J5OA 1V6HA 2G1DA 4MIBA 3DHXA 3W2WA 1KQSR 2ZVIA 1TL1A 2GIRA 3EPIA 4O3SA 2ZDPA 3QO9A 2DB1A 2IRUA 4WPAA 2R42A 3DRYA 4FF4A 2RHQB 1V9OA 1N4LA 4J7CA 1IR1A 2X7IA 4Q7AA 5G0RB 5I3UB 4ZVGA 1SJ4P 2YX7A 4Z2XA 4N8OA 4ED8A 2KFYA 4OZ1A 4ZJQA 4F02A 1JIHA 2A10A 3GB0A 2BVZA 1EAYC 2VBZA 2MMYA 1IBLJ 3G6ES 1S1VA 2B4UA 5DLFA 3MD3A 2R8GA 1S1WB 2PMZD 1TQLA 2KT3A 4FS1A 5KT3A 1URRA 4I0WA 4QPXA 3JSRA 4A47A 5EGYA 4ECXA 2MSSA 1GMUA 1RAFB 5KFVA 5KT6A 1Q4RA 2C3UA 4P2MA 1S6UA 4NXMF 3HVTA 3I0SA 3DOLB 1RWVB 2V2ZA 4DL5A 4IUFA 1RLDA 5FIIA 3R5CA 3GIJA 2MLYA 5ITHA 2QMWA 4K0KF 1TKZA 1CQNA 2JZ5A 3M32B 5DO2A 2DNNA 3LP2B 4CYUB 3BGOP 1DZ5A 1L3VA 2W9AA 3IS9A 3VZHA 5HSPA 1YLXA 4NEZA 4JI4F 1VOMA 4YQWA 2FQQB 2LA6A 1V5IB 5CYQB 2FHOB 4CWBA 5B0GA 1U47A 4MFBA 2HEKA 1A0OB 1HR0F 3RR8A 5D3GB 2BM1A 4BLGA 2MZTA 2F7VA 4QYRA 2XCAA 2JJ4D 1M5OC 3NAIA 4USUA 3KMQA 2IM0A 4OZNA 3U02A 3GJTB 2BJ3A 4CM2A 3FZBA 3AT1B 3V6KA 1BMQB 1EX8A 5GVQA 4YUDA 2CPZA 1NSQA 2HW3A 3DRSB 4LSZB 1NPKA 2PD1A 2YH1A 4DZDA 3QNWB 2CPFA 1AFJA 3KLHA 1ZAVA 3KLVA 1X4GA 5A8KB 1VJQA 2QN6B 2QLXA 4IR9A 2VQEJ 4BC9A 2Z2YB 3W5XA 2R3VA 4IFYA 1T0TV 3KWMA 1P9QC 3K59A 2NUHA 1OO0B 4LF2A 4MJKA 1T9WA 4R25A 5EDWA 4WYWA 3FBEA 1B7FA 3QFHA 1Y10A 4PZVA 4PXCA 4FF3A 3EVOA 4PR6A 3GIMA 4JI5F 4OX8A 5GMEA 4EEYA 4LRAA 3M9NB 3QMQA 3RR7A 2E1MC 1TAQA 4RL1A 4MK7A 5J1PA 2Z2ZA 3O44A 1CQMA 5C42B 1OYEA 1HBMB 4EU0A 3W5YA 4TXSA 3TX8A 2VUGA 3W2VB 4BS2A 2W2QP 4NMXA 3AQOA 2D7SA 2CAJA 1C0TA 4QR2A 4XTTA 3K0JA 2JL9A 5KFMA 2D74B 2LVWA 4QIVA 2XHWA 4PEOA 2HNYA 3DM2B 2RUSA 1FWKA 4FXWA 4MT1A 2HSEB 1YGYA 1RHKB 1HNWJ 1SL1A 3RG6A 1TL3B 1JK9B 1OY6A 1ZM3A 4FPRA 1QJHA 4OYMA 1TFWA 1PKUA 2PT0A 7AT1B 3IRXA 5H9FK 1NNDA 4ZLLA 3ISNC 4HI2A 5HJXA 4ZK7M 3EJMA 3JYTA 2EVZA 1PAUB 3TX0A 3LGHA 3FBBA 1CG2A 3JSYA 3CJQA 4RWWA 2QL5B 1VQSA 3N9UC 1SJRA 2DHHA 3FK4A 2J5AA 5MLCV 4DV3J 1SPBP 2VQEF 1RWPB 3LP1A 2NYIA 3HFVA 2RRBA 4O44A 5L1JA 2N4DA 2N3OA 4DL0C 3VVUA 4NZ0A 5D4OA 4KSEB 4E8UA 2Y8WA 1NKCA 3B4MA 1QAIA 5F8MA 2R7RA 5CZXA 1RAAB 2F8MA 3KDNA 1XMQF 2DRBA 5LM7E 3SQGA 2Z4PA 5AXLA 4FDFA 1YHQS 4M94A 2FJDB 4DBQA 1S6QA 1RI7A 2KH9A 1TK5A 4ZMMA 4OHXA 4CIOA 1F5CA 5EUHA 1Q7LB 2CWXA 1TK0A 1QM9A 2JLFA 3I96A 5KFNA 4AXJA 4FYDA 5HMXA 1YWXA 1HYSB 4PG6A 1IKYB 4OI1A 4RU2A 1SC3B 5AXKA 1Q7YT 2CXEA 3CC2S 3VVTA 3E51A 3MUVP 2VONA 2XYPB 2GVZA 4M5DB 4MKVA 1Y5LB 4PUOB 4C8OA 2OEMA 3HT0A 4P72A 3CCUS 2MQMA 5DGBA 2Z57B 1HNZJ 1Q8IA 4MKBA 1U0HA 2Q6CA 2RKIB 2VJVA 4NCAA 3G82A 5T7LA 3GV8B 1G1XA 2J6TA 1N5SA 2KXNB 4F8RA 4Y00A 5LJ3Y 4YFUA 2BKNA 1C4CA 4CCHA 4LQ3A 4NLDA 2AYEA 3R5JB 4FYVB 2BE2B 2LDYA 3IRWP 3THTA 3A3OB 5JVHQ 1BGXT 1K0VA 4XAKA 1IM4A 4DI6A 4YS2A 3KLGB 4RBTA 3I0RA 4ILLA 2DO0A 4KGKA 1TFYA 1RQ0A 1I6JA 1UAWA 2YNFB 1U1RA 4QQBA 1YJVA 1UVIA 5E3QA 2B6AA 1E6VB 3HHNB 3C15A 4ZJOA 4B17A 1N88A 2YX4A 4A8MP 3BM7A 2DNMA 3PRBA 4KKOB 5KFWA 2ZZNA 2V4RA 1EQ0A 3GFXA 1GXUA 1RT1B 4DUTA 3CJTA 2JEIA 3MECB 4LMZA 2MJUA 2J9DE 1ZAXA 2WBMA 3VGVA 3HZEA 5BYSA 3PFEA 2E1PA 5DQIA 4HHUA 3ETOA 3HHDA 3TUJC 1S48A 4TY9A 4CT8A 4EYIB 2X3DA 5A6PA 4ZPCA 2KB2A 1RE1B 4TLRA 4JV0A 4QWEA 3OR1B 3HHEA 4K2XA 2WOMB 3CB4A 2C3MA 1S0NA 4U7UK 5LT5A 1GK8A 1NZ8A 2YPYA 4R8UB 3V81A 2X1BA 5GAGU 1R6YA 4OLOA 3QRQA 4X4TA 3EVMA 1GTHA 4ILMA 2JFKA 3O6QA 4OX9J 1U1KA 4ECVA 2IMOA 1D9FA 2Q6BA 2FIUA 3UNYA 2GX8A 2K06A 1LOUA 2HVEA 4Q0BB 4YOEA 3M9MB 1RXOB 5KFPA 4DX6A 1WG5A 1SKSA 5GAHU 1DLOB 5I3QA 3RB4A 3Q8VA 5LXYA 3NEKA 3I4HX 3TANA 1SV5A 1TAUA 2HBRB 1ZM4A 2DY1A 3PACA 3R5AA 2OFHX 2KT5A 4UW2A 4QBUA 3LTOA 4ZPVR 1S1VB 2EFQA 4HTIA 4LFAJ 1VQ4S 4NCGB 3POTA 3D5MA 5KFHA 5B0AA 1ELOA 3M8RA 4AYBD 1WJ9A 4Q44A 1YG0A 1F9FA 1X7VA 3VHQA 4AD6A 5A8WB 5GAGI 1HMVA 4I4BA 3MAAA 3WX8A 3MHYA 2B7CB 4RW6B 1HNIB 2ILZA 3OPKA 3V6DB 1SH0A 1X60A 3PNIA 3WIUA 4EZ6A 3M8PA 4HACB 4DFMA 1R31A 2AYBA 3UR3C 1AUDA 3EGWB 4ZPDA 1N34J 2PI5A 5F3ZA 1PC4A 4AL7A 4FKYA 2UXCJ 5B0FA 3HDSA 4PG8A 4ZLJA 5GAHI 1B64A 2PE8A 2RAQA 4H4KC 2DYAA 2APOA 1IKXB 4DOZA 4PWUA 2V8PA 2YY3A 3HHLC 1AUSL 5U47A 5DM6Q 2RJZA 2P9CA 3QIPB 5CQGA 1TVRA 2OPRA 3EZOA 2MPUA 3L7UA 2XZTB 2QLBB 2V34A 1JJ4A 2QX0A 3K5LA 3OXFA 1X0FA 1FNMA 3SBMA 3BQ1A 2H4YB 2W4CA 5KG1A 2B0GA 1MNEA 1RT3A 4IRCA 5BXIA 2UVUA 3DDNA 4ANEA 2AQ4A 4CO3A 2ASYA 4FXVA 1WEXA 3BO2A 4OX9F 1P1LA 4WFAQ 2BJDA 5GMKa 3ZTPA 2J9EA 1PGZA 3KG4A 2C42A 1NDKA 5FDLA 2CJAA 4IG0A 2BKOA 3QJJA 2ZJRQ 3QYYA 5EX0A 4Q45A 3KKFA 4KE5A 2QA4G 1UZHA 3TRGA 1IUJA 3WX4A 4F0HA 4C11A 3M8ZA 1I51B 1DTTB 2DR7A 5J2NB 2WONB 3OSNA 1H72C 2PI4A 3R5BA 3R7NB 1MLAA 4B08A 3Q8SB 2Y1JA 4O3OA 1RAOA 2EFGA 4DG1B 3B54A 3IN5A 1S9GB 1VLOA 1U24A 3BS9A 5HVGA 4CLPA 4P9SA 3QFWA 1JXEA 3MM5A 4A4JA 5C24B 4K4YA 2FC8A 1WF1A 4H4MB 4ILRA 2WTFA 1N34F 3OR2A 4DR6J 1CVJA 1FRMA 1VK3A 2W7AA 1VS3A 3MM7A 2MQLA 2DR5A 4RNMA 3EPGA 1LWXA 2KM8C 3BQ0A 2G13A 1JLFB 3J7YI 5A2QU 5KG3A 3DRRA 2EXUA 4ZCMA 1CLFA 2IVYA 2CG4A 3DGPB 2M0GB 4DV7F 2G2YA 2MGZB 2LDIA 2M2BA 1XMOJ 1XNRJ 3PX0A 2W7OA 3FFIA 4JI1J 1NHUA 1S59A 2P9EA 5M2RA 1RADB 4WIQA 4HHHA 2IJFA 2I1RA 2X3GA 1EETA 2K3KA 4K59A 3VAHA 3VAKA 1FERA 2V69A 4DSJA 2NPIA 4M1KA 3JTPA 3MUMP 1REVA 3TJ8A 3UCGA 2IAJB 3N79A 2HLTA 1KLMB 4GO7X 2CZ9A 2MJNA 2BACA 4DQRA 4U67Q 2WVCA 5IC4B 2C3YA 4RLEA 3FKBA 1F2HA 1GAOA 4W92B 2IDEA 3KG1A 4ICLA 2XEXA 4KH1B 4GRSA 3W65A 4WXOA 4BHQA 2VC1A 2L3MA 4LBPA 2ZZTA 1QE1A 2V9WA 1HPZA 1Q5YA 2JOQA 3NGSA 3WBZA 1VHFA 3UWTA 3KJQB 3Q8UA 4C0BA 4KGXB 5HL7Q 3R8YA 1HD0A 2C22A 4MMOA 3NMRA 3LGMA 3Q2TC 2HK2A 1YJ9S 3KJNB 1X5OA 2P6SA 4XO0A 3FDSA 4A8FA 3SQOP 5ETSA 1LXNA 1JLEA 1HBUB 3MCOA 4G1IA 1LKZA 4H4KA 2RDDA 1L3UA 4LF5J 1LEOA 3MDFA 2HWTA 2GS8A 3H59A 4DR6F 4A8SA 3PW2A 2Y1LB 3K5MA 4I2PA 1SVDA 1RU2A 2B9EA 4F3OA 3DRPA 2IVMA 3ONQA 1KFSA 3QGGA 5CH7B 3DXSX 2M88A 2R7OA 1G7CB 5F41A 1M1KT 2PGCA 3R6LB 4KFBB 2QYCA 1RAIB 2H5IB 1CJUA 1XMOF 2BE7D 3MR3A 1XNRF 1PG5B 4Q8FA 3GJSB 2VKZG 2YKNA 4DV2J 3C19A 3D68A 4WJBA 1KVJA 3D1OA 4ZPTR 2E5GA 4JI1F 3LOUA 2CPYA 4B3RJ 1KFDA 1HW8A 3VAMA 4QU6A 2MKKA 4KQZA 1T9YA 4YN3B 2FYXA 1Y0HA 3FBCA 3UVJB 3H5UA 5LMUJ 2CJKA 4IKAA 4JV5J 3CVKA 5IC6B 3FCVA 2BANA 3T6JA 3DNCA 1S4FA 1HNXJ 4LIWA 1SC1B 2HGLA 5ETQA 4ANDA 1UFWA 1TKTA 2B9XA 1UEVA 2DXEA 1XR5A 1NMEB 4G1PA 2ZUAA 1FO1A 1RU1A 2QMUB 3ZZPA 4NLGA 2FPHX 2VBXA 1MWZA 5B0EA 4WBFA 3IG1B 4Q8EA 1KVIA 1VRUA 2ADCA 1FDBA 2ZITA 2QRRA 2CJBA 5KFYA 2AGOA 4AL6A 4GMKA 4LSNB 4J9MA 4WFBQ 3JXOA 1FXRA 1PIEA 4M8LA 2RQCA 3MM9A 3GU0A 4B3MJ 3D3CJ 4IDKB 4P7VA 3H42A 4F04B 1HQ2A 1R8PA 2F8EX 3TA1A 4RW8A 5E5NA 2ZEJA 3FNNA 2F9JA 4LT6A 4O23A 2NXCA 4PCQA 5K8OA 2RF2B 2LECA 2EG2A 5DG9A 2IJRA 3M8YA 2CQ4A 2E1AA 1MWQA 2RIJA 3DLKA 1HHSA 1CULA 1RT5B 2VBYA 4EI2A 2W2PP 1NSPA 5CXTA 3OD2A 3TWZA 4CO5A 4NL5A 1ZA2B 2AEJA 4B3RF 1JLQA 2B5JA 5E3AA 1H38A 4P71A 2IRXA 3QLHA 2Y9HA 2RB7A 2R8JA 3AJ2A 3MXHP 4R5PA 5LMUF 2HFSA 4L72B 3CJRA 4LF8F 2FY8A 3R2CJ 3GYGA 4ZN3A 2CQGA 5IV4A 2VG5B 3C6UB 4ZVUB 1BLUA 3MEDA 4C48A 1SBRA 4C0OC 3ICLA 1V5VA 5E3PA 3HSGA 3SYZA 4DR1J 1NK0A 4IH7A 1B0VA 4FS2A 4B9MA 2CQCA 1N33F 2VG7A 1X5TA 5F9NA 2D3OR 3UE2A 3M2VA 4B9VA 2OPSA 2DO4A 2LQ9A 2C28A 2XNRA 3R7BB 3OL7A 2M70A 1N6QA 2RMLA 2DHXA 1HL6A 1BWEA 4DDFA 2MKSA 2YWHA 1N5VA 3DLGA 1WHYA 4H4OA 4B3MF 4KGVB 2G0JA 3MPVA 1DQ9A 4WP9A 3GJQB 4RNFA 3PX6A 1M5PC 1WSVA 2MQQA 4ETZA 4RW9B 2CQ3A 4Q5VA 3PR5B 1FKPB 1YJ7A 3C2PA 3KK1B 4FYXB 2R8IA 4ZVEA 4IQMA 3D6FB 3MEGA 4PWDA 3MURP 1UFKA 4ZCIA 3N5FA 3V6JA 1WC0A 3OJSA 4FYYB 4MAKA 3SSRA 1R7IA 3GZ7A 5HK4A 3ILLA 3TUPA 2GO8A 2MQOA 1SC4B 4X62J 5C25B 4J9UE 2CQ0A 2LEBA 1S6PB 2R7VA 1X0PA 4DMZA 2GCFA 2HFUA 4OYPA 4ES1A 1TMMA 1MMNA 4K7QA 3CO0P 5HO4A 4KGZB 1UA0A 2W9CB 2FUG9 4QIWD 2ZDOA 1NH8A 4DCPB 1WC5A 1MROA 4MTPA 3J80U 1X5SA 4TVAB 1RA6A 5CHCB 4M5NA 4ZVRB 3LPYA 1JLGA 5I3PA 3TAQA 5CCLA 1SCJB 4DR1F 5L39A 1WTBA 3I87A 3MMCB 1C4AA 4A8OA 3OLBA 1Q95G 3AAWB 2KRRA 1FDNA 1WC3A 2DTJA 3BKUA 3S01A 2ZKUA 1OMSA 1H2UX 1J2VA 3VQTA 4NLUA 3TZZA 3NS7B 3JQJA 3US5A 2K7KA 3B8HA 3SZ2A 1DRZA 3BV8A 3T19A 3H20A 1XK8A 1LWFB 4WU2A 4RW4B 3TUIC 5L1LA 1HWJA 2LKZA 4DV5J 1H2TZ 1UWBB 4NLWA 2VPYB 1LWCB 3JSMA 4JB8B 3RBDA 5KFEA 2DCUB 2EC2A 1VQMS 4WFNQ 1PBAA 1VQ9S 3RB0A 5GADU 5HQ8A 2OPQB 4QYZK 3FEXB 3P45B 1RB0A 5F8GA 2VFSA 4PYAA 4GC7A 5DDQC 1EKSA 1PYTA 4ECSA 1U09A 1U49A 4C0HA 4LRBA 1NHVA 4KIAA 2PEHA 4QR1A 2ZJPQ 1IKWB 1UMJA 2KVQE 3CIZA 1RAJA 4DN0A 3KNAA 5C5JA 3QZ7A 1X4DA 1V3SA 4LQ9A 4DL4A 4QWBA 3ZNJ1 3K57A 3PZPA 3M1VA 3JAMU 3SXLA 1Y00A 1W2IA 1K44A 1K1SA 1RTHB 2BQ3A 2O5DA 2GZOA 3DLEA 2WVFA 2J76E 5HP1B 1ZZNA 4P6QA 3SMZA 1GNKA 2HIQA 4X2BA 2ZE2B 4C3LA 5A0YB 3KUEA 3G9CA 4KY3A 3EMTA 3H40A 4C8KA 1L3TA 2YQ3A 1C0UB 4ERDA 4NWBA 4YB6A 2QE5A 3CEDA 4IRDA 1VRQC 1U25A 5K8MA 3R3TA 4NLXA 2I5JB 4ZLPA 5GADI 3IR6B 4O4RA 5KT7A 1K1QA 1UL3A 1FTCA 4OL8A 3AA8A 5KTQA 3HHLB 1LW0B 4B3SF 4MYTA 2A2DA 5KFSA 3CJ8A 4HDGA 2AMCB 4HHJA 1S49A 4LSLB 4P2FA 1WD6A 2C2NA 4P2XA 4Y65A 4DR3J 4QW8A 2VQFJ 5IFMA 2GC8A 4NMLA 2ZOGA 1B3TA 1S7HA 3M30A 4QIGA 1YBUA 2EKYA 5AE1A 4IOBA 2CNLB 2BX6A 2WSFC 4RNOA 4C6AA 3HVWA 5THWA 1EP4A 3PKMA 4Z7CA 1REGX 3NS5A 1T95A 4DCOB 4J9NA 3G8SA 5DDRC 2NCKL 2NXNA 3RZAA 5IT9U 1RYRA 2BMBA 4OI0A 3AB2B 3GWCA 4CLKA 3MUTP 2F63A 1W25A 3BEGB 4YR0A 4EO6A 2FJBB 5ETKA 2ASDA 2LA4A 1B99A 3J7Z5 1LK5A 3H4DA 1VQ7S 4ZJLA 2VOOA 2GGPB 2VPWB 4IQXA 4OJ3A 4OJ1A 4GKJF 1TTHB 4F2RA 1BUXA 5L38A 4R0EA 1JKHA 2N82B 2HNDB 2Z2LA 4U9RA 5DM7Q 1NPRA 1KWMA 2EI5A 4XDDA 1WHXA 2M52A 1URNA 2FZCB 4KO0A 4DHVA 3FQLA 1T03A 3HCXA 2XMAA 1YZ6A 2NZ4A 4I6AA 3S8SA 3DDKA 3CMAS 2DR8A 1S1TA 2MZRA 2GV1A 4OHVA 3G6YA 2UUCJ 4B02A 3S7RA 4ZPAA 2K2PA 2BQUA 2ROPA 2DNZA 3P5BP 3KDOA 4WYLA 2BRKA 5H1SV 3IXQA 5F8IA 8AT1B 3OL9A 3TAMA 3NBPB 1VQOS 2F3JA 2KM8B 3I5BA 1ZM9A 3NP5A 4OZ3A 3EZUA 4I68A 5KFFA 5HBMA 2KHDA 4K5SA 2HVIA 2B9WA 3T41A 2E9TA 3M6WA 3ISND 4EO8A 4IOCQ 1SJ3P 1DQ8A 1IJEB 4DL3A 1S77D 1HWKA 2SXLA 3HSZA 2IVFB 1K8AT 4HTJA 4DR3F 1VISA 2ZH6A 2DIUA 1SB6A 2QC3A 4CO4A 1KVKA 3ZFVA 2R9LA 3GIIA 4MYUA 1QSYA 4TY8A 3PG9A 2QSFA 3FCHA 1FJEB 5KG5A 3CJKA 2E44A 4BDPA 4K4ZA 4ETXA 4LF6J 2DGQA 2XWXA 4KPCA 2ACYA 5DLGA 4FVCA 1RGVA 1HLWA 4K50A 4DL6A 2AJQA 1I5OB 3KLEA 3JQKA 3MFIA 2F1FA 2RQ4A 2JEJA 3QBCA 1NK7A 3PEJA 3OFEA 3TO8A 2FZGB 3MR6A 2CQIA 1HW9A 4QOTA 2WHOA 1VC6A 2DGVA 2W9BA 3OVSA 3ILOA 5C7PA 1EJ7L 3N0VA 3PYDA 3MMAB 2ROEA 4YEAA 4K2JA 3I32A 4EK2A 1I1GA 1RTZA 1AROP 2G4BA 1IN0A 2C2RA 3NCRA 1R0AB 1FFSB 5G0RA 4HEA9 3PW5A 5I3UA 3G6XA 2YKQA 2CJXB 4V19J 3CJSA 1QDUB 2RRAA 3C8YA 3EXCX 1KP6A 2J7WA 5I4MA 4EBCA 1Q53A 1LQ9A 3MTJA 4USMA 5DDPC 1S1WA 2UUCF 1VQ8S 2OIHA 4FXDA 3TUZC 3K89A 1Q8KA 3RAQA 2JDJA 2VV5A 3A4TA 1RZMA 1QAXA 2GQCA 1IBKF 1T05B 4I6WA 4DV6J 1RWKB 3DOLA 2E5IA 2XS5A 1F0XA 1J27A 2BYCA 5BYRA 1N56A 2JEGA 1CS4B 1R8HA 4YMEA 1CPZA 2HZVA 4YB1P 1N52B 4EYHB 3VAGA 1WDDA 4OI3A 3DI6B 4A8KA 3OTCA 3M32A 2QO3A 2W2NP 2OSQA 2Z0GA 3LP2A 4CYUA 3R5GA 5E0OA 3RW7A 4NYOA 1DTQB 3M2UB 2CZVC 3OTDA 3P5TL 1HBOB 3IA0A 2NPFA 4XPCA 5CYQA 2QA1A 4EBEA 3ZTOA 5AJ3F 3TP2A 4GVBB 4LF6F 1Q8BA 1FFWB 3JQMA 1KQKA 2XMMA 5D3GA 2KDOA 5AXNA 3TYTA 5IM0B 3R97A 4N76A 3G86A 4DV1F 1X4BA 3KNGA 1EQMA 1VMBA 2A0FB 3L3CA 3KHRA 2L41A 1TMJA 1AXQA 1YSJA 1FKOB 3A8EA 2AJ1A 3I4PA 2FVRA 3C66A 3DRSA 5CABA 2RVJA 3PJWA 1WSRA 3DLHA 1WORA 3TARA 3CO9A 1FJGF 3KK3B 4FZVA 3ZZ0A 1SKUB 5HMZA 3ZZYA 5A8KA 4FPIA 2ATLA 5J2PB 5M2UA 2C2OB 3NGRA 2IYIA 4DLGA 2BM0A 4CNZA 4DS4A 2HQ3A 2ZWPA 4YR3A 4RBVA 3PXGa 2XCPA 1YKWA 1TL7B 4O3PA 3IO1A 2HYIB 2R2SA 4F7VA 3BBFA 2KYXA 5F9LA 2CFXA 3JSBA 2BA9A 4M5KA 1GEHA 1PAEX 2OGUA 3BREA 4B3OB 5AE3A 2ZH1A 3CCVS 4CLLA 3ZNUA 2D3ZA 2D1CA 3KHHA 2Y1RI 3HVAA 1RBOB 2P6TA 3MM6B 1ZBTA 1DFDA 3M2RB 4DV6F 4JUZA 1HD1A 3ZTQA 5H9EJ 3WDOA 3IBFB 5C42A 1HBMA 4C3KA 1WDTA 3W2VA 3KK2B 3NNHA 3ET6B 2HZCA 4AL5A 1OPZA 4C97A 4WCEQ 4NLRA 1ULRA 4JI3J 3CMQA 2KO1A 3N28A 2DNLA 2FLNA 3DM2A 1RABB 1S97A 1RHJB 2D9PA 4JI2J 2CJYB 1I94J 3AD7C 1TL3A 3UQSA 3EUNA 7FD1A 1I3OB 2C1EB 4RNHA 4DX7A 4FF1A 2OTLS 1NK4A 4KR0B 2ZM6J 4WZQA 1JX4A 2CQPA 5KFKA 2BBEA 1KR4A 3CDUA 5HROB 2ZOMA 2H65B 4AQYJ 3P49B 1TK8A 3EGNA 3HXMA 3G6VA 2GVDB 5KFIA 2CPXA 4KBIA 3DC2A 3BN7A 2H1YA 1NEEA 1E6YB 2DY9A 2HAIA 2MKHA 1SJ1A 1L3SA 4F26A 4Y0FA 3W63A 3FSXA 1NJXA 4CZCA 2ZH8A 3F41A 4QU7A 1M1HA 3C14B 2DISA 3AY0A 5J1EB 5HAOA 2ZH3A 2V8DA 4UQGA 2JH3A 3E2EA 4O0IA 2W01A 2QT7A 1TP7A 4RW7B 1S1UB 2WZ1A 4NEYA 2YWFA 2BV3A 1CJTB 4XPEA 4C8ZA 3CCES 5HANA 3MMBB 3IBCB 4ID8A 2NREA 3K2YA 3CJ5A 3KUHA 1S76D 2BOPA 2MKJA 1HYSA 1IKYA 2L9NA 3NOCA 5FD1A 2N7CA 1F6TA 1BWVA 2I8EA 1PYSB 4WF9Q 4LR7A 4P7TA 4M5DA 4KB7A 4PUOA 4BWJA 4JI3F 1ZH5A 1NB2A 2MZQA 4J9QA 5ETOA 1T3OA 3I31A 1FA0A 4UTGA 4PKDB 2Y0BB 2OKQA 1DAXA 2RKIA 3VALA 2AWZA 2DIVA 1KQFB 1I94F 4V1Ak 3G71S 4LRFA 3FUYA 3NXZA 2NS1B 4WE1B 2CJ9A 1FEHA 4OV1A 5DGAA 4U96A 1Y3JA 2IMWP 3U7JA 2BRLA 3BGRB 3MR7A 2VASA 2BE2A 4AQYF 1WOOA 5FLXU 3KLGA 2QSWA 5IT4A 3LAKA 4ZHRB 2AZ3A 1DQAA 3H8YA 2YNFA 2EFVA 1FF2A 1E6VA 1GQEA 4KKOA 3FZ2A 2VIHA 4USTA 3CGIA 2C3OA 1XBWA 1RUSA 1NK6A 2OELA 4URQU 4LF7J 2R2RA 5K14B 2NXJA 4NLQA 4WFZA 4J9VA 1RT1A 4MK8A 2HQIA 4CRJA 3MCNA 2HHXA 4I2QB 4DSLA 3MECA 1TKXB 2AKWB 4DUYJ 4HR2A 3GIRA 5JMNA 2B4VA 2J7UA 1DHMA 2AEMA 2W7PA 1S5ZA 2BKPA 2OUGA 1NLKL 5CD4H 3OR1A 1N5YB 2ZH7A 2ZWOA 3MAHA 2PN6A 3W1YC 2WOMA 3K17A 2KZMA 3VF0B 2A2CA 3CJ2A 5E3RA 4R8UA 2RDJA 3I56S 1HKAA 1TR0A 2O1PA 5KT5A 2VF3A 1G3OA 2OMOA 3KOAA 1U0SA 4OYWA 2E5LJ 1RT4B 2XYHB 5LMNJ 1L3KA 2FLLA 2EK1A 4PG7A 2DR9A 3G87A 4Q0BA 1F60B 4CI0B 7FDRA 4X65J 2GJ2A 3ULHA 3QT7A 1AA1B 1DLOA 4OHWA 2PA8D 2CQ1A 3CTRA 3OL8A 1EIYB 1U1MA 5DJBA 1MU2B 3D66A 2OPPB 2E66A 3NOGA 1DBDA 2ZKTA 2FD2A 4G6VB 4RZRA 5KG2A 2EG1A 2VZ9A 1YK9A 1U1QA 1CEZA 1RTIB 2YWEA 2AGPA 4NCGA 4JBCA 1S57A 1U7LA 2YTCA 3FSYA 3UD3P 1UPPA 3N6NA 3PKYA 5KFRA 3AOBA 5KOXA 3AXKA 5CD4A 5DDOC 1R8AA 5EWFA 5A8WA 2ZNYA 3LH2S 3SCLE 3IGVA 2XMKA 3GP9A 3O3LA 4RW6A 1HNIA 2GMHA 3V6DA 2AYGA 1HHQA 4HACA 2OH2A 2YWGA 2L08A 4LF7F 2E7XA 2ZHBA 1PC5A 5HVHA 3C16B 2I0XA 3B4DA 4OZ5A 3ELHA 4ED0A 1DJ0A 3H5YA 3RUBL 3Q24A 1WELA 4DUYF 3V2UC 1IKXA 1GXLA 5T14A 3TVKA 3NMAA 5E2QA 2DITA 2QLFB 2HHVA 2GQ2A 4ID5B 5KFJA 1HBNB 1UVMA 3QIPA 3RRKA 3MR2A 2UVVA 4ZLNA 1AZSB 3DXBA 1KOOA 4TQSA 1VC0A 3ITHA 2FJEB 2ILYA 3IAS9 2A18A 4ZS6A 3SFUA 1S12A 3OUYB 1D1UA 1VJWA 3A12A 3I9ZA 1TL5A 2NLWA 4PRFA 2BJ7A 3AOCA 5LMNF 4KGMA 3BQ2A 3BH7B 4KH0B 5A6WA 6AT1B 3E01B 4X4PA 2YNHB 4X4OA 1XERA 4Z37A 3HD2A 2HFZA 2OSRA 5A8RA 1Y5IB 1HI0P 3NWGA 1RHMB 1T02A 5D0EA 1WOPA 1IBLF 4IYQA 1Q5VA 1DTTA 1GMWD 5J2NA 3Q2SC 2WONA 3F73A 4NLVA 5F0WA 2L48A 3LA0A 4HL9A 2HK3A 1SUQB 3OTEA 1C1BB 3ISZA 4DL2A 5KG4A 2W2OP 4DJBA 2V2VA 4IRKA 2FGCA 4JYAJ 4FKXA 2KL8A 4DG1A 5HLFB 1HQUB 1S9GA 5L9XA 4KTQA 3I55S 1R89A 1RTJB 4IO1A 3E3XA 3BGFA 3R9LA 1FWLA 1FE4A 5I42B 4HVZA 1U4BA 2FLPA 5C24A 4H4MA 4CH0S 3T1AA 1YX2A 1UJ4A 2MEWA 2CRLA 4TKTA 2XULA 3AJDA 2MKIA 1HQEB 2V4JB 5HMYA 4I7FB 2RS2A 2UUTA 2N4CA 2AD9A 3SFGA 1Q78A 1JLFA 3I82A 4HT5A 3TQEA 2FTRA 1JJHA 4DSIA 2HNZB 3DGPA 3PYEA 1G6BA 2XSJB 2MGZA 1B0PA 4ZP7A 2HWIA 3MEKA 1FXLA 2LXFA 4FN5A 2GAGC 2ZH9A 4YB7A 4GKKJ 1UTAA 5ETTA 4O3NA 8RUCA 3L4BC 3ZTRA 3QWPA 1HI8A 1IKVB 4RBUA 4DL7A 1D0EA 3RW6A 3SCIE 4HI1A 3RAXA 2HRYA 2VBWA 2IAJA 2J9DA 1KLMA 4GVLA 3QGPA 2B51A 5JUMA 1IVZA 1RLCL 1RHRB 3MCMA 2KI2A 1U8SA 2JVRA 5HQLA 2HLUA 3AFGA 4NYPA 2AT1B 3M4XA 4A46A 2XI2A 2V67A 1TUWA 2YKOA 2BDPA 3BSCA 1F9HA 1NDCA 4WFXA 1K9MT 1MWYA 5SZTA 2IBKA 4ZIVA 3Q8RB 1WACA 1KSPA 2CQ2A 1A7GE 3DDIA 3P96A 1TV6B 2JHEA 3UN2A 4JYAF 2VA2A 4NLOA 4ZCLA 1WF2A 1B7YB 3QAEA 4DF4A 2DVIA 4QW9A 2UUBJ 1QUVA 2ZBQA 4YP3A 3IWLA 3H7HB 1HBUA 4ECRA 3SI8A 1X9MA 4U8YA 4O4GB 1H0HB 4JV1A 2ZD1B 4I67A 5KFUA 3QT8A 1JLAB 1HIYA 1T94A 3DMJB 3TI0A 2E9ZA 3DLBA 1FTRA 1WC1A 1NSAA 3K5NA 2VFUA 3H5XA 1FRJA 1NJWA 1VIXA 4KFBA 1GMVA 4WKRA 1HNWF 1QAJA 3IFEA 2OD6A 2D3O1 2MYFA 1BQMB 1FK9B 2XZDB 1RHQB 4ZP9A 5K9FA 5B0BA 1XTZA 3MZIA 2CDQA 2QEXS 2DJWA 1UETA 3T5LA 4ED2A 3CCMS 2J0SD 4JP8A 4GO5X 2YKMB 1QSSA 3DGVA 1FD2A 2ABYA 4JI8J 3TOQA 4ZVQB 3TZXA 2DNYA 4AFFA 2EFPA 1OSCA 2ASLA 2LQ8A 3KLFB 2XS7A 3UVJA 1UFLA 2X1GA 1U6ZA 1EHWA 4QIFA 5E3CA 4RKUC 3W64A 4PWWA 3CDBA 2QTWA 4K4XA 3OFGA 4B9NA 1BQXA 1FVSA 3P6YC 2FVSA 3W62A 4F4AA 3K7RA 4E0DA 4DV3F 4CLYA 1KTQA 3TEHB 4PAAA 3AHPA 1KBRA 4IH5A 4O3QA 2V68A 4ZVSB 3KLIB 2XLIA 2VFVA 1P27B 3QSIA 5A2QY 4LIRA 4PXBA 2HURA 4LFCJ 1HI1A 3IG1A 1FHTA 3RGIA 4C98A 1IBMJ 4KV8B 5KG6A 3HSDA 2BEFA 1WC6A 2VL1A 3DYAA 1IWAA 1NM2A 1S9FA 3EYZA 4LSNA 3KMSA 3KJVB 4K4WA 3CCLS 4FNHA 3L7PA 1SJFA 4J90A 3QRPA 2UUBF 4ED3A 3FCWA 3FMBA 4N41A 2NQPA 3SIPB 2KXHA 2V8VA 4IDKA 2W24A 4IG3B 1ZYQA 3I6PA 5J2MB 2Z58B 1VQYA 3H2UB 4J9OA 4OFZA 4J91A 3PW4A 3FEZA 1F5BA 1J5EJ 2YXLA 2UXBJ 4DSEA 2Y1IA 3BSNA 4OZ0A 1RWOB 3UD5A 4UF4A 1A9NB 4EZ9A 3MI7X 1X9WA 5HJYA 1U2CA 2RF2A 3Q86A 4Y6IA 4CO2A 4TN2A 5CCMA 1WKLA 4MKYA 3QRRA 1S0VA 1Z1ZA 1GT8A 1HNZF 5F0UA 1FCAA 4J5OA 5J2QB 2IC3B 5LSRA 1OQ6A 4PXEA 3MTKA 1S0MA 1RT5A 4WP8A 4DSKA 1RT6B 4LF4J 5DRKA 4TYAA 4L6V3 3OBIA 2WB4A 3S6EA 5J1NA 3IMQJ 3DOMB 3N01A 2JNJA 4JI8F 3QSYB 2CADA 1NHKL 2DH7A 3VCDA 2PEBA 4KPYA 4UY8T 2N3LA 3UDCA 2AU0A 1T8EA 2KTQA 2HG4A 2IFXA 4OYIA 4ECQA 2KFZA 2KZZA 2JWNA 3H4BA 2M5YA 2XHCA 1UEUA 2VG5A 3C6UA 1C1CB 1U8WA 4HYKA 1KEKA 1HNVB 4P73A 4HKQA 1KONA 2XC9A 3ILJA 4A8YA 1S9EB 4KJIA 1WNEA 1LW2B 4B3TJ 2OLWA 2GIQA 4G1QA 4DR7J 1BQNB 5SUHA 1IBMF 3NNAA 3Q0AA 2E5HA 4ED4A 2W2MP 3F44A 4CLSA 5T41A 1XNQJ 3BH6B 1CSJA 4O3RA 4USIA 3AD9C 5D4PA 1UP1A 2Q66A 2CVEA 2HS3A 3ITHB 4JV2A 1RAHB 4J9PA 2L9WA 2OD4A 2FLOA 2VFRA 4DV4J 2HS4A 1VBKA 2OAUA 4J9KA 1M5SA 4NI2B 2K1RB 2VDIA 3GILA 1J5EF 1JLCB 2UXBF 3UW1A 4RW9A 4RX6A 1ZOTA 4F0KA 1FKPA 3CPWR 2MLZA 3KK1A 2YX1A 4LRCA 3G8TA 3J81U 3ZC4A 2ZBIA 4DQSA 2DHAA 3LO3A 1U48A 2B3TB 4M5HA 3T6BA 4NA2A 3FJ2A 5A8RB 1M5HA 3J7YU 2VOPA 4J9LA 2YNIB 3D0IE 4J9RA 2OHDA 4F50A 2LQBA 4DFPA 2R8KA 5C25A 2V8GA 2XLKA 3BBCA 5D15A 4LFAF 1EKRA 2CA9A 1S6PA 2XMUA 2RU3A 3FC9A 1H6KX 1CJKB 3C6TB 1SKRA 2WW4A 4O0NA 2UP1A 2MY7A 4FP9A 3HLUA 2W9CA 3CC7S 2VHGA 3ZZZA 1L5UA 1NK9A 4WTYA 4I56A 4RUCA 2Z56B 3HMJG 1WKJA 3L7OA 3K5PA 4KYZA 1RWWB 1FESA 3X1LB 4L3NA 4ED1A 1APSA 3CCZA 2FJWA 2ZUGA 3NLCA 2EKNA 3KG0A 1TL4A 2C2EA 5H9FJ 1VQ5S 1Q79A 2EC0A 2UXCF 4OHYA 4NCBA 4USVA 6FD1A 3EGVA 3LPEA 2J0QD 3MMCA 3IGNA 4DR7F 2IPOB 4ED7A 2XY5A 2KJVA 3JTNA 4NXMJ 4NXNJ 4PQUB 4YHHJ 3DOKB 1XNQF 4KAIA 2BJ8A 3PO4A 2CVIA 4RPFA 3MOZA 3TEGA 2DGSA 3H2VE 3GG0A 4N56A 1MW7A 1OQ3A 3GG1A 1LWFA 4RW4A 3L09A 4DX5A 1KOHA 1YJNS 1UWBA 1LWCA 1NBEB 2XBPA 4HH0A 2QYGA 5KFXA 4KHMA 1FRIA 4OJHA 2OPQA 5KT4A 3ZTSA 1N8RT 2IY5B 2WK4A 4V19X 1H98A 4OHZA 2CQDA 3NG8A 3HX9A 3NNCA 3FRZA 2ZVSA 1HR0J 2YQ0A 2WAQD 5B0DA 2ZJQQ 2RUGA 1IKWA 1ZM2A 2YNGB 1VCTA 3NGUA 4LRDA 2ERRA 4J37A 3W66A 2A3JA 3CCSS 2KKHA 5RUBA 3M05A 1X5PA 2LMIA 1WG1A 4LR9A 4IH6A 1RTHA 2DRAA 4A8XA 5JXSA 5HP1A 2ZE2A 5A0YA 2ZC3A 2RSQA 4L75A 1C0UA 3HVRA 1RKIA 4TLQA 5DG7A 4C9DA 3D3BJ 1VQLS 1R0CB 2N7YA 4OJGA 2I5JA 3BPDA 4ALZA 4ZP6A 3J7ZT 5JVGQ 3THPA 3HHLA 4LBHA 1LW0A 4ECYA 4JI5J 4WZMA 2ROGA 3QIDA 8ATCB 4NRUA 2FHJA 4DU7A 4NRTA 1KQGB 4KT0C 4LSLA 1S7IA 1H7XA 3M8QB 1YI2S 4DPXA 3D1HA 4NXNF 2JSXA 4YHHF 2VICA 4IO9Q 1LWEB 2QLJB 2C2MB 2OEKA 3VR1A 4IR1A 1QSLA 2IM1A 1WHWA 2WW8A 5CZVA 1RJJA 4P52A 3PEHA 1QTMA 2C3PA 2VPZB 1FNOA 4UZBA 2F65A 1YBTA 3CT9A 2JVOA 2U2FA 1ZS6A 2LP4A 1HARA 2HQGA 1GXTA 3AQPA 1TUVA 1JMTA 3NGTA 3W8PA 2GFFA 4X64J 5GAEU 3J80Y 2B43A 2H51B 5DZ7A 2VC0A 3EXYA 4QWAA 1SH2A 1PJ5A 5CAAA 1SH3A 4EBDA 3RRGA 2GGPA 3BR8A 5F3TA 1HWIA 1JQGA 2VU5A 4DV0J 2CDRB 4USJC 3PYFA 3FEYB 3D54A 4ATNA 4OX6A 1RTDB 1QTNB 4IFVB 1YRXA 3C3LA 1D9AA 3CNQP 2HNDA 3TQ1A 2CUYA 3VGSA 4EMDA 1XIQA 1B4SA 3NGDA 2O01C 3TR5A 5C2GA 3DYAB 3CDWA 5KG0A 2DNKA 4ZOSA 1R6VA 2R7WA 2AGQA 1W7WA 2IJNA 1N0VC 2HFVA 2YWWA 3UPFA 4L73A 2ZOFA 2W4PA 4RUBA 2F40A 4U8VA 4KHRA 2HVZA 5GAEI 2X1AA 3NBPA 2VG6B 4OYOA 3BYRA 3OTOJ 1CJVB 2F4VJ 3DN9A 1U6FA 4LF5F 4RJVA 4OI2A 2KU7A 1N32J 4ZKAA 3IM9A 2J0WA 1ZAWA 1XMQJ 4M95A 4K5RA 1X31C 5DZ6A 3D6TB 4J9SA 3BGLA 2EW9A 2BE9B 1EARA 4I1TA 2D3UA 3ENWA 1BY9A 2MZ1A 4Q2MA 2XG8A 3OSPA 3TVYA 4CLTA 3UDLA 3IC1A 3D0HE 4DV2F 2FZKB 3MM8B 2Y3YA 3SDEB 1Q8LA 2K7JA 3RTVA 3Q83A 3JAMY 4NLPA 2IHR1 2AEFA 2B8PA 3BN4A 3UR0A 3TJ9A 1U1OA 1T9XA 4ZPBA 2ZHOA 1FFGB 1WC4A 4X64F 2WB1D 1YVFA 1TKDA 2G0CA 1K73T 1FI4A 4JV5F 3THVA 1U26A 1WKKA 4C8LA 3TA2A 1D8YA 1Z4UA 2BJEA 1HNXF 3HP6A 2K3IA 4DV0F 5ETNA 3MMAA 1YJRA 1KN6A 2B8QA 4QCLA 4NLSA 4DLEA 3CJ0A 3FMWA 4UT4A 1SIZA 4L74A 2MHEA 3V4IA 1R0AA 2HMIB 4G1QB 1GFWB 4KC5A 1X4AA 3UCUP 1RT2B 5B09A 3CCWA 3GE9A 3HZGA 2DK2A 2GHWA 5KG7A 5KFOA 1VYAA 2HHQA 3HI9A 3I9V9 2YWKA 4RU9A 2FVQA 4ZVPB 4HLBA 1JNRB 2R2TA 3OTOF 2F4VF 3ZXWA 3SCJE 5IT9Y 5F8HA 4KHPJ 2FHKA 4UY85 3CCTA 1N32F 4B9SA 1T05A 2OI2A 3NAHA 1FE0A 2J8AA 2HHTA 4C8NA 2XY6A 2O67A 2GIFA 2VJUA 5L1IA 1CS4A 1MMLA 2YBVA 3MEEB 2V94A 4DF8A 1RT7B 4JOUA 5CYMB 3IBWA 5E33A 3DI6A 1NUEA 4DZ6A 3BZQA 3UD4P 1BE4A 4OYZA 2H54B 2MY8A 1DTQA 2BOAA 3M2UA 5ETLA 1JNZB 3BJYA 1KNZA 4ZPWR 1XN9A 1HBOA 5AE2A 5IV3A 1H74A 3LWMA 1N0UA 3UCZP 3VTIA 4GVBA 3TZWA 1T9UA 1F2GA 2FJAB 1PJ6A 1LV5A 3L95X 1WI6A 4N5SA 4A8QA 1VBZA 1T9TA 1NJIT 5IM0A 3VQSA 2W25A 2YKAA 3CD0A 3R27A 3EX7B 3GFYA 4QWCA 3K8WA 2AJ4A 1RWNB 1FKOA 4F4WA 2B4OA 1XR6A 2G0IA 3NCPA 3KK3A 4RWXA 3WHIA 4DWIA 5J2PA 4B9LA 2G2OA 3N5BA 2M8HA 3EWGA 4WK3A 2AX1A 2R8HA 1YJTA 1TL7A 1UZDA 4K4TA 5KFCA 4X4SA 5BR8J 4ES3A 1YJUA 2Q3PA 3R6GB 4I69A 4B3OA 4QJVA 3D0GE 4S0MA 4ZP8A 1GMWA 2GQQA 3UO0A 2Z8QA 1VRTA 4X4VA 2JLEA 4GC6A 4DQPA 4I64A 4KHPF 2HIYA 3HSJA 2F9DA 5EN1A 3LP0B 3MM6A 4OZLA 2CYYA 3M2RA 3UDEA 4F25A 1FRHA 1S1XB 4DR4J 4C2MA 3PRDA 2ZFHA 1SL0A 4ELVA 3KK2A 2XMVA 3ET6A 3SCKE 2FVPA 2I2YA 1LNQA 2A6OA 1DARA 5KAKA 1R0BG 2PA3A 2XGQA 4RUHA 2DPIA 1HFEL 4X62F 1J5OB 4UZCA 2BJ1A 3W2WB 4CH1A 2HQFA 4CO1A 1TL1B 5KFZA 2D9OA 3QO9B 3W8GA 1M5VC 3HF5A 4HDHA 1KRPA 2Z30B 2MQPA 3IR5B 1IR0A 4CP5A 2MKCA 5HROA 3KXDA 3CJ4A 1UW4A 3CD7A 2GVDA 5IQ6A 3HHKA 4M5LA 2VDHA 3CCJS 5KT2A 1B70B 1E6YA 2MQNA 2PO4A 3W60A 3ZO7A 2UV8G 2XZWA 4U6PA 3HO1A 1RK8A 2DKOB 3MMJA 4P2SA 3EZ5A 3SEOA 1PJ7A 3C14A 4F3MA 4YY3J 2NYHA 4NPOA 5J1EA 3HVTB 1RDRA 2HHUA 4UUWA 3I0SB 2XTJP 2DRDA 3LAMA 5IWAJ 5BR8F 4RW7A 1AFIA 2B9YA 1VQPS 1VLYA 3VGUA 1TKZB 4WWSA 1S1UA 5HI7A 1Z2LA 1U45A 4DUZJ 1CJTA 3T9NA 4DV5F 4QIEA
chains in the Genus database with same CATH topology
1HI0P 5HMWA 3PO5A 3NWGA 2EWHA 1XEZA 3S1TA 1FDDA 3IS9B 1T02A 3OVBA 1YBAA 3MMBA 4LFBF 2FJXA 2HGNA 3Q23A 3CC4S 1Q16B 1X4CA 4IYQA 1IBLF 4PCQA 1DTTA 3MPYA 4YDXA 1P8GA 5J2NA 3Q2SC 2WONA 3F73A 5K8OA 4NLVA 1HWLA 2RF2B 3QAUA 1J5OA 5F0WA 2L48A 3UNGC 4OQJA 2LECA 2MXYA 2EG2A 4HL9A 5DG9A 1SUQB 3RB3A 2ZH5A 3OTEA 1C1BB 2Y0SD 3ISZA 3OHBA 2HMIA 1QAYA 4DR4F 5LL6d 2CQ4A 2E1AA 4FNIA 4DL2A 4LFCF 5KG4A 4X4RA 4MFBB 2UUWA 4DJBA 4AE5A 2CZ4A 5EWGA 2RIJA 4IRKA 3CCRS 2FGCA 4OX7A 1UA1A 3FGVA 3DLKA 1HHSA 1RT5B 3OJUA 2VBYA 4DG1A 4W90B 2LXIA 5HLFB 1HQUB 5LJ5Y 1RT2A 1S9GA 5L9XA 4KTQA 3M6XA 3I55S 1R89A 4LUBA 5CXTA 1RTJB 4QWDA 4CO5A 4IO1A 3E3XA 2KVIA 1W2BR 4NL5A 1UVJA 2MHNA 3BGFA 3AA9A 2V5HG 3SV4A 1FE4A 4B3RF 5I42B 4HVZA 2LEPA 2DNOA 3QJLA 1U4BA 1JLQA 3PW7A 5K5MA 2FLPA 4CH7A 4PG5A 5C24A 1S79A 2H5EA 2B5JA 5DETA 3C46A 5E3AA 1H38A 2E1RA 2CPHA 4H4MA 4CH0S 2DGXA 3A1YG 2DH8A 3T1AA 4DN9A 1UJ4A 2E1CA 2IRXA 2IM2A 3QLHA 2CRLA 1P6TA 3IR7B 4PG4A 2RB7A 3BDEA 4TKTA 3HT3A 2Q1LA 1YTYA 2XULA 2IM3A 2R8JA 2MKIA 1HQEB 2V4JB 3AJ2A 5HMYA 2IRYA 3MWBA 4I7FB 2E7WA 1N5TA 3MXHP 3M30B 4WE1A 2RS2A 5IT0A 1NKEA 3KLHB 2KT2A 2N4CA 2UUTA 4R5PA 4EWTA 3MR5A 5LMUF 2UUAF 2AD9A 3MCSA 4L72B 3SFGA 3RRHA 4ED6A 3O1LA 4LF8F 3GR0A 4OZJA 2BUNA 3CCQS 2UVWA 1Q78A 2DPJA 3Q22A 1JLFA 3BGRA 4IFYB 4MKAA 2CQGA 2MZJA 4NLYA 3I82A 1EP4B 2VG5B 4HT5A 3C6UB 2FTRA 3WC2A 1NU4A 4E98A 1JJHA 4DSIA 2R2UA 2PFFB 2HNZB 3DGPA 4FVMA 1G6BA 4I6YA 2XSJB 3IAM9 3MEEA 2MGZA 3R1LA 1B0PA 4ZP7A 4PQAA 2HWIA 2OMLA 2RS8A 3TW0A 1BLUA 3MEKA 1FXLA 2LXFA 3MEDA 1Y3KA 1RT7A 1SBRA 4ZHRA 4FN5A 2CPIA 5CYMA 4C0OC 2ZH9A 3ICLA 5E3PA 3SYZA 3GMGA 4YB7A 1NK0A 3M6VA 1N5QA 4IH7A 1B0VA 2XO7A 4O3NA 4FS2A 4B9MA 3KFWX 1VQNS 2CQCA 2VH7A 2DGUA 2GMJA 3QWPA 1HI8A 2QMXA 1N33F 1RISA 1QVFR 1IKVB 4LF4F 4RBUA 1U1NA 4URSA 1OIAA 4DL7A 5D8HB 3NCQA 3X3UA 1ZPVA 2NXUA 1D0EA 3RW6A 3DLLQ 2VG7A 1X5TA 3SCIE 5F9NA 3T5HA 2D3OR 4HI1A 2YKPA 2X51A 1GH8A 2OP5A 3RAXA 3UE2A 3M2VA 4B9VA 2OPSA 3WC0A 5K14A 4YY3F 4NA3A 2GHVC 2CPEA 2DO4A 2LQ9A 2C28A 2W8LA 1A6LA 5D6GA 2XNRA 2HRYA 1LK7A 1R8CA 2M70A 3OL7A 1N6QA 3M9OB 2ALZA 1JKHB 2RMLA 2DHXA 3ENQA 2VBWA 2IAJA 2J9DA 1HL6A 2V9KA 4DDFA 1BWEA 2VQFF 1LXJA 1KLMA 4I2QA 3BSAA 4PXDA 2MKSA 4XDCA 1TKXA 2YWHA 2VB6A 3QGPA 2B51A 1N5VA 2M7SA 3GR1A 3GFZA 3GQCA 3DLGA 3TAPA 4IOAQ 2QA2A 5JUMA 1WHYA 4H4OA 4B3MF 5IWAF 2JC0A 2WBRA 2P9GA 4KO0B 4F4KA 2KI2A 1U1PA 1RA7A 1U8SA 3GFHA 2JVRA 4DUZF 1T03B 1DURA 2DNQA 2HLUA 3MPVA 4NYPA 1C0TB 1SJQA 4DPOA 1DQ9A 3M4XA 4RNFA 4A46A 2XI2A 3B82A 1S1TB 3CE8A 3PX6A 1M5PC 2YKOA 2BDPA 4DSFA 2MQQA 2RT3A 1N54B 4ETZA 3BSCA 1NJYA 4RW9B 2FHMA 2KXFA 3PVXA 1N5YA 3NKYA 2CQ3A 2HNYB 4WFXA 1K9MT 4Q5VA 3PR5B 1MWYA 5SZTA 5FJ4A 1FKPB 3NGKA 3C2PA 2IBKA 4N47A 3KK1B 4ECTA 4DS5A 1YITS 2IYGA 4ZDNA 3Q8RB 2CPJA 1WACA 1KSPA 2CQ2A 2R8IA 3TAMB 3CJ3A 2AW0A 4ZVEA 4B3TF 1A7GE 3P3DA 4IQMA 2IA6A 4Y2KA 3P96A 1TV6B 1PSDA 2DNGA 3PM9A 4F4YA 2E5JA 5DS7A 3VAJA 3MEGA 3OXGA 4PWDA 4Q2LA 3MURP 3NRBA 3N5FA 3IRXB 4ZCIA 2JHEA 1ZETA 3V6JA 2GMLA 1WG4A 4JYAF 2BQRA 3OJSA 2VA2A 5HBMB 4NLOA 4MAKA 3SSRA 1R7IA 4ZCLA 3U1NA 1WF2A 3GZ7A 1RT4A 3QAEA 4DF4A 1H2VZ 4JI0F 2GO8A 2MQOA 2DVIA 4QW9A 2R7UA 2POKA 5C25B 1VI7A 1QUVA 3JYTB 4TU7A 4YP3A 3LUYA 2CQ0A 3IWLA 2LEBA 2MZSA 1S6PB 1HBUA 1X0PA 4DMZA 4ECRA 2R7VA 2GCFA 3SI8A 1X9MA 2GNKA 3V4IB 4O4GB 4Q43A 4ES1A 1H0HB 1MMNA 2AJ0A 4CTAA 4DV4F 4JV1A 2ZD1B 4I67A 1CC8A 5HO4A 4ECUA 5KFUA 1T3NA 5L8RC 4FF2A 1JLAB 1UA0A 2PMHA 2AP6A 3QZ8A 2W9CB 2FUG9 4QIWD 1MU2A 2OPPA 1T94A 2ZDOA 3DMJB 4MK9A 4N77A 3TI0A 1NH8A 5DQGA 1OWXA 2E9ZA 4N8NA 1MROA 4MTPA 3DLBA 1M5KC 1FTRA 2YH0A 3LP0A 3K5NA 1X5SA 4TY8B 1UJ5A 1RTIA 4QR0A 1LFWA 2ADBA 2J6SA 1RA6A 2VFUA 4YB5A 4C4WA 3H5XA 3CJKB 1FRJA 1KHWA 5CHCB 3LP1B 3OTBA 1NJWA 2EFOA 3PFOA 1S1XA 4O44B 5DG8A 1VIXA 4KFBA 4WKRA 2QLWA 1RP5A 1HNWF 3LPYA 2COLA 2JLGA 1QAJA 4K4VA 2Q79A 3IFEA 1JLGA 1GX5A 2OD6A 5I3PA 2MYFA 4DR2F 1BQMB 3TAQA 1FK9B 3MPWA 5CCLA 2B4PA 3KLEB 2LU2A 2VD3A 4MH8A 1SQEA 4ZP9A 1Z2ZA 5K9FA 4DR1F 5B0BA 3KTQA 1BC6A 5L39A 1WTBA 1XTZA 3I87A 2HHHF 1HYSB 3MMCB 3MZIA 1C4AA 2CDQA 2QEXS 2DJWA 2CPDA 3GSDA 1UETA 3T5LA 4A8OA 3OLBA 3SQGB 1GTEA 2GHPA 3CCMS 4ED2A 2J0SD 1YIJS 3AAWB 1NK5A 3Q8PB 4GO5X 5MAOA 4U7CA 2KRRA 2ZHAA 2YKMB 4TYBA 1QSSA 1FDNA 2W9BB 2G9OA 1FD2A 1V6HA 1S6QB 2ABYA 2G1DA 2DTJA 4MIBA 2DHSA 3DHXA 3S01A 2ZKUA 3TOQA 3W2WA 1H2UX 1KQSR 1J2VA 3VQTA 3AJ1A 2DNYA 4NLUA 1TL1A 4AFFA 2GIRA 2EFPA 3O2IA 3EPIA 1Y5NB 4O3SA 1OSCA 2ZDPA 4MIWA 2ASLA 3US5A 2K7KA 3QO9A 2DB1A 3KLFB 2IRUA 3B8HA 2XS7A 3GV5B 3SZ2A 3DRYA 1UFLA 2X1GA 4RNNA 4FF4A 1U6ZA 1DRZA 1V9OA 4LF9F 3T19A 1N4LA 4QIFA 4Y2IA 3H20A 5E3CA 3OW2R 4Q7AA 4RKUC 1XK8A 4MIAA 1LWFB 4WU2A 4RW4B 3CDBA 3U1MA 4K4XA 5G0RB 3TUIC 3OFGA 4B9NA 1BQXA 5I3UB 4ZVGA 4DX8H 2YX7A 1FVSA 4Y2AA 5L1LA 1SJ4P 4Z2XA 3P6YC 1HWJA 1WF0A 4N8OA 2LKZA 4ED8A 2FVSA 2KFYA 4OZ1A