2MYOA

Solution structure of myotrophin, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOTROPHIN
publication title The structural basis of ankyrin-like repeat function as revealed by the solution structure of myotrophin.
pubmed doi rcsb
molecule tags Ank-repeat
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2myoA00
1NFIE 2BKKB 5ENPD 4U8YD 2VGEA 3B7BA 4Z68A 2A5EA 4ZHBA 1N0QA 3HG0D 1DCQA 4K5AB 2F37A 4LG6A 3UI2A 1IXVA 4K5CA 1MX4A 5CERB 5ENOD 4U96D 1N11A 3Q9UC 3AAAC 5EILA 3ZNGA 1YCSB 2RFAA 5AQ9A 2B0OE 3B95A 3TWSA 2XEHA 3EU9A 4BESA 5AQBA 5FINA 2ETAA 3JXIA 5ENQD 3TWXA 2DWZA 4OAVB 1SW6A 3UTMA 1S70B 4O1OA 5EYLA 2PNNA 5HS0A 3V31A 4DUIA 4ZFHA 2RFMA 2MYOA 3ZU7B 2NYJA 4QFVA 3J5PA 5ENSD 3DEPA 2JABA 1BI7B 2J8SD 2KXPC 2QC9A 4HRMB 4O1PA 1IKND 5AARA 5ITZF 2KBXA 1A5EA 2XEEA 4HQDA 4HI8A 5BXOA 5ENRD 1SVXA 2AJAA 4GMRA 5CECB 5AQ7A 1YYHA 3V30A 4K5BA 5CBOA 3JXJA 4N5QA 5CEAA 3DEOA 1MX6A 4NIKA 1IHBA 4BERA 5HKPA 5BXUA 5CBNA 4J8YA 4ATZD 5JA4D 1BLXB 4BEPA 4DX2A 1YMPA 1BD8A 2ZGDA 4DX5D 4YDYA 5KWDA 3AJIA 1G3NB 1D9SA 3T8KA 4RLYA 2ETCA 3T9KA 5EN5D 4DRXE 4DX6D 2V5QC 4LSZE 3NBNB 2XZDG 4GPMA 2ZGGA 4TUMA 4HRLA 3UXGA 2V4HC 5AN8A 2L6BA 4U8VD 4DX1A 3C5RA 2ETBA 3ZUVB 5AQAA 4YDWA 3IXEA 4LNUD 2BKGA 3KEAA 4CYMD 1UOHA 1MX2A 3J5QB 4HB5A 2HE0A 4J7WA 3V79K 3V2XA 3TWQA 4F1PA 1OY3D 2P2CP 5FIOA 3ZKJA 4HBDA 4B93B 1MYOA 2Y0BG 2DVWA 1QYMA 5EIDA 5D66A 4BETA 1TR4A 1K1BA 1BI8B 2XZTG 2DZNA 5JMND 3D9HA 1WDYA 2XENA 4A63B 4U95D 1WG0A 3TWUA 4C48B 1N0RA 2QYJA 1K3ZD 3F6QA 4JB8P 5EYPF 2Y1LE 3NOGD 4OAUC 5KNGA 2FO1E 4HLLA 5EIBE 1OT8A 1DC2A 3HRAA 2DZOA 3W9FA 4HI9A 4O60A 3Q9NC 4QQIA 4G8LA 4DX7D 4CZ2D 4BSZB 2F8YA 1K1AA 4G8KA 4HNAD 5KBAA 1AWCB 3EHRA 5ENTD 3V2OA 4HRNA 3SO8A 1BU9A 3JUEA 5CEDB 4F6RD 3W9GA 1MJ0A 5HRYA 5AAOA 2F8XK 3LJNA 3TWVA 4UUCA 3TWTA 3NOCD 1AP7A 3TWRA 3EHQA 5KNHD 3TWWA
chains in the Genus database with same CATH superfamily
3C72A 1ZU2A 2WXMA 4Z68A 4KT6B 3HXFA 1O1SA 5ENOD 5EILA 4ILHB 4B94A 3E30A 3CVXA 2P9UG 2PNNA 4GZ3A 2MYOA 1TJCA 1TJFA 4AV7A 4GMRA 1TN8A 2IONA 4K5BA 2KCVA 1OCRE 4N5QA 4V3IA 3ABME 1PC2A 2Y69E 3RJVA 2IO2C 3AS8A 3QWWA 2M63A 1G3NB 2XCCA 4KZ0A 4AIFA 2WXLA 4CDNA 2UWJG 3HYMB 2XZDG 3UIPC 1H19A 2E0IA 2XS1A 1E8ZA 1FCHA 2HE0A 3LJ3A 5EX3A 5CCLA 2WXJA 4UQYA 1IYGA 3CSTA 2H6GA 3EUVA 4C48B 4GMLA 4G23A 2PM7A 3CVQA 2FO1E 3PREA 4U0ZA 3DBSA 3TGOA 5FTPA 3CK8A 1Q2ZA 3BQOA 4HNAD 4F6RD 2F8XK 3LJNA 4PH4B 5KNHD 2P9PG 2AVPA 4APFA 4U8YD 2CFZA 4GPKA 3ENEA 3ASNE 1SA4A 1IXVA 4K5CA 3S2AA 3DSTA 4RG9A 1YCSB 1U2VG 2RFAA 4GZCA 4GYOA 4OVUA 5FINA 1LF8A 3PDNA 4DPRA 5BNWA 3ZN3A 3FU6A 3UQ3A 3CVNA 1QZ2A 3CVYA 4N3BA 5FQ4A 2XPIA 3DWLG 4EECA 4FC8A 4L2YA 2EINE 4DRXE 4PUCA 3OXFA 4Y6WA 1RZ4A 3GZSA 3MZLB 2WXIA 5AQAA 3G2WA 4U0SA 2FF4A 2GW1A 4NQ0A 3V79K 2PQRA 4Q69A 3KSQA 2YHEA 5EIDA 3ABLE 4JW1A 5FZRA 4GYWA 2A5UA 3QNKA 3ASFA 1DC2A 4APOA 3EHMA 3RSEG 1L5JA 4KVOA 5LP0A 5KBAA 2KCLA 5CEDB 5A23A 5ARFA 4P29A 4ILGA 1Y8MA 2LSUA 1HH8A 2P9LG 4JEHA 2A5EA 4J8FA 3IHVA 3JQ0A 3NQPA 2VYIA 5G05J 3PZ2A 4U8HA 1O1TA 4GU5A 5G05C 2Y4UA 1NA3A 3LVRE 3RO2A 4ABNA 2YINA 3AS5A 2ZISA 1SA5A 3WXXA 3CV0A 4TXQA 3P2BA 3FUHA 1ELRA 3C3OA 4DLOA 3ABKE 3QWPA 3CSFA 1TNZA 1S63A 3FU0A 1N4PA 3APCA 2GROB 2IJGX 4KZCA 3KD7A 3LY9A 2WXKA 3HHMA 2LXLA 4HXIA 2IO3C 3FU5A 4IN3B 3UT4A 3OXGA 1HG5A 4CYMD 1K8KG 5BT1A 4RSYA 3QC1A 5G2NA 4HORA 1BI8B 3Q73A 4A63B 4GA2A 3U9WA 4XIFA 4MRUA 2Y1LE 3G2SA 3JUIA 3NF1A 4GTQA 4URKA 3URZA 3PVLA 4GB9A 1A17A 3I4RB 3OTNA 5AJDA 3Q79A 2H6IA 4G24A 2Y4TA 4Y6CA 3RU0A 2BKKB 3FTXA 4N3CA 4CCAA 3O4ZA 1KZPA 3AAAC 1HU3A 3JXIA 4BTBA 5EDSA 4G1TA 2JABA 1BI7B 2JEKA 4KMOA 4JA7A 2QC9A 4HRMB 5ITZF 5AQ7A 2R5SA 1Z5SC 2J09A 2ZU6B 3L13A 4PS3A 4BERA 4I1AA 4I2WA 4DX5D 5KWDA 4RLYA 4J8EA 1INZA 3NBNB 2XRYA 4GPMA 2ZGGA 3ISMC 4B89A 2WB2A 3C5RA 3UINC 4B0ZA 4LNBA 3Q15A 5DIZA 4HB5A 4GZDA 3TG4A 3D9IA 3PH0C 1Z6TA 3HXBA 3SY2A 1K1BA 2I1KA 4HOQA 5FT9A 3ZYMA 3DRAA 2BEDA 1UJKA 2AW6A 3FTYA 2VSYA 2L0TB 4G8LA 4RQIA 4K0RA 2XRZA 4EZLA 1UJJA 4DI4A 5LCWJ 3U64A 3MKRA 1IHGA 2DYSE 3L17A 2DCPA 4XE0A 5CCMA 2XCBA 1KLXA 4G2VA 3FUDA 3D9NA 3CKBA 1N0QA 2I9CA 3I3NA 5EKQD 1MX4A 4NURA 3LKUA 4KYOB 3I5PA 3N71A 2L9BA 3APFA 2CHXA 1Y6IA 4CGVA 3VTXA 3FTSA 4F3VA 3SNXA 3B7SA 5HS0A 2GRQB 3FHEA 2C0LA 2QYUA 5T4YA 4ACLA 2C2LA 4GTTA 3MJWA 3FTUA 2X6HA 2X6KA 3AU5A 3LDZA 5KJKA 4JA9A 4E6HA 1BLXB 3TJPA 2IEJA 2OEWA 4DX6D 1H2TC 4IRUA 1H6OA 2R59A 2L6BA 3FUEA 4JHRA 3FU3A 3ASOE 2FEZA 3ZYQA 2CHWA 2XPZA 3ULYA 3DXKG 3PZ4A 4LNGA 1FPPA 5JMND 3TWUA 3F6QA 4JC8A 4CGWA 2UY1A 5D0OD 3UT8A 3ZW3A 3HRAA 4HI9A 1OWPA 5BV0A 1OWLA 4UWHA 3R7RA 3EJNA 1OXJA 1MJ0A 3BG0B 1AP7A 2WMOA 4DLQA 2L0IA 4Q96A 2LUHA 3FH5A 2NC9A 3ZNGA 4H7XA 4WNFA 3U4TA 3LY8A 4J0UA 4W9RA 5E76A 1S64A 4FP7A 2WXOA 2GRMA 2VGXB 1PAQA 4XX5A 3FUMA 5LOZA 2KXPC 1TN7A 2AXUA 2XEEA 4HI8A 4X8QA 2J4BA 4U07A 3ZEFA 3RRUA 3JYSA 5CBOA 3JXJA 3ZHEB 3Q7FA 2GGFA 2J08A 3FH8A 4J8YA 1HG2A 1YMPA 4I43A 1BD8A 4GTPA 3SFXA 3T8KA 5EN5D 2OEVA 4WWPA 3ZPJA 3CHQA 3SI5A 3LCAA 1UOHA 2LAHA 2WXFA 3J5QB 4UQXA 3MKQA 4TUUA 3V2XA 3ZYLA 4LRZA 4F53A 3UMVA 2IOSA 3APDA 3RO3A 1E7UA 2DYRE 3B7TA 2DZNA 4DK5A 2BTDA 3CVLA 5JHBA 3VTYA 1RW2A 3ASHA 4OAUC 2XGSA 2VSXE 5EIBE 2EILE 3LYAA 4N3AA 4ANVA 3FEXA 4EPZA 1FT2A 2VGYA 2R02A 3EHRA 4ANXA 3QARA 5KJMA 3R9AB 4LERA 4GYYA 3VLEA 3U66A 4CT4A 4K5AB 1UW4B 5FZSA 3TWSA 4CDRA 4FHJA 1LD8A 2CG3A 5T3RA 3UTMA 3FUFA 3UUXA 3FUIA 4BFRA 5CRVA 3IEGA 4QFVA 4YVQC 3TAXA 4PS8A 4O1PA 4UWGA 1IKND 2WVIA 3PS6A 3ZRHA 5JJ7A 5FZQA 2AJAA 2LXMA 2H6HA 1YYHA 3UIOC 3LXUX 3Q5MA 3OAWA 3DEOA 4JZYA 4HOUA 5HKPA 5BXUA 1E8XA 4KXKB 3E32A 3KEZA 4J8SA 2J4DA 3EU5A 4B8AA 2V5QC 3S7BA 4FJZA 3KS2A 2RG8A 4TV3A 2V4HC 4I6EA 4EZJA 3CHSA 4F1PA 1MHQA 3FUNA 3HIZA 4HS2A 2DVWA 3D9HA 3SFYA 1DCEA 3FEYA 3FTWA 3MV3B 5KNGA 4C0EA 1N9AA 1OT8A 2J49A 2Y3AA 1H6KA 3PRZA 1BPOA 3JQ1A 4MKTA 3T8MA 2ZIRA 4JXTA 2J07A 2FBNA 1N54A 1OWMA 5KCMA 3D3MA 3QB2A 2F37A 3UI2A 2WXRA 2X6IA 4YVOA 1N11A 4N2SA 4TXRA 2ONDA 1JWFA 2BUGA 1YA0A 3C3RA 3EU9A 3B13A 5ENQD 2VSOE 3SHFA 2PZIA 2EQXA 1U3DA 3ML8A 4RVBA 1NA0A 5ENRD 3G2VA 1QNFA 5CECB 3CLJA 4MBGA 3KSLA 3CVVA 1EF1C 3AG2E 4NRHB 4ATZD 2KZTA 3G2UA 5JA4D 1LD7A 3T9KA 4U8VD 4DX1A 4J6IA 4YDWA 3KEAA 1Z3YA 4LUNU 4N5CA 4GTMA 4FA6A 3OXLA 1O1RA 3B7RL 3D9JA 3L22A 3NOGD 4AVXA 1FVFA 2MHKA 3AU4A 4DJAA 1IQUA 1H6PA 3EIJA 3L16A 2IFUA 3HVEB 2I1JA 1D8EA 1H2VC 4WUYA 4XI0A 3TWVA 3FFLA 1WM5A 3FUJA 5BW8C 1XGWA 2X38A 3AS4A 1LTXA 4ZHBA 5AYWD 5CERB 3Q9UC 3L08A 2LNIA 5E75A 5J90A 2IOLA 1DVPA 3Q75A 2HO1A 4GZ5A 2B6CA 2XQ0A 4L1BA 1SQMA 4DUIA 3BG1B 3J5PA 4XKCA 1HXIA 3QAQA 2IU1A 1HS6A 4GA0A 3V30A 2LAIA 1ZBPA 4AXHA 3R7QA 3CQCB 1OCCE 4C0MA 4OYSA 5JHAA 3PUKA 3MA5A 1NL4A 4LSZE 1TEZA 2ETBA 3UM2A 2J9QA 1QYMA 5D66A 3CK9A 3PUJA 3SD5A 4AOFA 4JB8P 4F1SA 4HLLA 2MRIA 1OUVA 4O60A 1TNUA 3L54A 3PEUB 2HM8A 4ANWA 2KM4A 4TRQA 2IF4A 4M7CA 1OCOE 3PNTB 1KPSB 3QJZA 3W9GA 5BUZA 2WXHA 4G26A 1NFIE 5AJLA 5ENPD 2VGEA 4ME2A 1TYQG 4FJYA 4XEIG 3VLFA 4A3TA 1ELWA 2VTBA 3RRMB 2WXNA 3T5XA 3MGBA 4YDOA 2MOWA 1MZCA 2NYJA 2RD0A 3LVQE 3SQVA 2J8SD 2WQ7A 2P58C 3PE4A 3SZ7A 1ZB1A 4XI9A 1P5QA 2PM6A 5FQ6A 3NZUA 4BT8A 4NIKA 5CBNA 3B7UX 3CHOA 4DI3A 2GRRB 2WM9A 3IKOB 1D9SA 4UWKA 3AG1E 3QKYA 4PDXA 2I2OA 1MQSA 3FWVA 3UKUG 4H7YA 5C1DA 2HR2A 4C9BB 1B89A 4FLHA 3IXEA 4LNUD 2QZAA 2BKGA 1V55E 3SFZA 3PEVB 4UI9K 5CMYA 4B8CB 1WDYA 1X5BA 1JPLA 5B1AE 1EYHA 4AJWA 2AXZA 1E90A 1VDYA 3SF4A 3Q9NC 4DX7D 1FVHA 4ILIA 3FY4A 1BU9A 3PZ3A 3S7JA 4GZ6A 2V8SE 1HO8A 4LEUA 4L2LA 3I4GA 2JLBA 3ZXPA 3KAEA 1N52A 4J8DA 4U96D 4ATGA 1S0PA 1JUQA 4BESA 5HI7A 5AQBA 3HDXA 5D2MC 2EIKE 3GZ2A 3DPDA 1S70B 5ANLA 5EYLA 4PS7A 3UX4A 4UI9J 4ZFHA 5ENSD 4UI9C 1TNYA 3GYZA 1A5EA 3CVPA 1O5MA 2LSVA 4IULA 3FDHA 5G04J 3DPYA 1HF8A 3ZIMA 4BSXA 1IHBA 5G04C 1N94A 5JJTA 4EZKA 3DSXA 2V5FA 3MV2B 1NI1A 4ANUA 4HRLA 1HE8A 5AN8A 5FWQA 4UWFA 1HX8A 4FADA 2R2LA 5CRUA 3S7FA 3Q49B 3G2TA 3TWQA 2P2CP 2Y0BG 3SGHA 4GA1A 4U04A 4YNDA 4RG6A 4A3VA 2OCCE 3LPZA 3WG7E 5EX0A 1XNFA 2DZOA 3U3WA 1N4RA 2LO6A 4JPSA 1K1AA 2VGXA 3V2OA 2V4LA 4HFGA 5HRYA 3D9PA 2RKKA 3NOCD 3QDNA 5ANRA 3D9MA 3ZYKA 3EHNA 3ZHEA 5A6CA 1KZOA 1PY1A 2P9IG 4BWRA 2YQ8A 1HZ4A 1SZ9A 1UG3A 2VJ8A 4G25A 3DEPA 3E37A 2L6JA 5D0QD 5BXOA 2NXPA 4I6GA 1UN8A 4O6FA 4KBQA 4I17A 2VQ2A 1UN9A 4GTSA 2OVFA 4YDYA 3CHRA 2P9SG 3CHPA 3TG5A 3UXGA 3D9LA 3ZUVB 2CG2A 4I6JA 1V54E 1OY3D 5AIJA 1MYOA 2XS8A 4JVSA 2XZTG 5FQ7A 4HOSA 5EYPF 4FULA 1JCQA 3RK6A 4JHJA 4I1OB 3L82A 4GTOA 3W9FA 4CDMA 1NP7A 4JHKA 2KC7A 4GAAA 5ENTD 1E8WA 4AY6A 3ULEG 4F7AA 5FQ8A 3TWWA 3Q78A 4GCNA 3HG0D 2F0YA 4LG6A 4L7TA 3ESKA 4BT9A 3B95A 4L23A 5KJNA 3UKRG 3UM1A 4KVMA 4OAVB 4O1OA 3DSUA 3ONLA 2GRLA 5C2YA 1OCZE 4FU3A 5HQ8A 4I9EA 2NSZA 4GTRA 3IV0A 1ELKA 4HQDA 1SVXA 3E34A 4I9CA 3E4BA 2Q7FA 1JCSA 3NZSA 2I6HA 3D9KA 3CKCA 2R05A 2P9KG 2VSNA 4JL0A 1OWNA 1H2UA 4Q94A 4DX2A 2ZGDA 3S7DA 1NZNA 2KZTB 2E2EA 1QQEA 4U63A 4WWOA 4AEZC 1OWOA 4ACKA 4UQZA 1MX2A 3E33A 1DNPA 4HBDA 1GW6A 2HYZA 4BETA 3D9OA 2XPYA 2FO7A 4BX9A 4U95D 2FULA 3QWVA 5BPPA 3PNLB 5CHEE 2QYJA 1K3ZD 1N4SA 3CVUA 3TXNA 2FI7A 5A7DB 3ZVVA 3ZGQA 4K03A 4JEUA 5FJYA 4HLEA 2WQ6A 3Q47B 4CZ2D 4GTVA 4I1MA 4IYPA 2F8YA 4WAFA 3UPVA 1FT1A 5AAOA 3RKVA 4UUCA 3NB2A 4R7LA 4HOTA 3RIBA 3B7BA 4I2ZA 5LX8A 4A1SA 4UWLA 4M3OA 3UM0A 1JCRA 5DBKA 2WPVA 4XZ4A 3MYVA 1EDUA 2ETAA 3EDTB 4WNGA 3Q4AB 1Z3XA 3FUKA 2RFMA 4E85A 2QY7A 3FTZA 5AARA 4EBAA 4U0UA 1QBQA 3P1UA 3LS8A 1MX6A 4MLPA 3AG4E 1KT1A 4AY5A 1TN6A 2EIJE 2GRPB 3UM3A 3CIAA 3QOUA 4JD2G 3C98A 3HXDA 2IQCA 2XGMA 3HVEA 3RAUA 3ML9A 5JJ6A 2YHCA 3ZKJA 2WXGA 4B93B 5IY5E 1N95A 5T8IA 4WNEA 1TR4A 2ZXWE 3HXCA 4LCTA 2XENA 1JWGA 3R9MA 2PQNA 3PE3A 4L9PA 2CHZA 2OV8A 4HRNA 2OVBA 3ASGA 2X3MA 3GW4A 4FLBA 2X6FA 2C0MA 2XGOA 3SBTB 3PZ1A 4A55A 4NACA 3BUAA 1DCQA 2GRNB 5AQ9A 2B0OE 3ZXSA 2VTBB 5B3SE 2XEHA 2DWZA 2CFUA 1E7VA 2WXPA 1WAO1 3V31A 3K9IA 1TNBA 2WMNA 3ZU7B 1N4QA 2XHEA 4AP2A 5G55A 4WNDA 4FHKA 4BY6A 4N39A 4OVVA 2WXQA 2R03A 4GCOA 4CT0A 2OOEA 3TXMA 2BF0X 3VLDA 1KT0A 1E8YA 5KJLA 4TUMA 3LEWA 4D10C 3ASDA 2V0PA 4EQFA 3BEEA 4WWNA 4AM9A 4J7WA 2DIWA 4A1GA 3NAWA 3FTVA 3CVWA 5LCWC 3MX3A 3DSWA 3FULA 1WG0A 1N0RA 4EBAG 5BV1A 3UT7A 3Q7AA 3EIQC 1H0AA 4HVBA 4BSZB 2YNQA 3SO8A 3X2QE 3IBEA 4CEMA 5AENA 3TWRA 3EHQA 3ZFWA 4XKBA 2A4ZA 3DSSA 1W3BA 1E96B 3C3QA 3FH7A 3FP3A 4CRWA 2UY1B 5J08A 2PL2A 2XEVA 2P9NG 3QK0A 3TWXA 1SW6A 3CGHA 3AG3E 3MEKA 1HFAA 2R17C 2KBXA 4MS6A 2WQHA 3ULQA 3DSVA 5ARGA 1WY6A 4GMJA 1EPUA 2DBAA 5CEAA 2EIME 2KCKA 3RRNB 3DXMG 1IQRA 3MCXA 5ENNA 4BEPA 2X6JA 5B1BE 3BU8A 2QFCA 3AJIA 2ETCA 5CMWA 4N2QA 2KATA 4BX8A 2AWIA 3CHMA 4BTAA 4TXPA 4U7EB 3T5VA 5H7PA 3CEQA 3CR3A 1SZAA 5FIOA 2ILRA 3GZ1A 3IHYA 4G11A 1U3CA 3PZDA 3TL5A 3L9TA 5M72A 1TNOA 4YDEA 3CQGB 3JCKC 3L6AA 4QQIA 3ONKA 2AXVA 3O48A 4EHMA 3LY7A 3CK7A 4G8KA 1X81A 1AWCB 1D8DA 3MKQB 3ESLA 3JUEA 2H6FA 3HXEA 5LFAA 3SBSA 3TWTA 2IY0C
chains in the Genus database with same CATH topology
1NFIE 2BKKB 5ENPD 4U8YD 2VGEA 3B7BA 4Z68A 2A5EA 4ZHBA 1N0QA 3HG0D 1DCQA 4K5AB 2F37A 4LG6A 3UI2A 1IXVA 4K5CA 1MX4A 5CERB 5ENOD 4U96D 1N11A 3Q9UC 3AAAC 5EILA 3ZNGA 1YCSB 2RFAA 5AQ9A 2B0OE 3B95A 3TWSA 2XEHA 3EU9A 4BESA 5AQBA 5FINA 2ETAA 3JXIA 5ENQD 3TWXA 2DWZA 4OAVB 1SW6A 3UTMA 1S70B 4O1OA 5EYLA 2PNNA 5HS0A 3V31A 4DUIA 4ZFHA 2RFMA 2MYOA 3ZU7B 2NYJA 4QFVA 3J5PA 5ENSD 3DEPA 2JABA 1BI7B 2J8SD 2KXPC 2QC9A 4HRMB 4O1PA 1IKND 5AARA 5ITZF 2KBXA 1A5EA 2XEEA 4HQDA 4HI8A 5BXOA 5ENRD 1SVXA 2AJAA 4GMRA 5CECB 5AQ7A 1YYHA 3V30A 4K5BA 5CBOA 3JXJA 4N5QA 5CEAA 3DEOA 1MX6A 4NIKA 1IHBA 4BERA 5HKPA 5BXUA 5CBNA 4J8YA 4ATZD 5JA4D 1BLXB 4BEPA 4DX2A 1YMPA 1BD8A 2ZGDA 4DX5D 4YDYA 5KWDA 3AJIA 1G3NB 1D9SA 3T8KA 4RLYA 2ETCA 3T9KA 5EN5D 4DRXE 4DX6D 2V5QC 4LSZE 3NBNB 2XZDG 4GPMA 2ZGGA 4TUMA 4HRLA 3UXGA 2V4HC 5AN8A 2L6BA 4U8VD 4DX1A 3C5RA 2ETBA 3ZUVB 5AQAA 4YDWA 3IXEA 4LNUD 2BKGA 3KEAA 4CYMD 1UOHA 1MX2A 3J5QB 4HB5A 2HE0A 4J7WA 3V79K 3V2XA 3TWQA 4F1PA 1OY3D 2P2CP 5FIOA 3ZKJA 4HBDA 4B93B 1MYOA 2Y0BG 2DVWA 1QYMA 5EIDA 5D66A 4BETA 1TR4A 1K1BA 1BI8B 2XZTG 2DZNA 5JMND 3D9HA 1WDYA 2XENA 4A63B 4U95D 1WG0A 3TWUA 4C48B 1N0RA 2QYJA 1K3ZD 3F6QA 4JB8P 5EYPF 2Y1LE 3NOGD 4OAUC 5KNGA 2FO1E 4HLLA 5EIBE 1OT8A 1DC2A 3HRAA 2DZOA 3W9FA 4HI9A 4O60A 3Q9NC 4QQIA 4G8LA 4DX7D 4CZ2D 4BSZB 2F8YA 1K1AA 4G8KA 4HNAD 5KBAA 1AWCB 3EHRA 5ENTD 3V2OA 4HRNA 3SO8A 1BU9A 3JUEA 5CEDB 4F6RD 3W9GA 1MJ0A 5HRYA 5AAOA 2F8XK 3LJNA 3TWVA 4UUCA 3TWTA 3NOCD 1AP7A 3TWRA 3EHQA 5KNHD 3TWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFI E;  2BKK B;  5ENP D;  4U8Y D;  2VGE A;  3B7B A;  4Z68 A;  2A5E A;  4ZHB A;  1N0Q A;  3HG0 D;  1DCQ A;  4K5A B;  2F37 A;  4LG6 A;  3UI2 A;  1IXV A;  4K5C A;  1MX4 A;  5CER B;  5ENO D;  4U96 D;  1N11 A;  3Q9U C;  3AAA C;  5EIL A;  3ZNG A;  1YCS B;  2RFA A;  5AQ9 A;  2B0O E;  3B95 A;  3TWS A;  2XEH A;  3EU9 A;  4BES A;  5AQB A;  5FIN A;  2ETA A;  3JXI A;  5ENQ D;  3TWX A;  2DWZ A;  4OAV B;  1SW6 A;  3UTM A;  1S70 B;  4O1O A;  5EYL A;  2PNN A;  5HS0 A;  3V31 A;  4DUI A;  4ZFH A;  2RFM A;  2MYO A;  3ZU7 B;  2NYJ A;  4QFV A;  3J5P A;  5ENS D;  3DEP A;  2JAB A;  1BI7 B;  2J8S D;  2KXP C;  2QC9 A;  4HRM B;  4O1P A;  1IKN D;  5AAR A;  5ITZ F;  2KBX A;  1A5E A;  2XEE A;  4HQD A;  4HI8 A;  5BXO A;  5ENR D;  1SVX A;  2AJA A;  4GMR A;  5CEC B;  5AQ7 A;  1YYH A;  3V30 A;  4K5B A;  5CBO A;  3JXJ A;  4N5Q A;  5CEA A;  3DEO A;  1MX6 A;  4NIK A;  1IHB A;  4BER A;  5HKP A;  5BXU A;  5CBN A;  4J8Y A;  4ATZ D;  5JA4 D;  1BLX B;  4BEP A;  4DX2 A;  1YMP A;  1BD8 A;  2ZGD A;  4DX5 D;  4YDY A;  5KWD A;  3AJI A;  1G3N B;  1D9S A;  3T8K A;  4RLY A;  2ETC A;  3T9K A;  5EN5 D;  4DRX E;  4DX6 D;  2V5Q C;  4LSZ E;  3NBN B;  2XZD G;  4GPM A;  2ZGG A;  4TUM A;  4HRL A;  3UXG A;  2V4H C;  5AN8 A;  2L6B A;  4U8V D;  4DX1 A;  3C5R A;  2ETB A;  3ZUV B;  5AQA A;  4YDW A;  3IXE A;  4LNU D;  2BKG A;  3KEA A;  4CYM D;  1UOH A;  1MX2 A;  3J5Q B;  4HB5 A;  2HE0 A;  4J7W A;  3V79 K;  3V2X A;  3TWQ A;  4F1P A;  1OY3 D;  2P2C P;  5FIO A;  3ZKJ A;  4HBD A;  4B93 B;  1MYO A;  2Y0B G;  2DVW A;  1QYM A;  5EID A;  5D66 A;  4BET A;  1TR4 A;  1K1B A;  1BI8 B;  2XZT G;  2DZN A;  5JMN D;  3D9H A;  1WDY A;  2XEN A;  4A63 B;  4U95 D;  1WG0 A;  3TWU A;  4C48 B;  1N0R A;  2QYJ A;  1K3Z D;  3F6Q A;  4JB8 P;  5EYP F;  2Y1L E;  3NOG D;  4OAU C;  5KNG A;  2FO1 E;  4HLL A;  5EIB E;  1OT8 A;  1DC2 A;  3HRA A;  2DZO A;  3W9F A;  4HI9 A;  4O60 A;  3Q9N C;  4QQI A;  4G8L A;  4DX7 D;  4CZ2 D;  4BSZ B;  2F8Y A;  1K1A A;  4G8K A;  4HNA D;  5KBA A;  1AWC B;  3EHR A;  5ENT D;  3V2O A;  4HRN A;  3SO8 A;  1BU9 A;  3JUE A;  5CED B;  4F6R D;  3W9G A;  1MJ0 A;  5HRY A;  5AAO A;  2F8X K;  3LJN A;  3TWV A;  4UUC A;  3TWT A;  3NOC D;  1AP7 A;  3TWR A;  3EHQ A;  5KNH D;  3TWW A; 
#chains in the Genus database with same CATH topology
 3C72 A;  1ZU2 A;  2WXM A;  4Z68 A;  4KT6 B;  3HXF A;  1O1S A;  5ENO D;  5EIL A;  4ILH B;  4B94 A;  3E30 A;  3CVX A;  2P9U G;  2PNN A;  4GZ3 A;  2MYO A;  1TJC A;  1TJF A;  4AV7 A;  4GMR A;  1TN8 A;  2ION A;  4K5B A;  2KCV A;  1OCR E;  4N5Q A;  4V3I A;  3ABM E;  1PC2 A;  2Y69 E;  3RJV A;  2IO2 C;  3AS8 A;  3QWW A;  2M63 A;  1G3N B;  2XCC A;  4KZ0 A;  4AIF A;  2WXL A;  4CDN A;  2UWJ G;  3HYM B;  2XZD G;  3UIP C;  1H19 A;  2E0I A;  2XS1 A;  1E8Z A;  1FCH A;  2HE0 A;  3LJ3 A;  5EX3 A;  5CCL A;  2WXJ A;  4UQY A;  1IYG A;  3CST A;  2H6G A;  3EUV A;  4C48 B;  4GML A;  4G23 A;  2PM7 A;  3CVQ A;  2FO1 E;  3PRE A;  4U0Z A;  3DBS A;  3TGO A;  5FTP A;  3CK8 A;  1Q2Z A;  3BQO A;  4HNA D;  4F6R D;  2F8X K;  3LJN A;  4PH4 B;  5KNH D;  2P9P G;  2AVP A;  4APF A;  4U8Y D;  2CFZ A;  4GPK A;  3ENE A;  3ASN E;  1SA4 A;  1IXV A;  4K5C A;  3S2A A;  3DST A;  4RG9 A;  1YCS B;  1U2V G;  2RFA A;  4GZC A;  4GYO A;  4OVU A;  5FIN A;  1LF8 A;  3PDN A;  4DPR A;  5BNW A;  3ZN3 A;  3FU6 A;  3UQ3 A;  3CVN A;  1QZ2 A;  3CVY A;  4N3B A;  5FQ4 A;  2XPI A;  3DWL G;  4EEC A;  4FC8 A;  4L2Y A;  2EIN E;  4DRX E;  4PUC A;  3OXF A;  4Y6W A;  1RZ4 A;  3GZS A;  3MZL B;  2WXI A;  5AQA A;  3G2W A;  4U0S A;  2FF4 A;  2GW1 A;  4NQ0 A;  3V79 K;  2PQR A;  4Q69 A;  3KSQ A;  2YHE A;  5EID A;  3ABL E;  4JW1 A;  5FZR A;  4GYW A;  2A5U A;  3QNK A;  3ASF A;  1DC2 A;  4APO A;  3EHM A;  3RSE G;  1L5J A;  4KVO A;  5LP0 A;  5KBA A;  2KCL A;  5CED B;  5A23 A;  5ARF A;  4P29 A;  4ILG A;  1Y8M A;  2LSU A;  1HH8 A;  2P9L G;  4JEH A;  2A5E A;  4J8F A;  3IHV A;  3JQ0 A;  3NQP A;  2VYI A;  5G05 J;  3PZ2 A;  4U8H A;  1O1T A;  4GU5 A;  5G05 C;  2Y4U A;  1NA3 A;  3LVR E;  3RO2 A;  4ABN A;  2YIN A;  3AS5 A;  2ZIS A;  1SA5 A;  3WXX A;  3CV0 A;  4TXQ A;  3P2B A;  3FUH A;  1ELR A;  3C3O A;  4DLO A;  3ABK E;  3QWP A;  3CSF A;  1TNZ A;  1S63 A;  3FU0 A;  1N4P A;  3APC A;  2GRO B;  2IJG X;  4KZC A;  3KD7 A;  3LY9 A;  2WXK A;  3HHM A;  2LXL A;  4HXI A;  2IO3 C;  3FU5 A;  4IN3 B;  3UT4 A;  3OXG A;  1HG5 A;  4CYM D;  1K8K G;  5BT1 A;  4RSY A;  3QC1 A;  5G2N A;  4HOR A;  1BI8 B;  3Q73 A;  4A63 B;  4GA2 A;  3U9W A;  4XIF A;  4MRU A;  2Y1L E;  3G2S A;  3JUI A;  3NF1 A;  4GTQ A;  4URK A;  3URZ A;  3PVL A;  4GB9 A;  1A17 A;  3I4R B;  3OTN A;  5AJD A;  3Q79 A;  2H6I A;  4G24 A;  2Y4T A;  4Y6C A;  3RU0 A;  2BKK B;  3FTX A;  4N3C A;  4CCA A;  3O4Z A;  1KZP A;  3AAA C;  1HU3 A;  3JXI A;  4BTB A;  5EDS A;  4G1T A;  2JAB A;  1BI7 B;  2JEK A;  4KMO A;  4JA7 A;  2QC9 A;  4HRM B;  5ITZ F;  5AQ7 A;  2R5S A;  1Z5S C;  2J09 A;  2ZU6 B;  3L13 A;  4PS3 A;  4BER A;  4I1A A;  4I2W A;  4DX5 D;  5KWD A;  4RLY A;  4J8E A;  1INZ A;  3NBN B;  2XRY A;  4GPM A;  2ZGG A;  3ISM C;  4B89 A;  2WB2 A;  3C5R A;  3UIN C;  4B0Z A;  4LNB A;  3Q15 A;  5DIZ A;  4HB5 A;  4GZD A;  3TG4 A;  3D9I A;  3PH0 C;  1Z6T A;  3HXB A;  3SY2 A;  1K1B A;  2I1K A;  4HOQ A;  5FT9 A;  3ZYM A;  3DRA A;  2BED A;  1UJK A;  2AW6 A;  3FTY A;  2VSY A;  2L0T B;  4G8L A;  4RQI A;  4K0R A;  2XRZ A;  4EZL A;  1UJJ A;  4DI4 A;  5LCW J;  3U64 A;  3MKR A;  1IHG A;  2DYS E;  3L17 A;  2DCP A;  4XE0 A;  5CCM A;  2XCB A;  1KLX A;  4G2V A;  3FUD A;  3D9N A;  3CKB A;  1N0Q A;  2I9C A;  3I3N A;  5EKQ D;  1MX4 A;  4NUR A;  3LKU A;  4KYO B;  3I5P A;  3N71 A;  2L9B A;  3APF A;  2CHX A;  1Y6I A;  4CGV A;  3VTX A;  3FTS A;  4F3V A;  3SNX A;  3B7S A;  5HS0 A;  2GRQ B;  3FHE A;  2C0L A;  2QYU A;  5T4Y A;  4ACL A;  2C2L A;  4GTT A;  3MJW A;  3FTU A;  2X6H A;  2X6K A;  3AU5 A;  3LDZ A;  5KJK A;  4JA9 A;  4E6H A;  1BLX B;  3TJP A;  2IEJ A;  2OEW A;  4DX6 D;  1H2T C;  4IRU A;  1H6O A;  2R59 A;  2L6B A;  3FUE A;  4JHR A;  3FU3 A;  3ASO E;  2FEZ A;  3ZYQ A;  2CHW A;  2XPZ A;  3ULY A;  3DXK G;  3PZ4 A;  4LNG A;  1FPP A;  5JMN D;  3TWU A;  3F6Q A;  4JC8 A;  4CGW A;  2UY1 A;  5D0O D;  3UT8 A;  3ZW3 A;  3HRA A;  4HI9 A;  1OWP A;  5BV0 A;  1OWL A;  4UWH A;  3R7R A;  3EJN A;  1OXJ A;  1MJ0 A;  3BG0 B;  1AP7 A;  2WMO A;  4DLQ A;  2L0I A;  4Q96 A;  2LUH A;  3FH5 A;  2NC9 A;  3ZNG A;  4H7X A;  4WNF A;  3U4T A;  3LY8 A;  4J0U A;  4W9R A;  5E76 A;  1S64 A;  4FP7 A;  2WXO A;  2GRM A;  2VGX B;  1PAQ A;  4XX5 A;  3FUM A;  5LOZ A;  2KXP C;  1TN7 A;  2AXU A;  2XEE A;  4HI8 A;  4X8Q A;  2J4B A;  4U07 A;  3ZEF A;  3RRU A;  3JYS A;  5CBO A;  3JXJ A;  3ZHE B;  3Q7F A;  2GGF A;  2J08 A;  3FH8 A;  4J8Y A;  1HG2 A;  1YMP A;  4I43 A;  1BD8 A;  4GTP A;  3SFX A;  3T8K A;  5EN5 D;  2OEV A;  4WWP A;  3ZPJ A;  3CHQ A;  3SI5 A;  3LCA A;  1UOH A;  2LAH A;  2WXF A;  3J5Q B;  4UQX A;  3MKQ A;  4TUU A;  3V2X A;  3ZYL A;  4LRZ A;  4F53 A;  3UMV A;  2IOS A;  3APD A;  3RO3 A;  1E7U A;  2DYR E;  3B7T A;  2DZN A;  4DK5 A;  2BTD A;  3CVL A;  5JHB A;  3VTY A;  1RW2 A;  3ASH A;  4OAU C;  2XGS A;  2VSX E;  5EIB E;  2EIL E;  3LYA A;  4N3A A;  4ANV A;  3FEX A;  4EPZ A;  1FT2 A;  2VGY A;  2R02 A;  3EHR A;  4ANX A;  3QAR A;  5KJM A;  3R9A B;  4LER A;  4GYY A;  3VLE A;  3U66 A;  4CT4 A;  4K5A B;  1UW4 B;  5FZS A;  3TWS A;  4CDR A;  4FHJ A;  1LD8 A;  2CG3 A;  5T3R A;  3UTM A;  3FUF A;  3UUX A;  3FUI A;  4BFR A;  5CRV A;  3IEG A;  4QFV A;  4YVQ C;  3TAX A;  4PS8 A;  4O1P A;  4UWG A;  1IKN D;  2WVI A;  3PS6 A;  3ZRH A;  5JJ7 A;  5FZQ A;  2AJA A;  2LXM A;  2H6H A;  1YYH A;  3UIO C;  3LXU X;  3Q5M A;  3OAW A;  3DEO A;  4JZY A;  4HOU A;  5HKP A;  5BXU A;  1E8X A;  4KXK B;  3E32 A;  3KEZ A;  4J8S A;  2J4D A;  3EU5 A;  4B8A A;  2V5Q C;  3S7B A;  4FJZ A;  3KS2 A;  2RG8 A;  4TV3 A;  2V4H C;  4I6E A;  4EZJ A;  3CHS A;  4F1P A;  1MHQ A;  3FUN A;  3HIZ A;  4HS2 A;  2DVW A;  3D9H A;  3SFY A;  1DCE A;  3FEY A;  3FTW A;  3MV3 B;  5KNG A;  4C0E A;  1N9A A;  1OT8 A;  2J49 A;  2Y3A A;  1H6K A;  3PRZ A;  1BPO A;  3JQ1 A;  4MKT A;  3T8M A;  2ZIR A;  4JXT A;  2J07 A;  2FBN A;  1N54 A;  1OWM A;  5KCM A;  3D3M A;  3QB2 A;  2F37 A;  3UI2 A;  2WXR A;  2X6I A;  4YVO A;  1N11 A;  4N2S A;  4TXR A;  2OND A;  1JWF A;  2BUG A;  1YA0 A;  3C3R A;  3EU9 A;  3B13 A;  5ENQ D;  2VSO E;  3SHF A;  2PZI A;  2EQX A;  1U3D A;  3ML8 A;  4RVB A;  1NA0 A;  5ENR D;  3G2V A;  1QNF A;  5CEC B;  3CLJ A;  4MBG A;  3KSL A;  3CVV A;  1EF1 C;  3AG2 E;  4NRH B;  4ATZ D;  2KZT A;  3G2U A;  5JA4 D;  1LD7 A;  3T9K A;  4U8V D;  4DX1 A;  4J6I A;  4YDW A;  3KEA A;  1Z3Y A;  4LUN U;  4N5C A;  4GTM A;  4FA6 A;  3OXL A;  1O1R A;  3B7R L;  3D9J A;  3L22 A;  3NOG D;  4AVX A;  1FVF A;  2MHK A;  3AU4 A;  4DJA A;  1IQU A;  1H6P A;  3EIJ A;  3L16 A;  2IFU A;  3HVE B;  2I1J A;  1D8E A;  1H2V C;  4WUY A;  4XI0 A;  3TWV A;  3FFL A;  1WM5 A;  3FUJ A;  5BW8 C;  1XGW A;  2X38 A;  3AS4 A;  1LTX A;  4ZHB A;  5AYW D;  5CER B;  3Q9U C;  3L08 A;  2LNI A;  5E75 A;  5J90 A;  2IOL A;  1DVP A;  3Q75 A;  2HO1 A;  4GZ5 A;  2B6C A;  2XQ0 A;  4L1B A;  1SQM A;  4DUI A;  3BG1 B;  3J5P A;  4XKC A;  1HXI A;  3QAQ A;  2IU1 A;  1HS6 A;  4GA0 A;  3V30 A;  2LAI A;  1ZBP A;  4AXH A;  3R7Q A;  3CQC B;  1OCC E;  4C0M A;  4OYS A;  5JHA A;  3PUK A;  3MA5 A;  1NL4 A;  4LSZ E;  1TEZ A;  2ETB A;  3UM2 A;  2J9Q A;  1QYM A;  5D66 A;  3CK9 A;  3PUJ A;  3SD5 A;  4AOF A;  4JB8 P;  4F1S A;  4HLL A;  2MRI A;  1OUV A;  4O60 A;  1TNU A;  3L54 A;  3PEU B;  2HM8 A;  4ANW A;  2KM4 A;  4TRQ A;  2IF4 A;  4M7C A;  1OCO E;  3PNT B;  1KPS B;  3QJZ A;  3W9G A;  5BUZ A;  2WXH A;  4G26 A;  1NFI E;  5AJL A;  5ENP D;  2VGE A;  4ME2 A;  1TYQ G;  4FJY A;  4XEI G;  3VLF A;  4A3T A;  1ELW A;  2VTB A;  3RRM B;  2WXN A;  3T5X A;  3MGB A;  4YDO A;  2MOW A;  1MZC A;  2NYJ A;  2RD0 A;  3LVQ E;  3SQV A;  2J8S D;  2WQ7 A;  2P58 C;  3PE4 A;  3SZ7 A;  1ZB1 A;  4XI9 A;  1P5Q A;  2PM6 A;  5FQ6 A;  3NZU A;  4BT8 A;  4NIK A;  5CBN A;  3B7U X;  3CHO A;  4DI3 A;  2GRR B;  2WM9 A;  3IKO B;  1D9S A;  4UWK A;  3AG1 E;  3QKY A;  4PDX A;  2I2O A;  1MQS A;  3FWV A;  3UKU G;  4H7Y A;  5C1D A;  2HR2 A;  4C9B B;  1B89 A;  4FLH A;  3IXE A;  4LNU D;  2QZA A;  2BKG A;  1V55 E;  3SFZ A;  3PEV B;  4UI9 K;  5CMY A;  4B8C B;  1WDY A;  1X5B A;  1JPL A;  5B1A E;  1EYH A;  4AJW A;  2AXZ A;  1E90 A;  1VDY A;  3SF4 A;  3Q9N C;  4DX7 D;  1FVH A;  4ILI A;  3FY4 A;  1BU9 A;  3PZ3 A;  3S7J A;  4GZ6 A;  2V8S E;  1HO8 A;  4LEU A;  4L2L A;  3I4G A;  2JLB A;  3ZXP A;  3KAE A;  1N52 A;  4J8D A;  4U96 D;  4ATG A;  1S0P A;  1JUQ A;  4BES A;  5HI7 A;  5AQB A;  3HDX A;  5D2M C;  2EIK E;  3GZ2 A;  3DPD A;  1S70 B;  5ANL A;  5EYL A;  4PS7 A;  3UX4 A;  4UI9 J;  4ZFH A;  5ENS D;  4UI9 C;  1TNY A;  3GYZ A;  1A5E A;  3CVP A;  1O5M A;  2LSV A;  4IUL A;  3FDH A;  5G04 J;  3DPY A;  1HF8 A;  3ZIM A;  4BSX A;  1IHB A;  5G04 C;  1N94 A;  5JJT A;  4EZK A;  3DSX A;  2V5F A;  3MV2 B;  1NI1 A;  4ANU A;  4HRL A;  1HE8 A;  5AN8 A;  5FWQ A;  4UWF A;  1HX8 A;  4FAD A;  2R2L A;  5CRU A;  3S7F A;  3Q49 B;  3G2T A;  3TWQ A;  2P2C P;  2Y0B G;  3SGH A;  4GA1 A;  4U04 A;  4YND A;  4RG6 A;  4A3V A;  2OCC E;  3LPZ A;  3WG7 E;  5EX0 A;  1XNF A;  2DZO A;  3U3W A;  1N4R A;  2LO6 A;  4JPS A;  1K1A A;  2VGX A;  3V2O A;  2V4L A;  4HFG A;  5HRY A;  3D9P A;  2RKK A;  3NOC D;  3QDN A;  5ANR A;  3D9M A;  3ZYK A;  3EHN A;  3ZHE A;  5A6C A;  1KZO A;  1PY1 A;  2P9I G;  4BWR A;  2YQ8 A;  1HZ4 A;  1SZ9 A;  1UG3 A;  2VJ8 A;  4G25 A;  3DEP A;  3E37 A;  2L6J A;  5D0Q D;  5BXO A;  2NXP A;  4I6G A;  1UN8 A;  4O6F A;  4KBQ A;  4I17 A;  2VQ2 A;  1UN9 A;  4GTS A;  2OVF A;  4YDY A;  3CHR A;  2P9S G;  3CHP A;  3TG5 A;  3UXG A;  3D9L A;  3ZUV B;  2CG2 A;  4I6J A;  1V54 E;  1OY3 D;  5AIJ A;  1MYO A;  2XS8 A;  4JVS A;  2XZT G;  5FQ7 A;  4HOS A;  5EYP F;  4FUL A;  1JCQ A;  3RK6 A;  4JHJ A;  4I1O B;  3L82 A;  4GTO A;  3W9F A;  4CDM A;  1NP7 A;  4JHK A;  2KC7 A;  4GAA A;  5ENT D;  1E8W A;  4AY6 A;  3ULE G;  4F7A A;  5FQ8 A;  3TWW A;  3Q78 A;  4GCN A;  3HG0 D;  2F0Y A;  4LG6 A;  4L7T A;  3ESK A;  4BT9 A;  3B95 A;  4L23 A;  5KJN A;  3UKR G;  3UM1 A;  4KVM A;  4OAV B;  4O1O A;  3DSU A;  3ONL A;  2GRL A;  5C2Y A;  1OCZ E;  4FU3 A;  5HQ8 A;  4I9E A;  2NSZ A;  4GTR A;  3IV0 A;  1ELK A;  4HQD A;  1SVX A;  3E34 A;  4I9C A;  3E4B A;  2Q7F A;  1JCS A;  3NZS A;  2I6H A;  3D9K A;  3CKC A;  2R05 A;  2P9K G;  2VSN A;  4JL0 A;  1OWN A;  1H2U A;  4Q94 A;  4DX2 A;  2ZGD A;  3S7D A;  1NZN A;  2KZT B;  2E2E A;  1QQE A;  4U63 A;  4WWO A;  4AEZ C;  1OWO A;  4ACK A;  4UQZ A;  1MX2 A;  3E33 A;  1DNP A;  4HBD A;  1GW6 A;  2HYZ A;  4BET A;  3D9O A;  2XPY A;  2FO7 A;  4BX9 A;  4U95 D;  2FUL A;  3QWV A;  5BPP A;  3PNL B;  5CHE E;  2QYJ A;  1K3Z D;  1N4S A;  3CVU A;  3TXN A;  2FI7 A;  5A7D B;  3ZVV A;  3ZGQ A;  4K03 A;  4JEU A;  5FJY A;  4HLE A;  2WQ6 A;  3Q47 B;  4CZ2 D;  4GTV A;  4I1M A;  4IYP A;  2F8Y A;  4WAF A;  3UPV A;  1FT1 A;  5AAO A;  3RKV A;  4UUC A;  3NB2 A;  4R7L A;  4HOT A;  3RIB A;  3B7B A;  4I2Z A;  5LX8 A;  4A1S A;  4UWL A;  4M3O A;  3UM0 A;  1JCR A;  5DBK A;  2WPV A;  4XZ4 A;  3MYV A;  1EDU A;  2ETA A;  3EDT B;  4WNG A;  3Q4A B;  1Z3X A;  3FUK A;  2RFM A;  4E85 A;  2QY7 A;  3FTZ A;  5AAR A;  4EBA A;  4U0U A;  1QBQ A;  3P1U A;  3LS8 A;  1MX6 A;  4MLP A;  3AG4 E;  1KT1 A;  4AY5 A;  1TN6 A;  2EIJ E;  2GRP B;  3UM3 A;  3CIA A;  3QOU A;  4JD2 G;  3C98 A;  3HXD A;  2IQC A;  2XGM A;  3HVE A;  3RAU A;  3ML9 A;  5JJ6 A;  2YHC A;  3ZKJ A;  2WXG A;  4B93 B;  5IY5 E;  1N95 A;  5T8I A;  4WNE A;  1TR4 A;  2ZXW E;  3HXC A;  4LCT A;  2XEN A;  1JWG A;  3R9M A;  2PQN A;  3PE3 A;  4L9P A;  2CHZ A;  2OV8 A;  4HRN A;  2OVB A;  3ASG A;  2X3M A;  3GW4 A;  4FLB A;  2X6F A;  2C0M A;  2XGO A;  3SBT B;  3PZ1 A;  4A55 A;  4NAC A;  3BUA A;  1DCQ A;  2GRN B;  5AQ9 A;  2B0O E;  3ZXS A;  2VTB B;  5B3S E;  2XEH A;  2DWZ A;  2CFU A;  1E7V A;  2WXP A;  1WAO 1;  3V31 A;  3K9I A;  1TNB A;  2WMN A;  3ZU7 B;  1N4Q A;  2XHE A;  4AP2 A;  5G55 A;  4WND A;  4FHK A;  4BY6 A;  4N39 A;  4OVV A;  2WXQ A;  2R03 A;  4GCO A;  4CT0 A;  2OOE A;  3TXM A;  2BF0 X;  3VLD A;  1KT0 A;  1E8Y A;  5KJL A;  4TUM A;  3LEW A;  4D10 C;  3ASD A;  2V0P A;  4EQF A;  3BEE A;  4WWN A;  4AM9 A;  4J7W A;  2DIW A;  4A1G A;  3NAW A;  3FTV A;  3CVW A;  5LCW C;  3MX3 A;  3DSW A;  3FUL A;  1WG0 A;  1N0R A;  4EBA G;  5BV1 A;  3UT7 A;  3Q7A A;  3EIQ C;  1H0A A;  4HVB A;  4BSZ B;  2YNQ A;  3SO8 A;  3X2Q E;  3IBE A;  4CEM A;  5AEN A;  3TWR A;  3EHQ A;  3ZFW A;  4XKB A;  2A4Z A;  3DSS A;  1W3B A;  1E96 B;  3C3Q A;  3FH7 A;  3FP3 A;  4CRW A;  2UY1 B;  5J08 A;  2PL2 A;  2XEV A;  2P9N G;  3QK0 A;  3TWX A;  1SW6 A;  3CGH A;  3AG3 E;  3MEK A;  1HFA A;  2R17 C;  2KBX A;  4MS6 A;  2WQH A;  3ULQ A;  3DSV A;  5ARG A;  1WY6 A;  4GMJ A;  1EPU A;  2DBA A;  5CEA A;  2EIM E;  2KCK A;  3RRN B;  3DXM G;  1IQR A;  3MCX A;  5ENN A;  4BEP A;  2X6J A;  5B1B E;  3BU8 A;  2QFC A;  3AJI A;  2ETC A;  5CMW A;  4N2Q A;  2KAT A;  4BX8 A;  2AWI A;  3CHM A;  4BTA A;  4TXP A;  4U7E B;  3T5V A;  5H7P A;  3CEQ A;  3CR3 A;  1SZA A;  5FIO A;  2ILR A;  3GZ1 A;  3IHY A;  4G11 A;  1U3C A;  3PZD A;  3TL5 A;  3L9T A;  5M72 A;  1TNO A;  4YDE A;  3CQG B;  3JCK C;  3L6A A;  4QQI A;  3ONK A;  2AXV A;  3O48 A;  4EHM A;  3LY7 A;  3CK7 A;  4G8K A;  1X81 A;  1AWC B;  1D8D A;  3MKQ B;  3ESL A;  3JUE A;  2H6F A;  3HXE A;  5LFA A;  3SBS A;  3TWT A;  2IY0 C; 
#chains in the Genus database with same CATH homology
 1NFI E;  2BKK B;  5ENP D;  4U8Y D;  2VGE A;  3B7B A;  4Z68 A;  2A5E A;  4ZHB A;  1N0Q A;  3HG0 D;  1DCQ A;  4K5A B;  2F37 A;  4LG6 A;  3UI2 A;  1IXV A;  4K5C A;  1MX4 A;  5CER B;  5ENO D;  4U96 D;  1N11 A;  3Q9U C;  3AAA C;  5EIL A;  3ZNG A;  1YCS B;  2RFA A;  5AQ9 A;  2B0O E;  3B95 A;  3TWS A;  2XEH A;  3EU9 A;  4BES A;  5AQB A;  5FIN A;  2ETA A;  3JXI A;  5ENQ D;  3TWX A;  2DWZ A;  4OAV B;  1SW6 A;  3UTM A;  1S70 B;  4O1O A;  5EYL A;  2PNN A;  5HS0 A;  3V31 A;  4DUI A;  4ZFH A;  2RFM A;  2MYO A;  3ZU7 B;  2NYJ A;  4QFV A;  3J5P A;  5ENS D;  3DEP A;  2JAB A;  1BI7 B;  2J8S D;  2KXP C;  2QC9 A;  4HRM B;  4O1P A;  1IKN D;  5AAR A;  5ITZ F;  2KBX A;  1A5E A;  2XEE A;  4HQD A;  4HI8 A;  5BXO A;  5ENR D;  1SVX A;  2AJA A;  4GMR A;  5CEC B;  5AQ7 A;  1YYH A;  3V30 A;  4K5B A;  5CBO A;  3JXJ A;  4N5Q A;  5CEA A;  3DEO A;  1MX6 A;  4NIK A;  1IHB A;  4BER A;  5HKP A;  5BXU A;  5CBN A;  4J8Y A;  4ATZ D;  5JA4 D;  1BLX B;  4BEP A;  4DX2 A;  1YMP A;  1BD8 A;  2ZGD A;  4DX5 D;  4YDY A;  5KWD A;  3AJI A;  1G3N B;  1D9S A;  3T8K A;  4RLY A;  2ETC A;  3T9K A;  5EN5 D;  4DRX E;  4DX6 D;  2V5Q C;  4LSZ E;  3NBN B;  2XZD G;  4GPM A;  2ZGG A;  4TUM A;  4HRL A;  3UXG A;  2V4H C;  5AN8 A;  2L6B A;  4U8V D;  4DX1 A;  3C5R A;  2ETB A;  3ZUV B;  5AQA A;  4YDW A;  3IXE A;  4LNU D;  2BKG A;  3KEA A;  4CYM D;  1UOH A;  1MX2 A;  3J5Q B;  4HB5 A;  2HE0 A;  4J7W A;  3V79 K;  3V2X A;  3TWQ A;  4F1P A;  1OY3 D;  2P2C P;  5FIO A;  3ZKJ A;  4HBD A;  4B93 B;  1MYO A;  2Y0B G;  2DVW A;  1QYM A;  5EID A;  5D66 A;  4BET A;  1TR4 A;  1K1B A;  1BI8 B;  2XZT G;  2DZN A;  5JMN D;  3D9H A;  1WDY A;  2XEN A;  4A63 B;  4U95 D;  1WG0 A;  3TWU A;  4C48 B;  1N0R A;  2QYJ A;  1K3Z D;  3F6Q A;  4JB8 P;  5EYP F;  2Y1L E;  3NOG D;  4OAU C;  5KNG A;  2FO1 E;  4HLL A;  5EIB E;  1OT8 A;  1DC2 A;  3HRA A;  2DZO A;  3W9F A;  4HI9 A;  4O60 A;  3Q9N C;  4QQI A;  4G8L A;  4DX7 D;  4CZ2 D;  4BSZ B;  2F8Y A;  1K1A A;  4G8K A;  4HNA D;  5KBA A;  1AWC B;  3EHR A;  5ENT D;  3V2O A;  4HRN A;  3SO8 A;  1BU9 A;  3JUE A;  5CED B;  4F6R D;  3W9G A;  1MJ0 A;  5HRY A;  5AAO A;  2F8X K;  3LJN A;  3TWV A;  4UUC A;  3TWT A;  3NOC D;  1AP7 A;  3TWR A;  3EHQ A;  5KNH D;  3TWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...