2MYOA

Solution structure of myotrophin, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of ankyrin-like repeat function as revealed by the solution structure of myotrophin.
pubmed doi rcsb
molecule tags Ank-repeat
molecule keywords MYOTROPHIN
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2myoA00
3HRAA 5HKPA 3NBNB 5CECB 3W9FA 4HI8A 1K1AA 3TWUA 3UI2A 1YCSB 5EIDA 1BD8A 2L6BA 5ENSD 4HI9A 3SO8A 4N5QA 4CZ2D 2F8YA 1BI7B 2ZGGA 1WG0A 4HB5A 5ITZF 2V5QC 4HNAD 3IXEA 4OAUC 5KNGA 3HG0D 1IKND 3J5QB 5KWDA 4GMRA 4HQDA 4BEPA 3V2OA 2J8SD 3ZNGA 5EIBE 2ETBA 2F37A 1MX6A 3B7BA 3V31A 3W9GA 1N0QA 1MX4A 2XEEA 3V79K 3EHRA 1UOHA 3UXGA 5BXOA 3TWWA 2BKGA 5CEAA 4O60A 2RFMA 3TWSA 1OT8A 2ETAA 3F6QA 2DZNA 3Q9NC 1SW6A 2A5EA 2HE0A 5CEDB 1D9SA 5EYPF 4YDYA 3C5RA 5AARA 3J5PA 1A5EA 5EYLA 4K5BA 3T9KA 4G8LA 2FO1E 4BERA 4DX2A 1AP7A 3TWXA 4F6RD 5AN8A 4ZHBA 5CERB 3KEAA 3UTMA 3V30A 2P2CP 4UUCA 4F1PA 1OY3D 3T8KA 1SVXA 2B0OE 2BKKB 1BI8B 3Q9UC 1IHBA 4DX6D 5EILA 3EU9A 4U96D 2NYJA 3JXIA 3TWRA 1N0RA 4U8VD 4DUIA 5AAOA 4G8KA 3ZU7B 4ZFHA 3JXJA 5FIOA 4BESA 3D9HA 4YDWA 5AQ7A 2AJAA 5D66A 1MYOA 4HRMB 1K3ZD 4O1PA 5ENPD 1BLXB 4DX5D 3JUEA 5KNHD 2VGEA 1N11A 3TWVA 2DVWA 3LJNA 5ENOD 5HS0A 4JB8P 1AWCB 3TWTA 2Y1LE 3ZUVB 1MJ0A 1QYMA 5CBNA 2JABA 4U95D 4K5CA 4TUMA 1K1BA 3AJIA 3V2XA 5JMND 4HLLA 5BXUA 4K5AB 4DX1A 1DCQA 4NIKA 3NOCD 4ATZD 4Z68A 5ENQD 5AQ9A 4LNUD 1NFIE 1S70B 3NOGD 4BSZB 4CYMD 4QFVA 5AQAA 5FINA 4O1OA 4J8YA 4J7WA 4HRLA 2DWZA 1BU9A 3AAAC 2KXPC 4RLYA 3ZKJA 1G3NB 1YYHA 4U8YD 4LG6A 5AQBA 4HBDA 1IXVA 3DEOA 4GPMA 5ENRD 5JA4D 2XEHA 1YMPA 2ZGDA 2F8XK 4QQIA 5CBOA 2XENA 4DX7D 4C48B 2MYOA 1MX2A 2Y0BG 3TWQA 2QYJA 1WDYA 3DEPA 4B93B 1DC2A 1TR4A 2XZDG 2V4HC 4A63B 2DZOA 2ETCA 2RFAA 3EHQA 4HRNA 5EN5D 5ENTD 2KBXA 3B95A 4BETA 5KBAA 5HRYA 2XZTG 4OAVB 2QC9A 2PNNA 4LSZE 4DRXE
chains in the Genus database with same CATH superfamily
3RRMB 5HKPA 3U66A 2HR2A 3ASGA 2R17C 4OAUC 3L82A 4O6FA 1N54A 2XGOA 1MHQA 3QC1A 3V31A 4AP2A 3Q78A 4ME2A 3F6QA 4UWKA 4IYPA 2LSUA 4PS7A 5CEDB 4AXHA 5AJDA 2V4LA 3QWVA 4F7AA 2XQ0A 4DUIA 5CHEE 4AV7A 4ANWA 1H6OA 4G2VA 3ZEFA 3QJZA 2R05A 2IOSA 3O48A 2Y1LE 5E76A 2R03A 4U95D 2R5SA 3PEUB 4HLLA 1QQEA 4ATZD 4K0RA 4I17A 4WWNA 3CHPA 5BPPA 3BG0B 4ILIA 2WQ7A 3PRZA 1O5MA 4KVOA 3HIZA 1PY1A 4I2WA 3X2QE 1DC2A 3RRUA 3E33A 1OCRE 4GB9A 4A63B 1V55E 3LCAA 4N3AA 3MYVA 4E85A 4BETA 3I5PA 4I6GA 4XEIG 4KBQA 2JEKA 4RG6A 3N71A 4GZDA 5ENSD 2VSYA 2ZGGA 4JZYA 2EINE 4BEPA 1E96B 1KT0A 4JXTA 1MZCA 2OEWA 3PZDA 3CR3A 4RVBA 3V79K 4W9RA 3SD5A 2ETAA 1A17A 1SW6A 2UY1A 3EIJA 5EYPF 3C5RA 1A5EA 5EYLA 2AXVA 2XPZA 4MBGA 3KEAA 1S0PA 4UWLA 1KLXA 4F1PA 3CVVA 2PQNA 2GRRB 1HE8A 5FT9A 4CEMA 3Q73A 4G26A 4BT9A 4UI9C 3QOUA 2XCCA 1FVFA 1X5BA 2I9CA 4WWOA 4B8AA 3GZ2A 3MA5A 1Q2ZA 1JCRA 2X6JA 3BQOA 4FULA 3LJ3A 3IHYA 3CVXA 3C3OA 4UI9K 2KCLA 1HFAA 3CVYA 2AXUA 5AQBA 2IU1A 4G24A 3BG1B 3BEEA 5JJ7A 3CKCA 4DX7D 2X6KA 3FH5A 3ABME 3G2TA 3CVUA 2WM9A 2XGSA 3FUMA 1TN8A 2UWJG 3FTVA 4BTBA 2IQCA 3RKVA 3D9IA 4A3VA 4UWFA 4KMOA 3P2BA 3MKRA 4GYOA 4EHMA 5LP0A 3SFXA 1L5JA 4XKCA 1IQRA 3UUXA 1X81A 3AS5A 3SF4A 3W9GA 1VDYA 3AU5A 1SA5A 3QB2A 1QBQA 1W3BA 4KT6B 4U07A 5ANRA 3HXBA 2IF4A 3T8MA 4KXKB 2Y4UA 5BT1A 3WXXA 1RW2A 3S7JA 3OAWA 2BKKB 1BI8B 3Q9UC 4BY6A 3EU9A 3VTXA 3DXKG 5J90A 2WXLA 3AU4A 3FUHA 3CSFA 1JUQA 3O4ZA 2XRYA 4U8HA 3LJNA 2OEVA 3ZYLA 2J49A 4YVOA 3NOCD 5ENNA 3LY7A 3ZVVA 3D9KA 1LD8A 2WPVA 2WXRA 2WXHA 3CQGB 3NZUA 2XS8A 2C0LA 2XEHA 3D9MA 5A7DB 4YDEA 4C48B 1TR4A 4I2ZA 3I3NA 2J9QA 2AWIA 1TNOA 4I1MA 4I9CA 4I1OB 4GA1A 3UMVA 2V8SE 1H6KA 4EZKA 1BD8A 1KT1A 2F8YA 4HLEA 2DYSE 4E6HA 4B94A 3DXMG 4U0SA 3V2OA 2KCKA 2ETBA 2H6IA 1E7VA 1HO8A 3ASHA 5BV0A 3RSEG 4I6EA 4DPRA 4BT8A 2UY1B 4B8CB 3AG2E 5BNWA 3CQCB 3DBSA 4ILGA 2I1JA 4MLPA 4UUCA 2B0OE 2A5UA 4F3VA 2M63A 1N0RA 1NI1A 4HRMB 5FQ6A 5D0OD 2VGEA 3HXCA 1O1TA 1PC2A 5BW8C 2P9IG 4WAFA 4AY5A 5ENQD 3AS4A 3MZLB 4J7WA 4GTPA 2JLBA 1SZAA 1OCZE 3UT7A 4GPMA 5JA4D 3RRNB 3DSUA 5CBOA 2AW6A 3UM3A 1YA0A 5J08A 1FVHA 3HXDA 3AG1E 3PUJA 3LVQE 1HG2A 3GZ1A 3C3QA 5B1AE 3KEZA 4HI8A 5CMWA 4L2LA 2P58C 5T4YA 3LKUA 1N4SA 3I4GA 4L2YA 3I4RB 2IJGX 4CZ2D 4OVUA 5JJ6A 4XX5A 3G2VA 3HG0D 1IKND 3B7UX 3ZYKA 4CRWA 3MEKA 3SI5A 2KZTB 3D9PA 3Q5MA 3TWWA 4KZCA 2DZNA 3U9WA 4GZCA 2BEDA 3ZIMA 2QZAA 2CFUA 3L9TA 4F6RD 1HS6A 2IOLA 4U04A 1NA3A 3D9NA 4UQYA 5FIOA 2LO6A 2R59A 2EIKE 2P9PG 1H19A 3TJPA 2R2LA 2P9UG 3CLJA 3ZRHA 3DSTA 4NIKA 2VTBA 4NACA 3FDHA 2F0YA 2H6HA 3AAAC 3ZKJA 4OVVA 4YNDA 3PH0C 4LG6A 3LVRE 4HOQA 3RIBA 3TWQA 4WWPA 2QYJA 3SGHA 3UKRG 3CK8A 1INZA 1S64A 1HH8A 2J07A 4R7LA 2DZOA 2ETCA 2RFAA 3C3RA 1OWLA 2PNNA 2XEVA 3TL5A 1OCCE 3ZXSA 3QDNA 4JVSA 4KZ0A 4XZ4A 4N5QA 5JJTA 5KJMA 3C98A 2V5QC 4HOSA 2NC9A 4GTRA 2IO3C 2YINA 2X6HA 1NP7A 2KZTA 3PZ3A 5BXOA 3TWSA 2WXQA 1OT8A 3QWWA 2MRIA 3U3WA 2A5EA 4GCNA 5AN8A 3RK6A 2A4ZA 1TNUA 3Q7AA 4EPZA 1EF1C 3ZU7B 3Q15A 5AQ7A 5D66A 3SBTB 2IONA 4G25A 4JB8P 2FI7A 3PE4A 3VLEA 4RSYA 3V2XA 5BXUA 2BF0X 5FQ4A 3NOGD 3R9MA 4J0UA 1H2UA 1D8EA 1UG3A 2DIWA 4HRLA 4L23A 2VJ8A 3ZGQA 2YNQA 3CK7A 2XHEA 1SQMA 3S7BA 2GW1A 4JW1A 4BFRA 1WDYA 3Q75A 2WXKA 3FY4A 2PM6A 3CEQA 3DSSA 4N3BA 1B89A 1RZ4A 3B13A 4U63A 3E32A 5B3SE 1TJCA 3FUJA 5EX0A 5G05C 1E8WA 4NRHB 4HFGA 2X6FA 4I6JA 3T5XA 2VSNA 2J8SD 2RD0A 4C9BB 3ZNGA 3EHRA 3L16A 2X6IA 1JWFA 3FUEA 4AVXA 2MHKA 5AENA 3J5PA 2X38A 4APFA 3UIPC 1LF8A 2VGXA 2GRNB 3HDXA 4GPKA 3RO3A 4J8DA 2PQRA 3MV3B 3TWRA 1FPPA 3DPDA 2GRQB 4DX5D 5ENOD 3VTYA 3TWTA 3ZUVB 2JABA 3NQPA 2OCCE 1K1BA 4GTQA 3EDTB 3JYSA 2B6CA 1P5QA 2IO2C 4TXPA 5AQAA 3CVWA 1H2VC 4O1OA 2P9NG 4AOFA 3AS8A 5G2NA 2QY7A 3IHVA 3LDZA 4UQXA 2WXFA 5EKQD 1IYGA 2ONDA 3ZFWA 3FUFA 3MCXA 3HVEB 1MX2A 4EZLA 3DEPA 1OWOA 1KPSB 2AVPA 3Q49B 2KATA 1Y8MA 4U0UA 4MKTA 4OAVB 2BTDA 4LSZE 4ATGA 4N2QA 1OUVA 5C2YA 2WMNA 1K1AA 3SY2A 1QZ2A 3SO8A 4TRQA 4JHJA 3B7SA 3PE3A 3ZPJA 3QWPA 4GMLA 3S2AA 2DCPA 3FUDA 2IFUA 2WXOA 5EIBE 3B7BA 2H6GA 4Y6WA 4KYOB 4K03A 1TNBA 5DBKA 1Z3YA 3QKYA 1HZ4A 3FTYA 4G8LA 4YVQC 4ABNA 4DX2A 1AP7A 4DI4A 2QFCA 3CVPA 4G23A 4FADA 2NYJA 1FT1A 4ZFHA 3TG5A 2RG8A 1TEZA 2VYIA 5T3RA 1TNZA 4RQIA 3R7RA 3ZYMA 1AWCB 3TXNA 3PNTB 1EDUA 4GTTA 4PS3A 1NZNA 2RKKA 3G2WA 3JUIA 3PS6A 2FO7A 3Q79A 2WVIA 2KXPC 3ASOE 4LERA 4HBDA 2J4BA 1TJFA 4ACLA 4HVBA 3QAQA 4WNEA 3HXEA 2P9KG 3PZ2A 3PVLA 4TV3A 4DJAA 5EIDA 4BTAA 3UT8A 4D10C 2KM4A 1XGWA 3HHMA 3CGHA 3Q47B 3MV2B 4GZ5A 3J5QB 5ARFA 1O1RA 1N4QA 3BU8A 5FJYA 1TN6A 2X3MA 3APDA 3FFLA 1U3CA 2WQ6A 5CERB 3S7FA 3ZXPA 1ELWA 2WXMA 3SNXA 2Y4TA 2LUHA 1LD7A 1Z5SC 1MYOA 4XKBA 1BLXB 5KNHD 3SZ7A 2LXMA 4K5CA 2E0IA 4V3IA 4U7EB 5KCMA 2V0PA 5FINA 4CGWA 4AIFA 4J8YA 3LXUX 1UN9A 5ENRD 3D9JA 3P1UA 2MYOA 5KJLA 2Y0BG 3LYAA 4H7YA 3DSXA 3R9AB 5G05J 4F53A 2WMOA 2XZTG 2FBNA 2L9BA 2IEJA 2P9LG 3FH7A 4RG9A 2LAHA 2ZISA 2C2LA 4PUCA 3WG7E 3RJVA 3CIAA 2FULA 4DI3A 5KWDA 3L17A 3ONKA 2LNIA 2F37A 4J6IA 5FQ7A 3CV0A 4TXQA 3L13A 3UM1A 4CDRA 1HU3A 3Q9NC 3ULEG 5E75A 4M3OA 4LNBA 3T9KA 3L22A 4XI9A 4UWGA 3T5VA 4BX8A 4GA2A 3CHMA 3PREA 3JQ1A 2H6FA 3JXIA 4Q94A 4PH4B 2L0TB 3ISMC 2ZXWE 3NF1A 4JL0A 5CBNA 4P29A 3AJIA 5LCWC 2AXZA 4Z68A 1UJJA 2I1KA 2CHXA 4A3TA 5FQ8A 3HYMB 3IEGA 1UN8A 2J08A 1IXVA 3SFYA 2WXNA 1YMPA 2ZGDA 4LCTA 3DSVA 1EPUA 2DBAA 2XPYA 4JHRA 2YHEA 1WY6A 3SFZA 4URKA 2VGYA 4MRUA 4B93B 4FP7A 1D8DA 5FTPA 5EN5D 5ENTD 4ACKA 4FLBA 2GROB 2Y69E 3EUVA 4FA6A 5CEAA 4N2SA 4GTVA 3HRAA 3FU5A 3MKQB 3W9FA 5G04C 2L6BA 2WQHA 3EHNA 3LEWA 4HI9A 4BX9A 3IXEA 5KNGA 3TG4A 3IV0A 2WXIA 3GYZA 4Q96A 3IBEA 1SZ9A 1MX6A 4N39A 4AEZC 1N0QA 4HXIA 4O60A 1JPLA 3ULYA 5KJNA 3CK9A 2CHWA 2VGXB 3TWXA 1U2VG 3UTMA 3T8KA 3JQ0A 2OV8A 5EILA 4U96D 4CCAA 3KSQA 4A55A 5AAOA 4G8KA 1TNYA 3EIQC 3U64A 3D9HA 2HYZA 1EYHA 4UI9J 2VSXE 2XCBA 1QYMA 3FULA 3ZHEB 5AJLA 2XGMA 4M7CA 3MGBA 1N95A 5JMND 4K5AB 3DWLG 4JA7A 3ZW3A 2YHCA 2CFZA 5CRUA 5KJKA 2R02A 1HF8A 3D9LA 3FWVA 4A1GA 3UPVA 4QQIA 3TGOA 4L9PA 4GZ3A 3FHEA 2V4HC 4JD2G 2FEZA 3B95A 5KBAA 3KD7A 1N9AA 4FJYA 4EZJA 3APFA 5JHAA 5CECB 3PZ1A 1Z3XA 5ITZF 2CG2A 3D3MA 4X8QA 4TXRA 4G1TA 1NL4A 4GZ6A 3L54A 2WXGA 4LRZA 4J8EA 5CCLA 2RFMA 2LXLA 1UW4B 2HE0A 1D9SA 4WUYA 4N5CA 2L6JA 1GW6A 1N4RA 4AM9A 3PDNA 4ZHBA 1WM5A 2VSOE 1SVXA 4GTMA 3ASNE 1IHBA 4I43A 5CRVA 5LFAA 4U8VD 4JEHA 1U3DA 1JWGA 2OVFA 1N94A 1OWPA 1KZOA 2OVBA 3TXMA 3FEXA 5ENPD 1DVPA 2HM8A 3JUEA 4Q69A 3CSTA 4U0ZA 5DIZA 4CT0A 1V54E 3ASDA 1JCQA 1NA0A 2GRMA 3FEYA 1MQSA 4DLQA 4YDOA 2OOEA 4XIFA 3UINC 5A6CA 3PUKA 3EHMA 4DLOA 3APCA 4J8SA 3UX4A 4HRNA 2KCVA 2LSVA 4CDNA 1H2TC 3UM0A 3Q7FA 2WXJA 3KSLA 2WXPA 2I6HA 2VTBB 4WNFA 5A23A 4GYWA 1WG0A 3ABKE 4HB5A 1XNFA 4B0ZA 3QK0A 3OTNA 5ANLA 4GMRA 1TYQG 4HQDA 3KS2A 3S7DA 3SBSA 3VLFA 2V5FA 5ARGA 3UKUG 2XEEA 1E90A 3EU5A 3URZA 2BKGA 5EDSA 1ZU2A 2C0MA 3KAEA 2EIJE 3FTSA 2GRLA 2XPIA 3OXFA 3ZYQA 4LNGA 3JXJA 5EX3A 3EJNA 4YDWA 3R7QA 1OCOE 1K3ZD 5JHBA 2J09A 3Q4AB 1H6PA 3TWVA 1N4PA 5HS0A 3UQ3A 1MJ0A 3FU3A 3B7RL 3RAUA 4JC8A 3ESKA 3CVNA 4IULA 4LEUA 3CHQA 3CHSA 3FTWA 2PL2A 3ML9A 1BU9A 4RLYA 1G3NB 4PS8A 4HOUA 5LX8A 4L1BA 3JCKC 1KZPA 2E2EA 3BUAA 3E34A 4C0EA 2NSZA 4FHJA 3LY9A 3GZSA 1BPOA 3EHQA 3U4TA 3NAWA 2KBXA 5FZQA 1UJKA 2QC9A 3FP3A 3MX3A 3ABLE 2GGFA 1OWMA 3L6AA 4BSXA 5FWQA 1BI7B 3ONLA 4HNAD 4JPSA 3PNLB 2XRZA 1MX4A 3CHRA 4FJZA 2CHZA 3NB2A 1FCHA 5FZSA 1HXIA 3E37A 4CGVA 3ML8A 3V30A 4F1SA 4XI0A 4B89A 4NQ0A 4HOTA 4DX6D 1E7UA 2VQ2A 3VLDA 4ILHB 5HQ8A 2AJAA 3LS8A 2J4DA 3FTUA 1DNPA 1H0AA 3UIOC 1N11A 5BV1A 4ANVA 3ZN3A 4DK5A 4TUMA 3TAXA 4GU5A 5H7PA 1S70B 4CYMD 3NZSA 1N52A 4CT4A 4Y6CA 1TN7A 3HVEA 1IHGA 3CVLA 4WNDA 1Z6TA 3G2UA 3CKBA 4UWHA 3DSWA 4FHKA 2ZIRA 4GAAA 5C1DA 5HRYA 4H7XA 3NBNB 4L7TA 4GTSA 3TWUA 1YCSB 3FTXA 3UM2A 1IQUA 4UQZA 3PEVB 2YQ8A 5BUZA 2WB2A 1ELKA 4JA9A 4A1SA 1LTXA 4GMJA 4ANXA 2ILRA 4XE0A 3D9OA 1Y6IA 1UOHA 3UXGA 3CHOA 5LCWJ 5AARA 1O1SA 1HG5A 4K5BA 1ZBPA 3QARA 4BERA 2EILE 4I1AA 2FO1E 3L08A 4JEUA 4OYSA 4I9EA 4EQFA 4APOA 2FF4A 3FTZA 3FUNA 5CMYA 3LPZA 3ESLA 4IRUA 5LOZA 4O1PA 4FC8A 2PZIA 2DVWA 3OXLA 2KC7A 2EQXA 4WNGA 4ANUA 4DX1A 3AG4E 3CVQA 4AJWA 5AQ9A 4LNUD 4N3CA 2Y3AA 3FU0A 5G04J 1E8ZA 3UT4A 2P9SG 1E8XA 3ASFA 5AIJA 1YYHA 3G2SA 4GA0A 4U8YD 3MJWA 1OWNA 3K9IA 3DEOA 5M72A 1ZB1A 3OXGA 1S63A 2HO1A 3DPYA 2XENA 5FZRA 3IKOB 3GW4A 4JHKA 3ZHEA 2XZDG 4G11A 4HORA 2EIME 1HX8A 4MS6A 3DRAA 1QNFA 4EBAA 4GTOA 3AG3E 3UI2A 1OXJA 3E4BA 4IN3B 3RO2A 2Q7FA 4NURA 2NXPA 2ZU6B 1ELRA 4AY6A 3SHFA 4TUUA 4YDYA 5D2MC 2QYUA 2I2OA 2BUGA 2L0IA 5B1BE 2P2CP 2CG3A 1OY3D 4KVMA 3FH8A 1FT2A 3MKQA 5T8IA 3QNKA 3ULQA 1E8YA 4BESA 4C0MA 4EBAG 1K8KG 3E30A 1WAO1 5G55A 2GRPB 4J8FA 2PM7A 4GCOA 5IY5E 1DCQA 1JCSA 2DYRE 3B7TA 3LY8A 4GYYA 4FLHA 1NFIE 4BSZB 4QFVA 2DWZA 3FUKA 1PAQA 3PZ4A 3FUIA 4LUNU 3SQVA 2XS1A 5HI7A 3FU6A 2F8XK 4HS2A 1DCEA 4FU3A 4PDXA 3RU0A 4CDMA 2IY0C 1SA4A 3ENEA 4EECA 3HXFA 5AYWD 2MOWA 3C72A 5D0QD 2LAIA 4BWRA 4DRXE 5CCMA
chains in the Genus database with same CATH topology
3HRAA 5HKPA 3NBNB 5CECB 3W9FA 4HI8A 1K1AA 3TWUA 3UI2A 1YCSB 5EIDA 1BD8A 2L6BA 5ENSD 4HI9A 3SO8A 4N5QA 4CZ2D 2F8YA 1BI7B 2ZGGA 1WG0A 4HB5A 5ITZF 2V5QC 4HNAD 3IXEA 4OAUC 5KNGA 3HG0D 1IKND 3J5QB 5KWDA 4GMRA 4HQDA 4BEPA 3V2OA 2J8SD 3ZNGA 5EIBE 2ETBA 2F37A 1MX6A 3B7BA 3V31A 3W9GA 1N0QA 1MX4A 2XEEA 3V79K 3EHRA 1UOHA 3UXGA 5BXOA 3TWWA 2BKGA 5CEAA 4O60A 2RFMA 3TWSA 1OT8A 2ETAA 3F6QA 2DZNA 3Q9NC 1SW6A 2A5EA 2HE0A 5CEDB 1D9SA 5EYPF 4YDYA 3C5RA 5AARA 3J5PA 1A5EA 5EYLA 4K5BA 3T9KA 4G8LA 2FO1E 4BERA 4DX2A 1AP7A 3TWXA 4F6RD 5AN8A 4ZHBA 5CERB 3KEAA 3UTMA 3V30A 2P2CP 4UUCA 4F1PA 1OY3D 3T8KA 1SVXA 2B0OE 2BKKB 1BI8B 3Q9UC 1IHBA 4DX6D 5EILA 3EU9A 4U96D 2NYJA 3JXIA 3TWRA 1N0RA 4U8VD 4DUIA 5AAOA 4G8KA 3ZU7B 4ZFHA 3JXJA 5FIOA 4BESA 3D9HA 4YDWA 5AQ7A 2AJAA 5D66A 1MYOA 4HRMB 1K3ZD 4O1PA 5ENPD 1BLXB 4DX5D 3JUEA 5KNHD 2VGEA 1N11A 3TWVA 2DVWA 3LJNA 5ENOD 5HS0A 4JB8P 1AWCB 3TWTA 2Y1LE 3ZUVB 1MJ0A 1QYMA 5CBNA 2JABA 4U95D 4K5CA 4TUMA 1K1BA 3AJIA 3V2XA 5JMND 4HLLA 5BXUA 4K5AB 4DX1A 1DCQA 4NIKA 3NOCD 4ATZD 4Z68A 5ENQD 5AQ9A 4LNUD 1NFIE 1S70B 3NOGD 4BSZB 4CYMD 4QFVA 5AQAA 5FINA 4O1OA 4J8YA 4J7WA 4HRLA 2DWZA 1BU9A 3AAAC 2KXPC 4RLYA 3ZKJA 1G3NB 1YYHA 4U8YD 4LG6A 5AQBA 4HBDA 1IXVA 3DEOA 4GPMA 5ENRD 5JA4D 2XEHA 1YMPA 2ZGDA 2F8XK 4QQIA 5CBOA 2XENA 4DX7D 4C48B 2MYOA 1MX2A 2Y0BG 3TWQA 2QYJA 1WDYA 3DEPA 4B93B 1DC2A 1TR4A 2XZDG 2V4HC 4A63B 2DZOA 2ETCA 2RFAA 3EHQA 4HRNA 5EN5D 5ENTD 2KBXA 3B95A 4BETA 5KBAA 5HRYA 2XZTG 4OAVB 2QC9A 2PNNA 4LSZE 4DRXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRA A;  5HKP A;  3NBN B;  5CEC B;  3W9F A;  4HI8 A;  1K1A A;  3TWU A;  3UI2 A;  1YCS B;  5EID A;  1BD8 A;  2L6B A;  5ENS D;  4HI9 A;  3SO8 A;  4N5Q A;  4CZ2 D;  2F8Y A;  1BI7 B;  2ZGG A;  1WG0 A;  4HB5 A;  5ITZ F;  2V5Q C;  4HNA D;  3IXE A;  4OAU C;  5KNG A;  3HG0 D;  1IKN D;  3J5Q B;  5KWD A;  4GMR A;  4HQD A;  4BEP A;  3V2O A;  2J8S D;  3ZNG A;  5EIB E;  2ETB A;  2F37 A;  1MX6 A;  3B7B A;  3V31 A;  3W9G A;  1N0Q A;  1MX4 A;  2XEE A;  3V79 K;  3EHR A;  1UOH A;  3UXG A;  5BXO A;  3TWW A;  2BKG A;  5CEA A;  4O60 A;  2RFM A;  3TWS A;  1OT8 A;  2ETA A;  3F6Q A;  2DZN A;  3Q9N C;  1SW6 A;  2A5E A;  2HE0 A;  5CED B;  1D9S A;  5EYP F;  4YDY A;  3C5R A;  5AAR A;  3J5P A;  1A5E A;  5EYL A;  4K5B A;  3T9K A;  4G8L A;  2FO1 E;  4BER A;  4DX2 A;  1AP7 A;  3TWX A;  4F6R D;  5AN8 A;  4ZHB A;  5CER B;  3KEA A;  3UTM A;  3V30 A;  2P2C P;  4UUC A;  4F1P A;  1OY3 D;  3T8K A;  1SVX A;  2B0O E;  2BKK B;  1BI8 B;  3Q9U C;  1IHB A;  4DX6 D;  5EIL A;  3EU9 A;  4U96 D;  2NYJ A;  3JXI A;  3TWR A;  1N0R A;  4U8V D;  4DUI A;  5AAO A;  4G8K A;  3ZU7 B;  4ZFH A;  3JXJ A;  5FIO A;  4BES A;  3D9H A;  4YDW A;  5AQ7 A;  2AJA A;  5D66 A;  1MYO A;  4HRM B;  1K3Z D;  4O1P A;  5ENP D;  1BLX B;  4DX5 D;  3JUE A;  5KNH D;  2VGE A;  1N11 A;  3TWV A;  2DVW A;  3LJN A;  5ENO D;  5HS0 A;  4JB8 P;  1AWC B;  3TWT A;  2Y1L E;  3ZUV B;  1MJ0 A;  1QYM A;  5CBN A;  2JAB A;  4U95 D;  4K5C A;  4TUM A;  1K1B A;  3AJI A;  3V2X A;  5JMN D;  4HLL A;  5BXU A;  4K5A B;  4DX1 A;  1DCQ A;  4NIK A;  3NOC D;  4ATZ D;  4Z68 A;  5ENQ D;  5AQ9 A;  4LNU D;  1NFI E;  1S70 B;  3NOG D;  4BSZ B;  4CYM D;  4QFV A;  5AQA A;  5FIN A;  4O1O A;  4J8Y A;  4J7W A;  4HRL A;  2DWZ A;  1BU9 A;  3AAA C;  2KXP C;  4RLY A;  3ZKJ A;  1G3N B;  1YYH A;  4U8Y D;  4LG6 A;  5AQB A;  4HBD A;  1IXV A;  3DEO A;  4GPM A;  5ENR D;  5JA4 D;  2XEH A;  1YMP A;  2ZGD A;  2F8X K;  4QQI A;  5CBO A;  2XEN A;  4DX7 D;  4C48 B;  2MYO A;  1MX2 A;  2Y0B G;  3TWQ A;  2QYJ A;  1WDY A;  3DEP A;  4B93 B;  1DC2 A;  1TR4 A;  2XZD G;  2V4H C;  4A63 B;  2DZO A;  2ETC A;  2RFA A;  3EHQ A;  4HRN A;  5EN5 D;  5ENT D;  2KBX A;  3B95 A;  4BET A;  5KBA A;  5HRY A;  2XZT G;  4OAV B;  2QC9 A;  2PNN A;  4LSZ E;  4DRX E; 
#chains in the Genus database with same CATH topology
 3RRM B;  5HKP A;  3U66 A;  2HR2 A;  3ASG A;  2R17 C;  4OAU C;  3L82 A;  4O6F A;  1N54 A;  2XGO A;  1MHQ A;  3QC1 A;  3V31 A;  4AP2 A;  3Q78 A;  4ME2 A;  3F6Q A;  4UWK A;  4IYP A;  2LSU A;  4PS7 A;  5CED B;  4AXH A;  5AJD A;  2V4L A;  3QWV A;  4F7A A;  2XQ0 A;  4DUI A;  5CHE E;  4AV7 A;  4ANW A;  1H6O A;  4G2V A;  3ZEF A;  3QJZ A;  2R05 A;  2IOS A;  3O48 A;  2Y1L E;  5E76 A;  2R03 A;  4U95 D;  2R5S A;  3PEU B;  4HLL A;  1QQE A;  4ATZ D;  4K0R A;  4I17 A;  4WWN A;  3CHP A;  5BPP A;  3BG0 B;  4ILI A;  2WQ7 A;  3PRZ A;  1O5M A;  4KVO A;  3HIZ A;  1PY1 A;  4I2W A;  3X2Q E;  1DC2 A;  3RRU A;  3E33 A;  1OCR E;  4GB9 A;  4A63 B;  1V55 E;  3LCA A;  4N3A A;  3MYV A;  4E85 A;  4BET A;  3I5P A;  4I6G A;  4XEI G;  4KBQ A;  2JEK A;  4RG6 A;  3N71 A;  4GZD A;  5ENS D;  2VSY A;  2ZGG A;  4JZY A;  2EIN E;  4BEP A;  1E96 B;  1KT0 A;  4JXT A;  1MZC A;  2OEW A;  3PZD A;  3CR3 A;  4RVB A;  3V79 K;  4W9R A;  3SD5 A;  2ETA A;  1A17 A;  1SW6 A;  2UY1 A;  3EIJ A;  5EYP F;  3C5R A;  1A5E A;  5EYL A;  2AXV A;  2XPZ A;  4MBG A;  3KEA A;  1S0P A;  4UWL A;  1KLX A;  4F1P A;  3CVV A;  2PQN A;  2GRR B;  1HE8 A;  5FT9 A;  4CEM A;  3Q73 A;  4G26 A;  4BT9 A;  4UI9 C;  3QOU A;  2XCC A;  1FVF A;  1X5B A;  2I9C A;  4WWO A;  4B8A A;  3GZ2 A;  3MA5 A;  1Q2Z A;  1JCR A;  2X6J A;  3BQO A;  4FUL A;  3LJ3 A;  3IHY A;  3CVX A;  3C3O A;  4UI9 K;  2KCL A;  1HFA A;  3CVY A;  2AXU A;  5AQB A;  2IU1 A;  4G24 A;  3BG1 B;  3BEE A;  5JJ7 A;  3CKC A;  4DX7 D;  2X6K A;  3FH5 A;  3ABM E;  3G2T A;  3CVU A;  2WM9 A;  2XGS A;  3FUM A;  1TN8 A;  2UWJ G;  3FTV A;  4BTB A;  2IQC A;  3RKV A;  3D9I A;  4A3V A;  4UWF A;  4KMO A;  3P2B A;  3MKR A;  4GYO A;  4EHM A;  5LP0 A;  3SFX A;  1L5J A;  4XKC A;  1IQR A;  3UUX A;  1X81 A;  3AS5 A;  3SF4 A;  3W9G A;  1VDY A;  3AU5 A;  1SA5 A;  3QB2 A;  1QBQ A;  1W3B A;  4KT6 B;  4U07 A;  5ANR A;  3HXB A;  2IF4 A;  3T8M A;  4KXK B;  2Y4U A;  5BT1 A;  3WXX A;  1RW2 A;  3S7J A;  3OAW A;  2BKK B;  1BI8 B;  3Q9U C;  4BY6 A;  3EU9 A;  3VTX A;  3DXK G;  5J90 A;  2WXL A;  3AU4 A;  3FUH A;  3CSF A;  1JUQ A;  3O4Z A;  2XRY A;  4U8H A;  3LJN A;  2OEV A;  3ZYL A;  2J49 A;  4YVO A;  3NOC D;  5ENN A;  3LY7 A;  3ZVV A;  3D9K A;  1LD8 A;  2WPV A;  2WXR A;  2WXH A;  3CQG B;  3NZU A;  2XS8 A;  2C0L A;  2XEH A;  3D9M A;  5A7D B;  4YDE A;  4C48 B;  1TR4 A;  4I2Z A;  3I3N A;  2J9Q A;  2AWI A;  1TNO A;  4I1M A;  4I9C A;  4I1O B;  4GA1 A;  3UMV A;  2V8S E;  1H6K A;  4EZK A;  1BD8 A;  1KT1 A;  2F8Y A;  4HLE A;  2DYS E;  4E6H A;  4B94 A;  3DXM G;  4U0S A;  3V2O A;  2KCK A;  2ETB A;  2H6I A;  1E7V A;  1HO8 A;  3ASH A;  5BV0 A;  3RSE G;  4I6E A;  4DPR A;  4BT8 A;  2UY1 B;  4B8C B;  3AG2 E;  5BNW A;  3CQC B;  3DBS A;  4ILG A;  2I1J A;  4MLP A;  4UUC A;  2B0O E;  2A5U A;  4F3V A;  2M63 A;  1N0R A;  1NI1 A;  4HRM B;  5FQ6 A;  5D0O D;  2VGE A;  3HXC A;  1O1T A;  1PC2 A;  5BW8 C;  2P9I G;  4WAF A;  4AY5 A;  5ENQ D;  3AS4 A;  3MZL B;  4J7W A;  4GTP A;  2JLB A;  1SZA A;  1OCZ E;  3UT7 A;  4GPM A;  5JA4 D;  3RRN B;  3DSU A;  5CBO A;  2AW6 A;  3UM3 A;  1YA0 A;  5J08 A;  1FVH A;  3HXD A;  3AG1 E;  3PUJ A;  3LVQ E;  1HG2 A;  3GZ1 A;  3C3Q A;  5B1A E;  3KEZ A;  4HI8 A;  5CMW A;  4L2L A;  2P58 C;  5T4Y A;  3LKU A;  1N4S A;  3I4G A;  4L2Y A;  3I4R B;  2IJG X;  4CZ2 D;  4OVU A;  5JJ6 A;  4XX5 A;  3G2V A;  3HG0 D;  1IKN D;  3B7U X;  3ZYK A;  4CRW A;  3MEK A;  3SI5 A;  2KZT B;  3D9P A;  3Q5M A;  3TWW A;  4KZC A;  2DZN A;  3U9W A;  4GZC A;  2BED A;  3ZIM A;  2QZA A;  2CFU A;  3L9T A;  4F6R D;  1HS6 A;  2IOL A;  4U04 A;  1NA3 A;  3D9N A;  4UQY A;  5FIO A;  2LO6 A;  2R59 A;  2EIK E;  2P9P G;  1H19 A;  3TJP A;  2R2L A;  2P9U G;  3CLJ A;  3ZRH A;  3DST A;  4NIK A;  2VTB A;  4NAC A;  3FDH A;  2F0Y A;  2H6H A;  3AAA C;  3ZKJ A;  4OVV A;  4YND A;  3PH0 C;  4LG6 A;  3LVR E;  4HOQ A;  3RIB A;  3TWQ A;  4WWP A;  2QYJ A;  3SGH A;  3UKR G;  3CK8 A;  1INZ A;  1S64 A;  1HH8 A;  2J07 A;  4R7L A;  2DZO A;  2ETC A;  2RFA A;  3C3R A;  1OWL A;  2PNN A;  2XEV A;  3TL5 A;  1OCC E;  3ZXS A;  3QDN A;  4JVS A;  4KZ0 A;  4XZ4 A;  4N5Q A;  5JJT A;  5KJM A;  3C98 A;  2V5Q C;  4HOS A;  2NC9 A;  4GTR A;  2IO3 C;  2YIN A;  2X6H A;  1NP7 A;  2KZT A;  3PZ3 A;  5BXO A;  3TWS A;  2WXQ A;  1OT8 A;  3QWW A;  2MRI A;  3U3W A;  2A5E A;  4GCN A;  5AN8 A;  3RK6 A;  2A4Z A;  1TNU A;  3Q7A A;  4EPZ A;  1EF1 C;  3ZU7 B;  3Q15 A;  5AQ7 A;  5D66 A;  3SBT B;  2ION A;  4G25 A;  4JB8 P;  2FI7 A;  3PE4 A;  3VLE A;  4RSY A;  3V2X A;  5BXU A;  2BF0 X;  5FQ4 A;  3NOG D;  3R9M A;  4J0U A;  1H2U A;  1D8E A;  1UG3 A;  2DIW A;  4HRL A;  4L23 A;  2VJ8 A;  3ZGQ A;  2YNQ A;  3CK7 A;  2XHE A;  1SQM A;  3S7B A;  2GW1 A;  4JW1 A;  4BFR A;  1WDY A;  3Q75 A;  2WXK A;  3FY4 A;  2PM6 A;  3CEQ A;  3DSS A;  4N3B A;  1B89 A;  1RZ4 A;  3B13 A;  4U63 A;  3E32 A;  5B3S E;  1TJC A;  3FUJ A;  5EX0 A;  5G05 C;  1E8W A;  4NRH B;  4HFG A;  2X6F A;  4I6J A;  3T5X A;  2VSN A;  2J8S D;  2RD0 A;  4C9B B;  3ZNG A;  3EHR A;  3L16 A;  2X6I A;  1JWF A;  3FUE A;  4AVX A;  2MHK A;  5AEN A;  3J5P A;  2X38 A;  4APF A;  3UIP C;  1LF8 A;  2VGX A;  2GRN B;  3HDX A;  4GPK A;  3RO3 A;  4J8D A;  2PQR A;  3MV3 B;  3TWR A;  1FPP A;  3DPD A;  2GRQ B;  4DX5 D;  5ENO D;  3VTY A;  3TWT A;  3ZUV B;  2JAB A;  3NQP A;  2OCC E;  1K1B A;  4GTQ A;  3EDT B;  3JYS A;  2B6C A;  1P5Q A;  2IO2 C;  4TXP A;  5AQA A;  3CVW A;  1H2V C;  4O1O A;  2P9N G;  4AOF A;  3AS8 A;  5G2N A;  2QY7 A;  3IHV A;  3LDZ A;  4UQX A;  2WXF A;  5EKQ D;  1IYG A;  2OND A;  3ZFW A;  3FUF A;  3MCX A;  3HVE B;  1MX2 A;  4EZL A;  3DEP A;  1OWO A;  1KPS B;  2AVP A;  3Q49 B;  2KAT A;  1Y8M A;  4U0U A;  4MKT A;  4OAV B;  2BTD A;  4LSZ E;  4ATG A;  4N2Q A;  1OUV A;  5C2Y A;  2WMN A;  1K1A A;  3SY2 A;  1QZ2 A;  3SO8 A;  4TRQ A;  4JHJ A;  3B7S A;  3PE3 A;  3ZPJ A;  3QWP A;  4GML A;  3S2A A;  2DCP A;  3FUD A;  2IFU A;  2WXO A;  5EIB E;  3B7B A;  2H6G A;  4Y6W A;  4KYO B;  4K03 A;  1TNB A;  5DBK A;  1Z3Y A;  3QKY A;  1HZ4 A;  3FTY A;  4G8L A;  4YVQ C;  4ABN A;  4DX2 A;  1AP7 A;  4DI4 A;  2QFC A;  3CVP A;  4G23 A;  4FAD A;  2NYJ A;  1FT1 A;  4ZFH A;  3TG5 A;  2RG8 A;  1TEZ A;  2VYI A;  5T3R A;  1TNZ A;  4RQI A;  3R7R A;  3ZYM A;  1AWC B;  3TXN A;  3PNT B;  1EDU A;  4GTT A;  4PS3 A;  1NZN A;  2RKK A;  3G2W A;  3JUI A;  3PS6 A;  2FO7 A;  3Q79 A;  2WVI A;  2KXP C;  3ASO E;  4LER A;  4HBD A;  2J4B A;  1TJF A;  4ACL A;  4HVB A;  3QAQ A;  4WNE A;  3HXE A;  2P9K G;  3PZ2 A;  3PVL A;  4TV3 A;  4DJA A;  5EID A;  4BTA A;  3UT8 A;  4D10 C;  2KM4 A;  1XGW A;  3HHM A;  3CGH A;  3Q47 B;  3MV2 B;  4GZ5 A;  3J5Q B;  5ARF A;  1O1R A;  1N4Q A;  3BU8 A;  5FJY A;  1TN6 A;  2X3M A;  3APD A;  3FFL A;  1U3C A;  2WQ6 A;  5CER B;  3S7F A;  3ZXP A;  1ELW A;  2WXM A;  3SNX A;  2Y4T A;  2LUH A;  1LD7 A;  1Z5S C;  1MYO A;  4XKB A;  1BLX B;  5KNH D;  3SZ7 A;  2LXM A;  4K5C A;  2E0I A;  4V3I A;  4U7E B;  5KCM A;  2V0P A;  5FIN A;  4CGW A;  4AIF A;  4J8Y A;  3LXU X;  1UN9 A;  5ENR D;  3D9J A;  3P1U A;  2MYO A;  5KJL A;  2Y0B G;  3LYA A;  4H7Y A;  3DSX A;  3R9A B;  5G05 J;  4F53 A;  2WMO A;  2XZT G;  2FBN A;  2L9B A;  2IEJ A;  2P9L G;  3FH7 A;  4RG9 A;  2LAH A;  2ZIS A;  2C2L A;  4PUC A;  3WG7 E;  3RJV A;  3CIA A;  2FUL A;  4DI3 A;  5KWD A;  3L17 A;  3ONK A;  2LNI A;  2F37 A;  4J6I A;  5FQ7 A;  3CV0 A;  4TXQ A;  3L13 A;  3UM1 A;  4CDR A;  1HU3 A;  3Q9N C;  3ULE G;  5E75 A;  4M3O A;  4LNB A;  3T9K A;  3L22 A;  4XI9 A;  4UWG A;  3T5V A;  4BX8 A;  4GA2 A;  3CHM A;  3PRE A;  3JQ1 A;  2H6F A;  3JXI A;  4Q94 A;  4PH4 B;  2L0T B;  3ISM C;  2ZXW E;  3NF1 A;  4JL0 A;  5CBN A;  4P29 A;  3AJI A;  5LCW C;  2AXZ A;  4Z68 A;  1UJJ A;  2I1K A;  2CHX A;  4A3T A;  5FQ8 A;  3HYM B;  3IEG A;  1UN8 A;  2J08 A;  1IXV A;  3SFY A;  2WXN A;  1YMP A;  2ZGD A;  4LCT A;  3DSV A;  1EPU A;  2DBA A;  2XPY A;  4JHR A;  2YHE A;  1WY6 A;  3SFZ A;  4URK A;  2VGY A;  4MRU A;  4B93 B;  4FP7 A;  1D8D A;  5FTP A;  5EN5 D;  5ENT D;  4ACK A;  4FLB A;  2GRO B;  2Y69 E;  3EUV A;  4FA6 A;  5CEA A;  4N2S A;  4GTV A;  3HRA A;  3FU5 A;  3MKQ B;  3W9F A;  5G04 C;  2L6B A;  2WQH A;  3EHN A;  3LEW A;  4HI9 A;  4BX9 A;  3IXE A;  5KNG A;  3TG4 A;  3IV0 A;  2WXI A;  3GYZ A;  4Q96 A;  3IBE A;  1SZ9 A;  1MX6 A;  4N39 A;  4AEZ C;  1N0Q A;  4HXI A;  4O60 A;  1JPL A;  3ULY A;  5KJN A;  3CK9 A;  2CHW A;  2VGX B;  3TWX A;  1U2V G;  3UTM A;  3T8K A;  3JQ0 A;  2OV8 A;  5EIL A;  4U96 D;  4CCA A;  3KSQ A;  4A55 A;  5AAO A;  4G8K A;  1TNY A;  3EIQ C;  3U64 A;  3D9H A;  2HYZ A;  1EYH A;  4UI9 J;  2VSX E;  2XCB A;  1QYM A;  3FUL A;  3ZHE B;  5AJL A;  2XGM A;  4M7C A;  3MGB A;  1N95 A;  5JMN D;  4K5A B;  3DWL G;  4JA7 A;  3ZW3 A;  2YHC A;  2CFZ A;  5CRU A;  5KJK A;  2R02 A;  1HF8 A;  3D9L A;  3FWV A;  4A1G A;  3UPV A;  4QQI A;  3TGO A;  4L9P A;  4GZ3 A;  3FHE A;  2V4H C;  4JD2 G;  2FEZ A;  3B95 A;  5KBA A;  3KD7 A;  1N9A A;  4FJY A;  4EZJ A;  3APF A;  5JHA A;  5CEC B;  3PZ1 A;  1Z3X A;  5ITZ F;  2CG2 A;  3D3M A;  4X8Q A;  4TXR A;  4G1T A;  1NL4 A;  4GZ6 A;  3L54 A;  2WXG A;  4LRZ A;  4J8E A;  5CCL A;  2RFM A;  2LXL A;  1UW4 B;  2HE0 A;  1D9S A;  4WUY A;  4N5C A;  2L6J A;  1GW6 A;  1N4R A;  4AM9 A;  3PDN A;  4ZHB A;  1WM5 A;  2VSO E;  1SVX A;  4GTM A;  3ASN E;  1IHB A;  4I43 A;  5CRV A;  5LFA A;  4U8V D;  4JEH A;  1U3D A;  1JWG A;  2OVF A;  1N94 A;  1OWP A;  1KZO A;  2OVB A;  3TXM A;  3FEX A;  5ENP D;  1DVP A;  2HM8 A;  3JUE A;  4Q69 A;  3CST A;  4U0Z A;  5DIZ A;  4CT0 A;  1V54 E;  3ASD A;  1JCQ A;  1NA0 A;  2GRM A;  3FEY A;  1MQS A;  4DLQ A;  4YDO A;  2OOE A;  4XIF A;  3UIN C;  5A6C A;  3PUK A;  3EHM A;  4DLO A;  3APC A;  4J8S A;  3UX4 A;  4HRN A;  2KCV A;  2LSV A;  4CDN A;  1H2T C;  3UM0 A;  3Q7F A;  2WXJ A;  3KSL A;  2WXP A;  2I6H A;  2VTB B;  4WNF A;  5A23 A;  4GYW A;  1WG0 A;  3ABK E;  4HB5 A;  1XNF A;  4B0Z A;  3QK0 A;  3OTN A;  5ANL A;  4GMR A;  1TYQ G;  4HQD A;  3KS2 A;  3S7D A;  3SBS A;  3VLF A;  2V5F A;  5ARG A;  3UKU G;  2XEE A;  1E90 A;  3EU5 A;  3URZ A;  2BKG A;  5EDS A;  1ZU2 A;  2C0M A;  3KAE A;  2EIJ E;  3FTS A;  2GRL A;  2XPI A;  3OXF A;  3ZYQ A;  4LNG A;  3JXJ A;  5EX3 A;  3EJN A;  4YDW A;  3R7Q A;  1OCO E;  1K3Z D;  5JHB A;  2J09 A;  3Q4A B;  1H6P A;  3TWV A;  1N4P A;  5HS0 A;  3UQ3 A;  1MJ0 A;  3FU3 A;  3B7R L;  3RAU A;  4JC8 A;  3ESK A;  3CVN A;  4IUL A;  4LEU A;  3CHQ A;  3CHS A;  3FTW A;  2PL2 A;  3ML9 A;  1BU9 A;  4RLY A;  1G3N B;  4PS8 A;  4HOU A;  5LX8 A;  4L1B A;  3JCK C;  1KZP A;  2E2E A;  3BUA A;  3E34 A;  4C0E A;  2NSZ A;  4FHJ A;  3LY9 A;  3GZS A;  1BPO A;  3EHQ A;  3U4T A;  3NAW A;  2KBX A;  5FZQ A;  1UJK A;  2QC9 A;  3FP3 A;  3MX3 A;  3ABL E;  2GGF A;  1OWM A;  3L6A A;  4BSX A;  5FWQ A;  1BI7 B;  3ONL A;  4HNA D;  4JPS A;  3PNL B;  2XRZ A;  1MX4 A;  3CHR A;  4FJZ A;  2CHZ A;  3NB2 A;  1FCH A;  5FZS A;  1HXI A;  3E37 A;  4CGV A;  3ML8 A;  3V30 A;  4F1S A;  4XI0 A;  4B89 A;  4NQ0 A;  4HOT A;  4DX6 D;  1E7U A;  2VQ2 A;  3VLD A;  4ILH B;  5HQ8 A;  2AJA A;  3LS8 A;  2J4D A;  3FTU A;  1DNP A;  1H0A A;  3UIO C;  1N11 A;  5BV1 A;  4ANV A;  3ZN3 A;  4DK5 A;  4TUM A;  3TAX A;  4GU5 A;  5H7P A;  1S70 B;  4CYM D;  3NZS A;  1N52 A;  4CT4 A;  4Y6C A;  1TN7 A;  3HVE A;  1IHG A;  3CVL A;  4WND A;  1Z6T A;  3G2U A;  3CKB A;  4UWH A;  3DSW A;  4FHK A;  2ZIR A;  4GAA A;  5C1D A;  5HRY A;  4H7X A;  3NBN B;  4L7T A;  4GTS A;  3TWU A;  1YCS B;  3FTX A;  3UM2 A;  1IQU A;  4UQZ A;  3PEV B;  2YQ8 A;  5BUZ A;  2WB2 A;  1ELK A;  4JA9 A;  4A1S A;  1LTX A;  4GMJ A;  4ANX A;  2ILR A;  4XE0 A;  3D9O A;  1Y6I A;  1UOH A;  3UXG A;  3CHO A;  5LCW J;  5AAR A;  1O1S A;  1HG5 A;  4K5B A;  1ZBP A;  3QAR A;  4BER A;  2EIL E;  4I1A A;  2FO1 E;  3L08 A;  4JEU A;  4OYS A;  4I9E A;  4EQF A;  4APO A;  2FF4 A;  3FTZ A;  3FUN A;  5CMY A;  3LPZ A;  3ESL A;  4IRU A;  5LOZ A;  4O1P A;  4FC8 A;  2PZI A;  2DVW A;  3OXL A;  2KC7 A;  2EQX A;  4WNG A;  4ANU A;  4DX1 A;  3AG4 E;  3CVQ A;  4AJW A;  5AQ9 A;  4LNU D;  4N3C A;  2Y3A A;  3FU0 A;  5G04 J;  1E8Z A;  3UT4 A;  2P9S G;  1E8X A;  3ASF A;  5AIJ A;  1YYH A;  3G2S A;  4GA0 A;  4U8Y D;  3MJW A;  1OWN A;  3K9I A;  3DEO A;  5M72 A;  1ZB1 A;  3OXG A;  1S63 A;  2HO1 A;  3DPY A;  2XEN A;  5FZR A;  3IKO B;  3GW4 A;  4JHK A;  3ZHE A;  2XZD G;  4G11 A;  4HOR A;  2EIM E;  1HX8 A;  4MS6 A;  3DRA A;  1QNF A;  4EBA A;  4GTO A;  3AG3 E;  3UI2 A;  1OXJ A;  3E4B A;  4IN3 B;  3RO2 A;  2Q7F A;  4NUR A;  2NXP A;  2ZU6 B;  1ELR A;  4AY6 A;  3SHF A;  4TUU A;  4YDY A;  5D2M C;  2QYU A;  2I2O A;  2BUG A;  2L0I A;  5B1B E;  2P2C P;  2CG3 A;  1OY3 D;  4KVM A;  3FH8 A;  1FT2 A;  3MKQ A;  5T8I A;  3QNK A;  3ULQ A;  1E8Y A;  4BES A;  4C0M A;  4EBA G;  1K8K G;  3E30 A;  1WAO 1;  5G55 A;  2GRP B;  4J8F A;  2PM7 A;  4GCO A;  5IY5 E;  1DCQ A;  1JCS A;  2DYR E;  3B7T A;  3LY8 A;  4GYY A;  4FLH A;  1NFI E;  4BSZ B;  4QFV A;  2DWZ A;  3FUK A;  1PAQ A;  3PZ4 A;  3FUI A;  4LUN U;  3SQV A;  2XS1 A;  5HI7 A;  3FU6 A;  2F8X K;  4HS2 A;  1DCE A;  4FU3 A;  4PDX A;  3RU0 A;  4CDM A;  2IY0 C;  1SA4 A;  3ENE A;  4EEC A;  3HXF A;  5AYW D;  2MOW A;  3C72 A;  5D0Q D;  2LAI A;  4BWR A;  4DRX E;  5CCM A; 
#chains in the Genus database with same CATH homology
 3HRA A;  5HKP A;  3NBN B;  5CEC B;  3W9F A;  4HI8 A;  1K1A A;  3TWU A;  3UI2 A;  1YCS B;  5EID A;  1BD8 A;  2L6B A;  5ENS D;  4HI9 A;  3SO8 A;  4N5Q A;  4CZ2 D;  2F8Y A;  1BI7 B;  2ZGG A;  1WG0 A;  4HB5 A;  5ITZ F;  2V5Q C;  4HNA D;  3IXE A;  4OAU C;  5KNG A;  3HG0 D;  1IKN D;  3J5Q B;  5KWD A;  4GMR A;  4HQD A;  4BEP A;  3V2O A;  2J8S D;  3ZNG A;  5EIB E;  2ETB A;  2F37 A;  1MX6 A;  3B7B A;  3V31 A;  3W9G A;  1N0Q A;  1MX4 A;  2XEE A;  3V79 K;  3EHR A;  1UOH A;  3UXG A;  5BXO A;  3TWW A;  2BKG A;  5CEA A;  4O60 A;  2RFM A;  3TWS A;  1OT8 A;  2ETA A;  3F6Q A;  2DZN A;  3Q9N C;  1SW6 A;  2A5E A;  2HE0 A;  5CED B;  1D9S A;  5EYP F;  4YDY A;  3C5R A;  5AAR A;  3J5P A;  1A5E A;  5EYL A;  4K5B A;  3T9K A;  4G8L A;  2FO1 E;  4BER A;  4DX2 A;  1AP7 A;  3TWX A;  4F6R D;  5AN8 A;  4ZHB A;  5CER B;  3KEA A;  3UTM A;  3V30 A;  2P2C P;  4UUC A;  4F1P A;  1OY3 D;  3T8K A;  1SVX A;  2B0O E;  2BKK B;  1BI8 B;  3Q9U C;  1IHB A;  4DX6 D;  5EIL A;  3EU9 A;  4U96 D;  2NYJ A;  3JXI A;  3TWR A;  1N0R A;  4U8V D;  4DUI A;  5AAO A;  4G8K A;  3ZU7 B;  4ZFH A;  3JXJ A;  5FIO A;  4BES A;  3D9H A;  4YDW A;  5AQ7 A;  2AJA A;  5D66 A;  1MYO A;  4HRM B;  1K3Z D;  4O1P A;  5ENP D;  1BLX B;  4DX5 D;  3JUE A;  5KNH D;  2VGE A;  1N11 A;  3TWV A;  2DVW A;  3LJN A;  5ENO D;  5HS0 A;  4JB8 P;  1AWC B;  3TWT A;  2Y1L E;  3ZUV B;  1MJ0 A;  1QYM A;  5CBN A;  2JAB A;  4U95 D;  4K5C A;  4TUM A;  1K1B A;  3AJI A;  3V2X A;  5JMN D;  4HLL A;  5BXU A;  4K5A B;  4DX1 A;  1DCQ A;  4NIK A;  3NOC D;  4ATZ D;  4Z68 A;  5ENQ D;  5AQ9 A;  4LNU D;  1NFI E;  1S70 B;  3NOG D;  4BSZ B;  4CYM D;  4QFV A;  5AQA A;  5FIN A;  4O1O A;  4J8Y A;  4J7W A;  4HRL A;  2DWZ A;  1BU9 A;  3AAA C;  2KXP C;  4RLY A;  3ZKJ A;  1G3N B;  1YYH A;  4U8Y D;  4LG6 A;  5AQB A;  4HBD A;  1IXV A;  3DEO A;  4GPM A;  5ENR D;  5JA4 D;  2XEH A;  1YMP A;  2ZGD A;  2F8X K;  4QQI A;  5CBO A;  2XEN A;  4DX7 D;  4C48 B;  2MYO A;  1MX2 A;  2Y0B G;  3TWQ A;  2QYJ A;  1WDY A;  3DEP A;  4B93 B;  1DC2 A;  1TR4 A;  2XZD G;  2V4H C;  4A63 B;  2DZO A;  2ETC A;  2RFA A;  3EHQ A;  4HRN A;  5EN5 D;  5ENT D;  2KBX A;  3B95 A;  4BET A;  5KBA A;  5HRY A;  2XZT G;  4OAV B;  2QC9 A;  2PNN A;  4LSZ E;  4DRX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...