2MYOA

Solution structure of myotrophin, nmr, minimized average structure
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis of ankyrin-like repeat function as revealed by the solution structure of myotrophin.
pubmed doi rcsb
molecule tags Ank-repeat
molecule keywords MYOTROPHIN
total genus 20
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2myoA00
3JXJA 4BERA 5KWDA 3NOGD 2RFMA 2DZNA 3HRAA 4O1OA 5AQAA 3TWQA 4G8LA 3J5QB 4J7WA 4OAVB 3JUEA 5BXOA 2HE0A 3D9HA 1MX6A 1OY3D 1SVXA 3SO8A 1MYOA 5ENTD 4CZ2D 5D66A 5ENPD 5BXUA 4JB8P 3V30A 3TWTA 1N0QA 4LNUD 4O1PA 3TWWA 3Q9UC 1NFIE 3V2XA 5FIOA 3EHQA 5EIBE 3UI2A 4TUMA 1BLXB 1MX4A 3B7BA 5ENRD 4LG6A 5ENQD 4B93B 4BETA 2RFAA 4U8VD 5EYLA 5AARA 5HS0A 4Z68A 2XZTG 4DRXE 4YDWA 3B95A 2DVWA 3KEAA 2ETCA 4GMRA 4HRLA 1DC2A 1K1AA 3ZUVB 5ITZF 4HRNA 1N11A 4HI8A 5HKPA 2AJAA 1D9SA 3T8KA 4QFVA 4U96D 4U95D 5KNGA 2Y1LE 5EIDA 5HRYA 4HLLA 3Q9NC 1AWCB 1YYHA 3IXEA 1K3ZD 1BI7B 1MX2A 5CBOA 3TWSA 5AN8A 1MJ0A 5KNHD 2FO1E 5AQ7A 2L6BA 4CYMD 4HI9A 5ENOD 2A5EA 2ZGDA 4C48B 4HQDA 4K5AB 3T9KA 5ENSD 3ZKJA 2DWZA 4ZHBA 5CBNA 3TWRA 3EHRA 2B0OE 1OT8A 4BEPA 4GPMA 5KBAA 2Y0BG 1BU9A 1YMPA 4ZFHA 5FINA 3TWVA 4ATZD 2MYOA 4O60A 3TWXA 3C5RA 3DEPA 1TR4A 2F37A 5CEDB 5CERB 5EILA 1A5EA 3V2OA 4BESA 1BI8B 3LJNA 4K5BA 4NIKA 2KBXA 5AQ9A 4DX5D 2F8XK 1UOHA 3JXIA 1SW6A 4HNAD 2JABA 1G3NB 4DUIA 2V4HC 5AQBA 4A63B 4F6RD 3HG0D 4BSZB 2V5QC 4DX7D 1BD8A 5JMND 3EU9A 2QC9A 2XEHA 2BKGA 2QYJA 4DX1A 4F1PA 5EYPF 2J8SD 3AAAC 3UTMA 4HRMB 5EN5D 3NBNB 1YCSB 1WDYA 4QQIA 1IKND 2DZOA 3J5PA 1QYMA 1N0RA 4LSZE 2XZDG 4K5CA 4YDYA 1K1BA 2F8YA 1S70B 3ZNGA 4DX6D 3W9GA 2BKKB 1IXVA 4U8YD 4UUCA 5AAOA 1AP7A 4OAUC 2ETAA 1IHBA 2XEEA 3W9FA 2PNNA 2XENA 2P2CP 2VGEA 3AJIA 4RLYA 3TWUA 4HB5A 4DX2A 5CECB 3V79K 5CEAA 2NYJA 3F6QA 2ETBA 4N5QA 4G8KA 3V31A 2KXPC 3ZU7B 4J8YA 4HBDA 1DCQA 5JA4D 3DEOA 2ZGGA 3NOCD 3UXGA 1WG0A
chains in the Genus database with same CATH superfamily
2WXJA 3BG1B 3QC1A 3OXGA 3BG0B 5IY5E 2WXRA 3CHPA 1FPPA 4OVVA 3MJWA 2FO7A 2ZU6B 4U8VD 3DSWA 2KZTB 2R02A 1FCHA 1JCSA 2X3MA 3UINC 3UPVA 3B7TA 4C0EA 2LSVA 5DBKA 4U96D 1HX8A 4N39A 3I3NA 1UN8A 5AN8A 5KNHD 4HI9A 5HQ8A 3VTXA 4HQDA 5G05C 3C3QA 3L9TA 1UJKA 3HVEB 5KBAA 2Y0BG 1YMPA 4H7XA 2MYOA 1LTXA 4URKA 3UMVA 1BI8B 5AQ9A 1OXJA 3TAXA 3CK7A 4OVUA 3FUDA 4XX5A 4DX1A 2IJGX 4CT4A 3DPDA 4AOFA 5KJKA 3ASFA 3TXNA 4FP7A 3RSEG 4K0RA 3SQVA 1U2VG 3S2AA 1WDYA 2DZOA 1N0RA 3PZ1A 4FULA 3C3RA 2XEEA 3FTZA 3ZVVA 4HFGA 4Q96A 3IBEA 5CECB 2LAHA 2MOWA 4GTOA 4G8KA 2Y4UA 4HBDA 3TXMA 3ABME 1OWNA 3CVYA 4E6HA 2DZNA 3EHNA 4IULA 4KBQA 3E4BA 4GTVA 3D9LA 2P9NG 4YDOA 5EX0A 3SFZA 2PM7A 2WQ7A 2V0PA 4N2SA 3V2XA 4BT9A 2VYIA 5ENRD 1OCCE 5BT1A 4GTQA 3UT4A 3Q79A 3B95A 5LOZA 4UI9C 4DK5A 3RK6A 1TNOA 3LY9A 3ASNE 5EIDA 1RZ4A 4M7CA 2FULA 4N3AA 2QY7A 2ZGDA 3ULEG 2XHEA 3L54A 5CBNA 1FT2A 2IY0C 3B7SA 2OV8A 4EQFA 2IOSA 1EF1C 2OOEA 5CEDB 4DX5D 5FQ6A 1V54E 1TJCA 3R9MA 3Q15A 4HNAD 5BV0A 1E7VA 1DCEA 1BD8A 2GRMA 4AY5A 4CRWA 3DSVA 4JEUA 1S0PA 5EYPF 4IRUA 5FQ4A 4F3VA 4WNEA 4BTBA 4AIFA 3CVWA 4GAAA 5D2MC 1NA3A 3L08A 5FQ8A 4UUCA 4Y6CA 4XKBA 1AP7A 2AWIA 4AXHA 3V31A 4JC8A 2KXPC 2CHXA 2I1JA 2ZGGA 2KC7A 4RG9A 3U66A 3OXLA 1H6PA 3AS8A 1D8DA 3TWQA 2OCCE 5J90A 5ANLA 3T8MA 3URZA 3FUJA 5BUZA 1RW2A 2VJ8A 4GA1A 3JUEA 3R7QA 4L2LA 4WAFA 5ENTD 4CEMA 3TGOA 5FIOA 2YQ8A 2RKKA 2NSZA 5ANRA 4Z68A 1INZA 4GTSA 4YDWA 4XE0A 2I1KA 3ZXPA 3PNTB 2AVPA 3P2BA 5HRYA 2L6JA 1E8YA 2ZIRA 1JUQA 3SI5A 4EBAA 2X6KA 1E8XA 5LCWC 5ENSD 2VGXA 4KVOA 2B0OE 4GYWA 4AY6A 1FVFA 4GYYA 1EDUA 3DBSA 1JCQA 3JXIA 5JHBA 4I1MA 2V5QC 4HLEA 1QQEA 2WB2A 3S7DA 2XEHA 3CVPA 3NAWA 2WXIA 4P29A 3Q73A 3PUKA 4UQZA 3ZYKA 1O1RA 1B89A 4I9CA 2EINE 4I9EA 4JL0A 4MLPA 1LF8A 4N5QA 5M72A 3R9AB 1U3CA 3APFA 4WWNA 4I1OB 2DIWA 4I2ZA 1UN9A 2IU1A 5KJLA 4G1TA 3TG4A 2P9LG 1E90A 5LFAA 1H2UA 3ZYQA 1NFIE 1HE8A 4PS8A 4LUNU 2UY1B 4AV7A 5B1AE 1PC2A 2YHCA 5EDSA 3NZUA 2Y1LE 2XPZA 2J07A 4WNFA 2R59A 1MHQA 3UIOC 3FEXA 3PZ3A 1PAQA 3QKYA 3S7FA 2R03A 5FINA 3TWVA 3UUXA 3FUHA 3TWXA 3ZHEB 3DEPA 4HOQA 4GB9A 2KBXA 3PREA 3PZ2A 2PM6A 1Z3XA 5AQBA 2X6HA 4L2YA 1A17A 5CMYA 1ZBPA 3AAAC 1E8ZA 4UWFA 3PS6A 5FZQA 2IEJA 5G04J 3MGBA 5T8IA 4QQIA 1E7UA 4MKTA 4CGWA 5CCMA 4OAUC 4X8QA 3BQOA 1DVPA 4TUUA 3RKVA 2X6IA 3AG3E 5JA4D 2LNIA 3AG4E 2VSOE 4U0SA 4BWRA 2LXLA 3DSXA 5BXOA 3HXBA 2P9IG 3SBSA 3GYZA 4PH4B 5E75A 2I2OA 4PUCA 2KCVA 3IHVA 1H6OA 3G2WA 2JLBA 3Q5MA 2L0TB 3QWWA 2DVWA 5ITZF 3ZN3A 2AXZA 4NURA 2LO6A 3LYAA 3MZLB 2XGOA 4HLLA 3NF1A 3SHFA 4EECA 2WXMA 3ZRHA 4A3TA 2ZISA 4AVXA 3MKRA 1BU9A 2C2LA 2XS1A 4I43A 2GGFA 2VQ2A 2WXGA 5JJTA 3ESKA 3ONKA 4ANXA 2F8XK 4I6JA 2JABA 4F6RD 3ZGQA 1SA5A 4GPKA 3X2QE 2QYJA 3HXCA 2XQ0A 3ISMC 3BEEA 3TL5A 4J6IA 2KATA 3UM0A 4I17A 1YA0A 1TNUA 3CQGB 1S70B 4H7YA 4U8YD 3MA5A 3G2TA 3E32A 3FH7A 2YINA 3MKQB 3JUIA 4FJZA 4N5CA 3RRUA 2WQHA 4YVOA 4GTTA 4U7EB 1O1SA 2X38A 4UWHA 1ELKA 3UQ3A 1NP7A 1OY3D 1OCOE 3PH0C 3PZDA 2VSNA 3D9PA 3CVXA 2FEZA 3AS5A 3QARA 5LX8A 3CK9A 2QFCA 3NB2A 4JPSA 2XRYA 4GYOA 2JEKA 4BFRA 3E34A 2AJAA 1D9SA 5KNGA 3LEWA 1N9AA 4HOTA 3IXEA 3ENEA 5J08A 1H6KA 3LY8A 4ZHBA 3LCAA 4ANUA 3Q7FA 3CHRA 4B8CB 2QYUA 4I2WA 4NIKA 4G2VA 1NL4A 5FZRA 4A63B 3FHEA 1XNFA 3AU5A 2BKGA 4F1PA 1S64A 3CVNA 2J8SD 4TXPA 3FP3A 2LUHA 1U3DA 2WXHA 3PDNA 2WQ6A 4YDYA 4UWGA 1OUVA 2BKKB 2LSUA 5CRUA 3SF4A 4MS6A 2QZAA 1H0AA 3ZU7B 5G55A 4U07A 2RFMA 5CHEE 4O1OA 5AQAA 4DI3A 3ASGA 3L82A 4N3BA 1MX6A 1NZNA 1SVXA 4XEIG 1IHGA 3V30A 2DCPA 4CDMA 4WWOA 2EIME 1OCRE 1HG2A 3CEQA 5BW8C 2WXPA 1Z5SC 3Q75A 3OAWA 1Y6IA 4Y6WA 3AG1E 2L6BA 5ENOD 2UY1A 4BEPA 3MYVA 1UJJA 4ZFHA 2J4DA 1SZAA 3OXFA 4JD2G 4F53A 1TEZA 3JYSA 4XIFA 3NQPA 3EJNA 5JMND 4YVQC 4V3IA 3CHQA 4JEHA 5ARGA 3WG7E 2C0MA 1JPLA 1PY1A 3APDA 3AS4A 4M3OA 4ANWA 3TWTA 2XZDG 4K5CA 4K03A 4JVSA 3DSUA 4A3VA 2BUGA 2ETAA 3Q7AA 3FTXA 4ILIA 5CEAA 4A55A 2P9SG 3FFLA 5CCLA 3GZ1A 3HDXA 2VTBA 4L9PA 3UX4A 1HFAA 5C1DA 5G2NA 1E96B 4YDEA 3QWVA 3U4TA 2KZTA 2IONA 4ABNA 3ZIMA 4ANVA 5EX3A 2I9CA 4BX9A 2WXOA 3TWWA 3FEYA 4FADA 4JHRA 5ENQD 5CMWA 4JW1A 4XI9A 4UWKA 5EYLA 5HS0A 4DRXE 5AYWD 4HS2A 5HKPA 3E30A 3PE4A 4LNGA 1K3ZD 3TWSA 4LEUA 2E2EA 3FTSA 5JJ7A 3FTYA 4NQ0A 3SGHA 2HR2A 3PNLB 3FU0A 3TJPA 1OWLA 3C5RA 2XPIA 4ME2A 2F37A 4DPRA 3D9OA 4K5BA 1TNYA 2PQNA 2XGSA 2V8SE 4N3CA 4BSXA 1Y8MA 2QC9A 3AU4A 4RSYA 1N94A 3VTYA 2NXPA 3TG5A 4JA7A 3EU5A 3CHSA 4J8DA 3UT7A 3DSTA 1KZOA 1IXVA 3SNXA 5AAOA 5JHAA 5D0OD 3HHMA 4EZKA 5FJYA 4HB5A 3CHMA 3HIZA 2A5UA 4GA2A 1UW4B 4J7WA 3RO3A 4W9RA 2AW6A 4DLOA 3MKQA 3ML8A 3ASOE 2IF4A 3ESLA 4KZCA 4XZ4A 5AENA 2J08A 4GCNA 2PQRA 2EIKE 5EIBE 3FTUA 3WXXA 4B93B 4GZCA 1W3BA 3U3WA 2C0LA 3CVLA 4HRLA 2H6FA 4O6FA 1N11A 3MCXA 4KXKB 3SD5A 1D8EA 1BI7B 3Q78A 4AM9A 1MJ0A 2XPYA 2XRZA 2WVIA 4CYMD 3UKUG 2YNQA 3T5XA 4ATZD 4O60A 1HH8A 1NI1A 4GMLA 3FU6A 4JHJA 3VLFA 3ZYMA 1N54A 1H19A 5KJMA 5CRVA 4KT6B 3EDTB 2DBAA 3RIBA 1KLXA 4JZYA 3DRAA 3DWLG 1YCSB 3ABKE 2EILE 4I1AA 4EZLA 4GZ3A 4HOUA 5ARFA 3ZW3A 4PDXA 3FH8A 5T3RA 3MV2B 2GRRB 3TWUA 3CLJA 4RLYA 3MEKA 4LERA 4AEZC 4JHKA 3CKBA 3CVQA 3ZXSA 3Q49B 1SQMA 3Q4AB 2FBNA 4BERA 5KWDA 3KEZA 2H6GA 3HRAA 4GU5A 3QOUA 4EBAG 2Y69E 3BU8A 4G8LA 1K8KG 1N4SA 3KS2A 4Q69A 5BXUA 3LJ3A 1N0QA 3CSFA 3EHQA 4CCAA 4J8SA 3L22A 4LNBA 2BF0X 4U04A 3APCA 3FDHA 1QZ2A 4DI4A 3ZUVB 3D9IA 5LP0A 4U95D 5T4YA 2R2LA 1EYHA 1YYHA 1S63A 1MX2A 3CQCB 1N4PA 4GCOA 3FTWA 4G26A 3RAUA 2H6IA 3EHRA 4L1BA 1OT8A 5D0QD 3C3OA 3EIJA 4GPMA 5G05J 2EIJE 3FUKA 4UQYA 2CG2A 2R17C 4TXRA 2ILRA 3D9MA 4G23A 3HVEA 2CG3A 3B7RL 3NBNB 3P1UA 3UM3A 4J8FA 3ABLE 3IEGA 2AXUA 4L7TA 5H7PA 2GRNB 1FVHA 2OVBA 1IQUA 4AJWA 3V79K 2CFUA 4NACA 3PRZA 4MRUA 2NYJA 4GTPA 3O48A 2MRIA 4IN3B 4PS7A 3UM2A 1WAO1 1DCQA 3S7JA 3NOCD 3Q47B 3PVLA 3UXGA 2WXFA 3NOGD 4FC8A 4A1GA 4MBGA 2Q7FA 1MYOA 3FH5A 2VTBB 3LY7A 1UG3A 2BEDA 1O1TA 4LG6A 2RFAA 3PUJA 4R7LA 4C0MA 1P5QA 1ELRA 4G25A 4GMJA 3D9NA 4CDRA 3K9IA 2HYZA 4F7AA 2PZIA 3FU5A 3ZHEA 3HYMB 5BNWA 4HORA 2FF4A 4L23A 5AQ7A 3CSTA 3D9KA 3KSLA 2UWJG 3CVUA 4C9BB 3B13A 3LJNA 2IO2C 3CKCA 4GTRA 2J49A 1N4QA 4DX7D 5FZSA 4FLBA 4PS3A 4CT0A 1HS6A 1HF8A 3R7RA 3BUAA 1IKND 4LSZE 4DX6D 1K1BA 3S7BA 3ULYA 1SA4A 3KSQA 3AG2E 2MHKA 3GZ2A 2Y3AA 2J09A 1ZB1A 2P9UG 4TRQA 2WPVA 2R5SA 3PEVB 2RD0A 5BPPA 4GTMA 2HE0A 4BY6A 1MQSA 3I4GA 1IYGA 1H2TC 4CZ2D 4DJAA 4O1PA 2WXQA 2XGMA 1TYQG 1TNZA 1OWPA 4TUMA 3FU3A 3B7BA 2OEVA 3CIAA 3DXMG 4YNDA 2WMOA 4BT8A 4U0ZA 2KCLA 4RG6A 5C2YA 3LPZA 4F1SA 4HVBA 3RRMB 4IYPA 3IHYA 3ZKJA 2DWZA 3TWRA 3IKOB 3G2VA 2KCKA 4WNGA 3ML9A 1DNPA 4N2QA 1KPSB 1TR4A 3ULQA 3V2OA 3UT8A 3O4ZA 3QK0A 2I6HA 2YHEA 3DSSA 4DUIA 2V4HC 3N71A 2VGXB 3EU9A 5KCMA 1HXIA 5BV1A 1IQRA 3GW4A 3UKRG 2R05A 2X6FA 3JQ1A 3FY4A 3FULA 3DPYA 2GRPB 4I6EA 2M63A 3QB2A 3CVVA 2XENA 3AJIA 1FT1A 1HG5A 2E0IA 3MV3B 3JCKC 4ILHB 3VLDA 3UM1A 3E37A 3EUVA 3SO8A 1TN8A 3D9JA 3HXDA 3ZPJA 3UI2A 3LVRE 5A6CA 5AARA 1VDYA 2PL2A 1LD8A 2ETCA 4GMRA 2LXMA 1Z3YA 1ZU2A 3Q9NC 4FLHA 2WXLA 4UI9K 4KMOA 3U9WA 3CV0A 1QBQA 1MZCA 3SY2A 4KZ0A 5CERB 4FHJA 3L16A 1JWFA 1UOHA 3D3MA 3QDNA 4U0UA 1N4RA 3RJVA 4APFA 1NA0A 4Q94A 2XCCA 3IV0A 2P9PG 4XI0A 5HI7A 3J5PA 5B3SE 2J4BA 3W9GA 4EZJA 3ASDA 4GZDA 4WWPA 1SZ9A 3ZFWA 1KZPA 3DXKG 1OWOA 3PE3A 4J8YA 1WY6A 2F0YA 2VGYA 1EPUA 4CDNA 3ZEFA 2HM8A 3T5VA 3JXJA 5G04C 2WMNA 4HXIA 3B7UX 3I4RB 1HU3A 5AJDA 1X81A 1L5JA 3VLEA 2VSXE 4UI9J 2GW1A 5D66A 5KJNA 3FTVA 3JQ0A 1KT0A 3Q9UC 5ENNA 2V4LA 1BLXB 2KM4A 3OTNA 3EHMA 2XZTG 4BX8A 3KEAA 4WNDA 4HRNA 3RU0A 3SFXA 2P9KG 3LXUX 1GW6A 1AWCB 2FO1E 5E76A 1XGWA 4C48B 1JCRA 4K5AB 4DLQA 2GROB 1BPOA 1LD7A 1A5EA 5FWQA 4ACKA 5LCWJ 2A4ZA 1SW6A 1TJFA 1HZ4A 3C72A 4FJYA 3LKUA 3FUEA 1O5MA 5DIZA 1KT1A 4XKCA 2IO3C 1V55E 2EQXA 2GRQB 4HRMB 3ASHA 2WXKA 3KAEA 2DYRE 3SFYA 4NRHB 4UQXA 4TXQA 1IHBA 3W9FA 1N52A 3PEUB 1TN7A 3F6QA 2J9QA 3G2SA 1H2VC 1E8WA 5EKQD 5B1BE 4HOSA 3DEOA 2P58C 3LDZA 2OEWA 4UWLA 3MX3A 2ONDA 3J5QB 4OAVB 3ONLA 3FUMA 3CGHA 5ENPD 2GRLA 2XEVA 2OVFA 4ILGA 4LNUD 1MX4A 3UIPC 3HXEA 1X5BA 1HO8A 4U8HA 1DC2A 4HI8A 3T8KA 4B89A 4LRZA 2RG8A 2Y4TA 4G24A 5CBOA 4FU3A 4FHKA 4JXTA 2A5EA 3I5PA 3RRNB 3CK8A 5FQ7A 3KD7A 2IFUA 4J0UA 5AIJA 4BTAA 3E33A 5EILA 4E85A 4JA9A 4CGVA 4AP2A 4ATGA 2B6CA 1Q2ZA 2CFZA 3LVQE 1G3NB 2XS8A 1QNFA 4KYOB 1JWGA 3NZSA 4LCTA 3U64A 4WUYA 3ZYLA 4APOA 2L0IA 1QYMA 3ZNGA 4D10C 2F8YA 4U63A 3FUNA 2PNNA 4DX2A 4I6GA 4KVMA 1N95A 1Z6TA 3FWVA 2V5FA 4EPZA 4FA6A 5AJLA 2HO1A 2CHWA 1WG0A 3GZSA 4EHMA 4RVBA 4RQIA 4GZ5A 4GZ6A 3D9HA 1TNBA 2X6JA 2DYSE 4ACLA 3FUFA 4B94A 3HXFA 4JB8P 1ELWA 2BTDA 3LS8A 4BETA 4J8EA 1WM5A 3L17A 3CR3A 1K1AA 3RO2A 5FT9A 4QFVA 4A1SA 4TV3A 3SBTB 5A23A 2VSYA 5FTPA 3T9KA 3L6AA 4B0ZA 3QJZA 1OWMA 2CHZA 5JJ6A 4BESA 3CHOA 3HG0D 4BSZB 3C98A 3QNKA 2AXVA 2NC9A 2H6HA 3SZ7A 2WXNA 3EIQC 5A7DB 3UTMA 2LAIA 1OCZE 5EN5D 2IOLA 4B8AA 4GA0A 2FI7A 3QAQA 3FUIA 2IQCA 2XCBA 3QWPA 2P2CP 2VGEA 2WM9A 2L9BA 4OYSA 2ETBA 3G2UA 1TN6A 2ZXWE 3PZ4A 4G11A 3L13A
chains in the Genus database with same CATH topology
3JXJA 4BERA 5KWDA 3NOGD 2RFMA 2DZNA 3HRAA 4O1OA 5AQAA 3TWQA 4G8LA 3J5QB 4J7WA 4OAVB 3JUEA 5BXOA 2HE0A 3D9HA 1MX6A 1OY3D 1SVXA 3SO8A 1MYOA 5ENTD 4CZ2D 5D66A 5ENPD 5BXUA 4JB8P 3V30A 3TWTA 1N0QA 4LNUD 4O1PA 3TWWA 3Q9UC 1NFIE 3V2XA 5FIOA 3EHQA 5EIBE 3UI2A 4TUMA 1BLXB 1MX4A 3B7BA 5ENRD 4LG6A 5ENQD 4B93B 4BETA 2RFAA 4U8VD 5EYLA 5AARA 5HS0A 4Z68A 2XZTG 4DRXE 4YDWA 3B95A 2DVWA 3KEAA 2ETCA 4GMRA 4HRLA 1DC2A 1K1AA 3ZUVB 5ITZF 4HRNA 1N11A 4HI8A 5HKPA 2AJAA 1D9SA 3T8KA 4QFVA 4U96D 4U95D 5KNGA 2Y1LE 5EIDA 5HRYA 4HLLA 3Q9NC 1AWCB 1YYHA 3IXEA 1K3ZD 1BI7B 1MX2A 5CBOA 3TWSA 5AN8A 1MJ0A 5KNHD 2FO1E 5AQ7A 2L6BA 4CYMD 4HI9A 5ENOD 2A5EA 2ZGDA 4C48B 4HQDA 4K5AB 3T9KA 5ENSD 3ZKJA 2DWZA 4ZHBA 5CBNA 3TWRA 3EHRA 2B0OE 1OT8A 4BEPA 4GPMA 5KBAA 2Y0BG 1BU9A 1YMPA 4ZFHA 5FINA 3TWVA 4ATZD 2MYOA 4O60A 3TWXA 3C5RA 3DEPA 1TR4A 2F37A 5CEDB 5CERB 5EILA 1A5EA 3V2OA 4BESA 1BI8B 3LJNA 4K5BA 4NIKA 2KBXA 5AQ9A 4DX5D 2F8XK 1UOHA 3JXIA 1SW6A 4HNAD 2JABA 1G3NB 4DUIA 2V4HC 5AQBA 4A63B 4F6RD 3HG0D 4BSZB 2V5QC 4DX7D 1BD8A 5JMND 3EU9A 2QC9A 2XEHA 2BKGA 2QYJA 4DX1A 4F1PA 5EYPF 2J8SD 3AAAC 3UTMA 4HRMB 5EN5D 3NBNB 1YCSB 1WDYA 4QQIA 1IKND 2DZOA 3J5PA 1QYMA 1N0RA 4LSZE 2XZDG 4K5CA 4YDYA 1K1BA 2F8YA 1S70B 3ZNGA 4DX6D 3W9GA 2BKKB 1IXVA 4U8YD 4UUCA 5AAOA 1AP7A 4OAUC 2ETAA 1IHBA 2XEEA 3W9FA 2PNNA 2XENA 2P2CP 2VGEA 3AJIA 4RLYA 3TWUA 4HB5A 4DX2A 5CECB 3V79K 5CEAA 2NYJA 3F6QA 2ETBA 4N5QA 4G8KA 3V31A 2KXPC 3ZU7B 4J8YA 4HBDA 1DCQA 5JA4D 3DEOA 2ZGGA 3NOCD 3UXGA 1WG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXJ A;  4BER A;  5KWD A;  3NOG D;  2RFM A;  2DZN A;  3HRA A;  4O1O A;  5AQA A;  3TWQ A;  4G8L A;  3J5Q B;  4J7W A;  4OAV B;  3JUE A;  5BXO A;  2HE0 A;  3D9H A;  1MX6 A;  1OY3 D;  1SVX A;  3SO8 A;  1MYO A;  5ENT D;  4CZ2 D;  5D66 A;  5ENP D;  5BXU A;  4JB8 P;  3V30 A;  3TWT A;  1N0Q A;  4LNU D;  4O1P A;  3TWW A;  3Q9U C;  1NFI E;  3V2X A;  5FIO A;  3EHQ A;  5EIB E;  3UI2 A;  4TUM A;  1BLX B;  1MX4 A;  3B7B A;  5ENR D;  4LG6 A;  5ENQ D;  4B93 B;  4BET A;  2RFA A;  4U8V D;  5EYL A;  5AAR A;  5HS0 A;  4Z68 A;  2XZT G;  4DRX E;  4YDW A;  3B95 A;  2DVW A;  3KEA A;  2ETC A;  4GMR A;  4HRL A;  1DC2 A;  1K1A A;  3ZUV B;  5ITZ F;  4HRN A;  1N11 A;  4HI8 A;  5HKP A;  2AJA A;  1D9S A;  3T8K A;  4QFV A;  4U96 D;  4U95 D;  5KNG A;  2Y1L E;  5EID A;  5HRY A;  4HLL A;  3Q9N C;  1AWC B;  1YYH A;  3IXE A;  1K3Z D;  1BI7 B;  1MX2 A;  5CBO A;  3TWS A;  5AN8 A;  1MJ0 A;  5KNH D;  2FO1 E;  5AQ7 A;  2L6B A;  4CYM D;  4HI9 A;  5ENO D;  2A5E A;  2ZGD A;  4C48 B;  4HQD A;  4K5A B;  3T9K A;  5ENS D;  3ZKJ A;  2DWZ A;  4ZHB A;  5CBN A;  3TWR A;  3EHR A;  2B0O E;  1OT8 A;  4BEP A;  4GPM A;  5KBA A;  2Y0B G;  1BU9 A;  1YMP A;  4ZFH A;  5FIN A;  3TWV A;  4ATZ D;  2MYO A;  4O60 A;  3TWX A;  3C5R A;  3DEP A;  1TR4 A;  2F37 A;  5CED B;  5CER B;  5EIL A;  1A5E A;  3V2O A;  4BES A;  1BI8 B;  3LJN A;  4K5B A;  4NIK A;  2KBX A;  5AQ9 A;  4DX5 D;  2F8X K;  1UOH A;  3JXI A;  1SW6 A;  4HNA D;  2JAB A;  1G3N B;  4DUI A;  2V4H C;  5AQB A;  4A63 B;  4F6R D;  3HG0 D;  4BSZ B;  2V5Q C;  4DX7 D;  1BD8 A;  5JMN D;  3EU9 A;  2QC9 A;  2XEH A;  2BKG A;  2QYJ A;  4DX1 A;  4F1P A;  5EYP F;  2J8S D;  3AAA C;  3UTM A;  4HRM B;  5EN5 D;  3NBN B;  1YCS B;  1WDY A;  4QQI A;  1IKN D;  2DZO A;  3J5P A;  1QYM A;  1N0R A;  4LSZ E;  2XZD G;  4K5C A;  4YDY A;  1K1B A;  2F8Y A;  1S70 B;  3ZNG A;  4DX6 D;  3W9G A;  2BKK B;  1IXV A;  4U8Y D;  4UUC A;  5AAO A;  1AP7 A;  4OAU C;  2ETA A;  1IHB A;  2XEE A;  3W9F A;  2PNN A;  2XEN A;  2P2C P;  2VGE A;  3AJI A;  4RLY A;  3TWU A;  4HB5 A;  4DX2 A;  5CEC B;  3V79 K;  5CEA A;  2NYJ A;  3F6Q A;  2ETB A;  4N5Q A;  4G8K A;  3V31 A;  2KXP C;  3ZU7 B;  4J8Y A;  4HBD A;  1DCQ A;  5JA4 D;  3DEO A;  2ZGG A;  3NOC D;  3UXG A;  1WG0 A; 
#chains in the Genus database with same CATH topology
 2WXJ A;  3BG1 B;  3QC1 A;  3OXG A;  3BG0 B;  5IY5 E;  2WXR A;  3CHP A;  1FPP A;  4OVV A;  3MJW A;  2FO7 A;  2ZU6 B;  4U8V D;  3DSW A;  2KZT B;  2R02 A;  1FCH A;  1JCS A;  2X3M A;  3UIN C;  3UPV A;  3B7T A;  4C0E A;  2LSV A;  5DBK A;  4U96 D;  1HX8 A;  4N39 A;  3I3N A;  1UN8 A;  5AN8 A;  5KNH D;  4HI9 A;  5HQ8 A;  3VTX A;  4HQD A;  5G05 C;  3C3Q A;  3L9T A;  1UJK A;  3HVE B;  5KBA A;  2Y0B G;  1YMP A;  4H7X A;  2MYO A;  1LTX A;  4URK A;  3UMV A;  1BI8 B;  5AQ9 A;  1OXJ A;  3TAX A;  3CK7 A;  4OVU A;  3FUD A;  4XX5 A;  4DX1 A;  2IJG X;  4CT4 A;  3DPD A;  4AOF A;  5KJK A;  3ASF A;  3TXN A;  4FP7 A;  3RSE G;  4K0R A;  3SQV A;  1U2V G;  3S2A A;  1WDY A;  2DZO A;  1N0R A;  3PZ1 A;  4FUL A;  3C3R A;  2XEE A;  3FTZ A;  3ZVV A;  4HFG A;  4Q96 A;  3IBE A;  5CEC B;  2LAH A;  2MOW A;  4GTO A;  4G8K A;  2Y4U A;  4HBD A;  3TXM A;  3ABM E;  1OWN A;  3CVY A;  4E6H A;  2DZN A;  3EHN A;  4IUL A;  4KBQ A;  3E4B A;  4GTV A;  3D9L A;  2P9N G;  4YDO A;  5EX0 A;  3SFZ A;  2PM7 A;  2WQ7 A;  2V0P A;  4N2S A;  3V2X A;  4BT9 A;  2VYI A;  5ENR D;  1OCC E;  5BT1 A;  4GTQ A;  3UT4 A;  3Q79 A;  3B95 A;  5LOZ A;  4UI9 C;  4DK5 A;  3RK6 A;  1TNO A;  3LY9 A;  3ASN E;  5EID A;  1RZ4 A;  4M7C A;  2FUL A;  4N3A A;  2QY7 A;  2ZGD A;  3ULE G;  2XHE A;  3L54 A;  5CBN A;  1FT2 A;  2IY0 C;  3B7S A;  2OV8 A;  4EQF A;  2IOS A;  1EF1 C;  2OOE A;  5CED B;  4DX5 D;  5FQ6 A;  1V54 E;  1TJC A;  3R9M A;  3Q15 A;  4HNA D;  5BV0 A;  1E7V A;  1DCE A;  1BD8 A;  2GRM A;  4AY5 A;  4CRW A;  3DSV A;  4JEU A;  1S0P A;  5EYP F;  4IRU A;  5FQ4 A;  4F3V A;  4WNE A;  4BTB A;  4AIF A;  3CVW A;  4GAA A;  5D2M C;  1NA3 A;  3L08 A;  5FQ8 A;  4UUC A;  4Y6C A;  4XKB A;  1AP7 A;  2AWI A;  4AXH A;  3V31 A;  4JC8 A;  2KXP C;  2CHX A;  2I1J A;  2ZGG A;  2KC7 A;  4RG9 A;  3U66 A;  3OXL A;  1H6P A;  3AS8 A;  1D8D A;  3TWQ A;  2OCC E;  5J90 A;  5ANL A;  3T8M A;  3URZ A;  3FUJ A;  5BUZ A;  1RW2 A;  2VJ8 A;  4GA1 A;  3JUE A;  3R7Q A;  4L2L A;  4WAF A;  5ENT D;  4CEM A;  3TGO A;  5FIO A;  2YQ8 A;  2RKK A;  2NSZ A;  5ANR A;  4Z68 A;  1INZ A;  4GTS A;  4YDW A;  4XE0 A;  2I1K A;  3ZXP A;  3PNT B;  2AVP A;  3P2B A;  5HRY A;  2L6J A;  1E8Y A;  2ZIR A;  1JUQ A;  3SI5 A;  4EBA A;  2X6K A;  1E8X A;  5LCW C;  5ENS D;  2VGX A;  4KVO A;  2B0O E;  4GYW A;  4AY6 A;  1FVF A;  4GYY A;  1EDU A;  3DBS A;  1JCQ A;  3JXI A;  5JHB A;  4I1M A;  2V5Q C;  4HLE A;  1QQE A;  2WB2 A;  3S7D A;  2XEH A;  3CVP A;  3NAW A;  2WXI A;  4P29 A;  3Q73 A;  3PUK A;  4UQZ A;  3ZYK A;  1O1R A;  1B89 A;  4I9C A;  2EIN E;  4I9E A;  4JL0 A;  4MLP A;  1LF8 A;  4N5Q A;  5M72 A;  3R9A B;  1U3C A;  3APF A;  4WWN A;  4I1O B;  2DIW A;  4I2Z A;  1UN9 A;  2IU1 A;  5KJL A;  4G1T A;  3TG4 A;  2P9L G;  1E90 A;  5LFA A;  1H2U A;  3ZYQ A;  1NFI E;  1HE8 A;  4PS8 A;  4LUN U;  2UY1 B;  4AV7 A;  5B1A E;  1PC2 A;  2YHC A;  5EDS A;  3NZU A;  2Y1L E;  2XPZ A;  2J07 A;  4WNF A;  2R59 A;  1MHQ A;  3UIO C;  3FEX A;  3PZ3 A;  1PAQ A;  3QKY A;  3S7F A;  2R03 A;  5FIN A;  3TWV A;  3UUX A;  3FUH A;  3TWX A;  3ZHE B;  3DEP A;  4HOQ A;  4GB9 A;  2KBX A;  3PRE A;  3PZ2 A;  2PM6 A;  1Z3X A;  5AQB A;  2X6H A;  4L2Y A;  1A17 A;  5CMY A;  1ZBP A;  3AAA C;  1E8Z A;  4UWF A;  3PS6 A;  5FZQ A;  2IEJ A;  5G04 J;  3MGB A;  5T8I A;  4QQI A;  1E7U A;  4MKT A;  4CGW A;  5CCM A;  4OAU C;  4X8Q A;  3BQO A;  1DVP A;  4TUU A;  3RKV A;  2X6I A;  3AG3 E;  5JA4 D;  2LNI A;  3AG4 E;  2VSO E;  4U0S A;  4BWR A;  2LXL A;  3DSX A;  5BXO A;  3HXB A;  2P9I G;  3SBS A;  3GYZ A;  4PH4 B;  5E75 A;  2I2O A;  4PUC A;  2KCV A;  3IHV A;  1H6O A;  3G2W A;  2JLB A;  3Q5M A;  2L0T B;  3QWW A;  2DVW A;  5ITZ F;  3ZN3 A;  2AXZ A;  4NUR A;  2LO6 A;  3LYA A;  3MZL B;  2XGO A;  4HLL A;  3NF1 A;  3SHF A;  4EEC A;  2WXM A;  3ZRH A;  4A3T A;  2ZIS A;  4AVX A;  3MKR A;  1BU9 A;  2C2L A;  2XS1 A;  4I43 A;  2GGF A;  2VQ2 A;  2WXG A;  5JJT A;  3ESK A;  3ONK A;  4ANX A;  2F8X K;  4I6J A;  2JAB A;  4F6R D;  3ZGQ A;  1SA5 A;  4GPK A;  3X2Q E;  2QYJ A;  3HXC A;  2XQ0 A;  3ISM C;  3BEE A;  3TL5 A;  4J6I A;  2KAT A;  3UM0 A;  4I17 A;  1YA0 A;  1TNU A;  3CQG B;  1S70 B;  4H7Y A;  4U8Y D;  3MA5 A;  3G2T A;  3E32 A;  3FH7 A;  2YIN A;  3MKQ B;  3JUI A;  4FJZ A;  4N5C A;  3RRU A;  2WQH A;  4YVO A;  4GTT A;  4U7E B;  1O1S A;  2X38 A;  4UWH A;  1ELK A;  3UQ3 A;  1NP7 A;  1OY3 D;  1OCO E;  3PH0 C;  3PZD A;  2VSN A;  3D9P A;  3CVX A;  2FEZ A;  3AS5 A;  3QAR A;  5LX8 A;  3CK9 A;  2QFC A;  3NB2 A;  4JPS A;  2XRY A;  4GYO A;  2JEK A;  4BFR A;  3E34 A;  2AJA A;  1D9S A;  5KNG A;  3LEW A;  1N9A A;  4HOT A;  3IXE A;  3ENE A;  5J08 A;  1H6K A;  3LY8 A;  4ZHB A;  3LCA A;  4ANU A;  3Q7F A;  3CHR A;  4B8C B;  2QYU A;  4I2W A;  4NIK A;  4G2V A;  1NL4 A;  5FZR A;  4A63 B;  3FHE A;  1XNF A;  3AU5 A;  2BKG A;  4F1P A;  1S64 A;  3CVN A;  2J8S D;  4TXP A;  3FP3 A;  2LUH A;  1U3D A;  2WXH A;  3PDN A;  2WQ6 A;  4YDY A;  4UWG A;  1OUV A;  2BKK B;  2LSU A;  5CRU A;  3SF4 A;  4MS6 A;  2QZA A;  1H0A A;  3ZU7 B;  5G55 A;  4U07 A;  2RFM A;  5CHE E;  4O1O A;  5AQA A;  4DI3 A;  3ASG A;  3L82 A;  4N3B A;  1MX6 A;  1NZN A;  1SVX A;  4XEI G;  1IHG A;  3V30 A;  2DCP A;  4CDM A;  4WWO A;  2EIM E;  1OCR E;  1HG2 A;  3CEQ A;  5BW8 C;  2WXP A;  1Z5S C;  3Q75 A;  3OAW A;  1Y6I A;  4Y6W A;  3AG1 E;  2L6B A;  5ENO D;  2UY1 A;  4BEP A;  3MYV A;  1UJJ A;  4ZFH A;  2J4D A;  1SZA A;  3OXF A;  4JD2 G;  4F53 A;  1TEZ A;  3JYS A;  4XIF A;  3NQP A;  3EJN A;  5JMN D;  4YVQ C;  4V3I A;  3CHQ A;  4JEH A;  5ARG A;  3WG7 E;  2C0M A;  1JPL A;  1PY1 A;  3APD A;  3AS4 A;  4M3O A;  4ANW A;  3TWT A;  2XZD G;  4K5C A;  4K03 A;  4JVS A;  3DSU A;  4A3V A;  2BUG A;  2ETA A;  3Q7A A;  3FTX A;  4ILI A;  5CEA A;  4A55 A;  2P9S G;  3FFL A;  5CCL A;  3GZ1 A;  3HDX A;  2VTB A;  4L9P A;  3UX4 A;  1HFA A;  5C1D A;  5G2N A;  1E96 B;  4YDE A;  3QWV A;  3U4T A;  2KZT A;  2ION A;  4ABN A;  3ZIM A;  4ANV A;  5EX3 A;  2I9C A;  4BX9 A;  2WXO A;  3TWW A;  3FEY A;  4FAD A;  4JHR A;  5ENQ D;  5CMW A;  4JW1 A;  4XI9 A;  4UWK A;  5EYL A;  5HS0 A;  4DRX E;  5AYW D;  4HS2 A;  5HKP A;  3E30 A;  3PE4 A;  4LNG A;  1K3Z D;  3TWS A;  4LEU A;  2E2E A;  3FTS A;  5JJ7 A;  3FTY A;  4NQ0 A;  3SGH A;  2HR2 A;  3PNL B;  3FU0 A;  3TJP A;  1OWL A;  3C5R A;  2XPI A;  4ME2 A;  2F37 A;  4DPR A;  3D9O A;  4K5B A;  1TNY A;  2PQN A;  2XGS A;  2V8S E;  4N3C A;  4BSX A;  1Y8M A;  2QC9 A;  3AU4 A;  4RSY A;  1N94 A;  3VTY A;  2NXP A;  3TG5 A;  4JA7 A;  3EU5 A;  3CHS A;  4J8D A;  3UT7 A;  3DST A;  1KZO A;  1IXV A;  3SNX A;  5AAO A;  5JHA A;  5D0O D;  3HHM A;  4EZK A;  5FJY A;  4HB5 A;  3CHM A;  3HIZ A;  2A5U A;  4GA2 A;  1UW4 B;  4J7W A;  3RO3 A;  4W9R A;  2AW6 A;  4DLO A;  3MKQ A;  3ML8 A;  3ASO E;  2IF4 A;  3ESL A;  4KZC A;  4XZ4 A;  5AEN A;  2J08 A;  4GCN A;  2PQR A;  2EIK E;  5EIB E;  3FTU A;  3WXX A;  4B93 B;  4GZC A;  1W3B A;  3U3W A;  2C0L A;  3CVL A;  4HRL A;  2H6F A;  4O6F A;  1N11 A;  3MCX A;  4KXK B;  3SD5 A;  1D8E A;  1BI7 B;  3Q78 A;  4AM9 A;  1MJ0 A;  2XPY A;  2XRZ A;  2WVI A;  4CYM D;  3UKU G;  2YNQ A;  3T5X A;  4ATZ D;  4O60 A;  1HH8 A;  1NI1 A;  4GML A;  3FU6 A;  4JHJ A;  3VLF A;  3ZYM A;  1N54 A;  1H19 A;  5KJM A;  5CRV A;  4KT6 B;  3EDT B;  2DBA A;  3RIB A;  1KLX A;  4JZY A;  3DRA A;  3DWL G;  1YCS B;  3ABK E;  2EIL E;  4I1A A;  4EZL A;  4GZ3 A;  4HOU A;  5ARF A;  3ZW3 A;  4PDX A;  3FH8 A;  5T3R A;  3MV2 B;  2GRR B;  3TWU A;  3CLJ A;  4RLY A;  3MEK A;  4LER A;  4AEZ C;  4JHK A;  3CKB A;  3CVQ A;  3ZXS A;  3Q49 B;  1SQM A;  3Q4A B;  2FBN A;  4BER A;  5KWD A;  3KEZ A;  2H6G A;  3HRA A;  4GU5 A;  3QOU A;  4EBA G;  2Y69 E;  3BU8 A;  4G8L A;  1K8K G;  1N4S A;  3KS2 A;  4Q69 A;  5BXU A;  3LJ3 A;  1N0Q A;  3CSF A;  3EHQ A;  4CCA A;  4J8S A;  3L22 A;  4LNB A;  2BF0 X;  4U04 A;  3APC A;  3FDH A;  1QZ2 A;  4DI4 A;  3ZUV B;  3D9I A;  5LP0 A;  4U95 D;  5T4Y A;  2R2L A;  1EYH A;  1YYH A;  1S63 A;  1MX2 A;  3CQC B;  1N4P A;  4GCO A;  3FTW A;  4G26 A;  3RAU A;  2H6I A;  3EHR A;  4L1B A;  1OT8 A;  5D0Q D;  3C3O A;  3EIJ A;  4GPM A;  5G05 J;  2EIJ E;  3FUK A;  4UQY A;  2CG2 A;  2R17 C;  4TXR A;  2ILR A;  3D9M A;  4G23 A;  3HVE A;  2CG3 A;  3B7R L;  3NBN B;  3P1U A;  3UM3 A;  4J8F A;  3ABL E;  3IEG A;  2AXU A;  4L7T A;  5H7P A;  2GRN B;  1FVH A;  2OVB A;  1IQU A;  4AJW A;  3V79 K;  2CFU A;  4NAC A;  3PRZ A;  4MRU A;  2NYJ A;  4GTP A;  3O48 A;  2MRI A;  4IN3 B;  4PS7 A;  3UM2 A;  1WAO 1;  1DCQ A;  3S7J A;  3NOC D;  3Q47 B;  3PVL A;  3UXG A;  2WXF A;  3NOG D;  4FC8 A;  4A1G A;  4MBG A;  2Q7F A;  1MYO A;  3FH5 A;  2VTB B;  3LY7 A;  1UG3 A;  2BED A;  1O1T A;  4LG6 A;  2RFA A;  3PUJ A;  4R7L A;  4C0M A;  1P5Q A;  1ELR A;  4G25 A;  4GMJ A;  3D9N A;  4CDR A;  3K9I A;  2HYZ A;  4F7A A;  2PZI A;  3FU5 A;  3ZHE A;  3HYM B;  5BNW A;  4HOR A;  2FF4 A;  4L23 A;  5AQ7 A;  3CST A;  3D9K A;  3KSL A;  2UWJ G;  3CVU A;  4C9B B;  3B13 A;  3LJN A;  2IO2 C;  3CKC A;  4GTR A;  2J49 A;  1N4Q A;  4DX7 D;  5FZS A;  4FLB A;  4PS3 A;  4CT0 A;  1HS6 A;  1HF8 A;  3R7R A;  3BUA A;  1IKN D;  4LSZ E;  4DX6 D;  1K1B A;  3S7B A;  3ULY A;  1SA4 A;  3KSQ A;  3AG2 E;  2MHK A;  3GZ2 A;  2Y3A A;  2J09 A;  1ZB1 A;  2P9U G;  4TRQ A;  2WPV A;  2R5S A;  3PEV B;  2RD0 A;  5BPP A;  4GTM A;  2HE0 A;  4BY6 A;  1MQS A;  3I4G A;  1IYG A;  1H2T C;  4CZ2 D;  4DJA A;  4O1P A;  2WXQ A;  2XGM A;  1TYQ G;  1TNZ A;  1OWP A;  4TUM A;  3FU3 A;  3B7B A;  2OEV A;  3CIA A;  3DXM G;  4YND A;  2WMO A;  4BT8 A;  4U0Z A;  2KCL A;  4RG6 A;  5C2Y A;  3LPZ A;  4F1S A;  4HVB A;  3RRM B;  4IYP A;  3IHY A;  3ZKJ A;  2DWZ A;  3TWR A;  3IKO B;  3G2V A;  2KCK A;  4WNG A;  3ML9 A;  1DNP A;  4N2Q A;  1KPS B;  1TR4 A;  3ULQ A;  3V2O A;  3UT8 A;  3O4Z A;  3QK0 A;  2I6H A;  2YHE A;  3DSS A;  4DUI A;  2V4H C;  3N71 A;  2VGX B;  3EU9 A;  5KCM A;  1HXI A;  5BV1 A;  1IQR A;  3GW4 A;  3UKR G;  2R05 A;  2X6F A;  3JQ1 A;  3FY4 A;  3FUL A;  3DPY A;  2GRP B;  4I6E A;  2M63 A;  3QB2 A;  3CVV A;  2XEN A;  3AJI A;  1FT1 A;  1HG5 A;  2E0I A;  3MV3 B;  3JCK C;  4ILH B;  3VLD A;  3UM1 A;  3E37 A;  3EUV A;  3SO8 A;  1TN8 A;  3D9J A;  3HXD A;  3ZPJ A;  3UI2 A;  3LVR E;  5A6C A;  5AAR A;  1VDY A;  2PL2 A;  1LD8 A;  2ETC A;  4GMR A;  2LXM A;  1Z3Y A;  1ZU2 A;  3Q9N C;  4FLH A;  2WXL A;  4UI9 K;  4KMO A;  3U9W A;  3CV0 A;  1QBQ A;  1MZC A;  3SY2 A;  4KZ0 A;  5CER B;  4FHJ A;  3L16 A;  1JWF A;  1UOH A;  3D3M A;  3QDN A;  4U0U A;  1N4R A;  3RJV A;  4APF A;  1NA0 A;  4Q94 A;  2XCC A;  3IV0 A;  2P9P G;  4XI0 A;  5HI7 A;  3J5P A;  5B3S E;  2J4B A;  3W9G A;  4EZJ A;  3ASD A;  4GZD A;  4WWP A;  1SZ9 A;  3ZFW A;  1KZP A;  3DXK G;  1OWO A;  3PE3 A;  4J8Y A;  1WY6 A;  2F0Y A;  2VGY A;  1EPU A;  4CDN A;  3ZEF A;  2HM8 A;  3T5V A;  3JXJ A;  5G04 C;  2WMN A;  4HXI A;  3B7U X;  3I4R B;  1HU3 A;  5AJD A;  1X81 A;  1L5J A;  3VLE A;  2VSX E;  4UI9 J;  2GW1 A;  5D66 A;  5KJN A;  3FTV A;  3JQ0 A;  1KT0 A;  3Q9U C;  5ENN A;  2V4L A;  1BLX B;  2KM4 A;  3OTN A;  3EHM A;  2XZT G;  4BX8 A;  3KEA A;  4WND A;  4HRN A;  3RU0 A;  3SFX A;  2P9K G;  3LXU X;  1GW6 A;  1AWC B;  2FO1 E;  5E76 A;  1XGW A;  4C48 B;  1JCR A;  4K5A B;  4DLQ A;  2GRO B;  1BPO A;  1LD7 A;  1A5E A;  5FWQ A;  4ACK A;  5LCW J;  2A4Z A;  1SW6 A;  1TJF A;  1HZ4 A;  3C72 A;  4FJY A;  3LKU A;  3FUE A;  1O5M A;  5DIZ A;  1KT1 A;  4XKC A;  2IO3 C;  1V55 E;  2EQX A;  2GRQ B;  4HRM B;  3ASH A;  2WXK A;  3KAE A;  2DYR E;  3SFY A;  4NRH B;  4UQX A;  4TXQ A;  1IHB A;  3W9F A;  1N52 A;  3PEU B;  1TN7 A;  3F6Q A;  2J9Q A;  3G2S A;  1H2V C;  1E8W A;  5EKQ D;  5B1B E;  4HOS A;  3DEO A;  2P58 C;  3LDZ A;  2OEW A;  4UWL A;  3MX3 A;  2OND A;  3J5Q B;  4OAV B;  3ONL A;  3FUM A;  3CGH A;  5ENP D;  2GRL A;  2XEV A;  2OVF A;  4ILG A;  4LNU D;  1MX4 A;  3UIP C;  3HXE A;  1X5B A;  1HO8 A;  4U8H A;  1DC2 A;  4HI8 A;  3T8K A;  4B89 A;  4LRZ A;  2RG8 A;  2Y4T A;  4G24 A;  5CBO A;  4FU3 A;  4FHK A;  4JXT A;  2A5E A;  3I5P A;  3RRN B;  3CK8 A;  5FQ7 A;  3KD7 A;  2IFU A;  4J0U A;  5AIJ A;  4BTA A;  3E33 A;  5EIL A;  4E85 A;  4JA9 A;  4CGV A;  4AP2 A;  4ATG A;  2B6C A;  1Q2Z A;  2CFZ A;  3LVQ E;  1G3N B;  2XS8 A;  1QNF A;  4KYO B;  1JWG A;  3NZS A;  4LCT A;  3U64 A;  4WUY A;  3ZYL A;  4APO A;  2L0I A;  1QYM A;  3ZNG A;  4D10 C;  2F8Y A;  4U63 A;  3FUN A;  2PNN A;  4DX2 A;  4I6G A;  4KVM A;  1N95 A;  1Z6T A;  3FWV A;  2V5F A;  4EPZ A;  4FA6 A;  5AJL A;  2HO1 A;  2CHW A;  1WG0 A;  3GZS A;  4EHM A;  4RVB A;  4RQI A;  4GZ5 A;  4GZ6 A;  3D9H A;  1TNB A;  2X6J A;  2DYS E;  4ACL A;  3FUF A;  4B94 A;  3HXF A;  4JB8 P;  1ELW A;  2BTD A;  3LS8 A;  4BET A;  4J8E A;  1WM5 A;  3L17 A;  3CR3 A;  1K1A A;  3RO2 A;  5FT9 A;  4QFV A;  4A1S A;  4TV3 A;  3SBT B;  5A23 A;  2VSY A;  5FTP A;  3T9K A;  3L6A A;  4B0Z A;  3QJZ A;  1OWM A;  2CHZ A;  5JJ6 A;  4BES A;  3CHO A;  3HG0 D;  4BSZ B;  3C98 A;  3QNK A;  2AXV A;  2NC9 A;  2H6H A;  3SZ7 A;  2WXN A;  3EIQ C;  5A7D B;  3UTM A;  2LAI A;  1OCZ E;  5EN5 D;  2IOL A;  4B8A A;  4GA0 A;  2FI7 A;  3QAQ A;  3FUI A;  2IQC A;  2XCB A;  3QWP A;  2P2C P;  2VGE A;  2WM9 A;  2L9B A;  4OYS A;  2ETB A;  3G2U A;  1TN6 A;  2ZXW E;  3PZ4 A;  4G11 A;  3L13 A; 
#chains in the Genus database with same CATH homology
 3JXJ A;  4BER A;  5KWD A;  3NOG D;  2RFM A;  2DZN A;  3HRA A;  4O1O A;  5AQA A;  3TWQ A;  4G8L A;  3J5Q B;  4J7W A;  4OAV B;  3JUE A;  5BXO A;  2HE0 A;  3D9H A;  1MX6 A;  1OY3 D;  1SVX A;  3SO8 A;  1MYO A;  5ENT D;  4CZ2 D;  5D66 A;  5ENP D;  5BXU A;  4JB8 P;  3V30 A;  3TWT A;  1N0Q A;  4LNU D;  4O1P A;  3TWW A;  3Q9U C;  1NFI E;  3V2X A;  5FIO A;  3EHQ A;  5EIB E;  3UI2 A;  4TUM A;  1BLX B;  1MX4 A;  3B7B A;  5ENR D;  4LG6 A;  5ENQ D;  4B93 B;  4BET A;  2RFA A;  4U8V D;  5EYL A;  5AAR A;  5HS0 A;  4Z68 A;  2XZT G;  4DRX E;  4YDW A;  3B95 A;  2DVW A;  3KEA A;  2ETC A;  4GMR A;  4HRL A;  1DC2 A;  1K1A A;  3ZUV B;  5ITZ F;  4HRN A;  1N11 A;  4HI8 A;  5HKP A;  2AJA A;  1D9S A;  3T8K A;  4QFV A;  4U96 D;  4U95 D;  5KNG A;  2Y1L E;  5EID A;  5HRY A;  4HLL A;  3Q9N C;  1AWC B;  1YYH A;  3IXE A;  1K3Z D;  1BI7 B;  1MX2 A;  5CBO A;  3TWS A;  5AN8 A;  1MJ0 A;  5KNH D;  2FO1 E;  5AQ7 A;  2L6B A;  4CYM D;  4HI9 A;  5ENO D;  2A5E A;  2ZGD A;  4C48 B;  4HQD A;  4K5A B;  3T9K A;  5ENS D;  3ZKJ A;  2DWZ A;  4ZHB A;  5CBN A;  3TWR A;  3EHR A;  2B0O E;  1OT8 A;  4BEP A;  4GPM A;  5KBA A;  2Y0B G;  1BU9 A;  1YMP A;  4ZFH A;  5FIN A;  3TWV A;  4ATZ D;  2MYO A;  4O60 A;  3TWX A;  3C5R A;  3DEP A;  1TR4 A;  2F37 A;  5CED B;  5CER B;  5EIL A;  1A5E A;  3V2O A;  4BES A;  1BI8 B;  3LJN A;  4K5B A;  4NIK A;  2KBX A;  5AQ9 A;  4DX5 D;  2F8X K;  1UOH A;  3JXI A;  1SW6 A;  4HNA D;  2JAB A;  1G3N B;  4DUI A;  2V4H C;  5AQB A;  4A63 B;  4F6R D;  3HG0 D;  4BSZ B;  2V5Q C;  4DX7 D;  1BD8 A;  5JMN D;  3EU9 A;  2QC9 A;  2XEH A;  2BKG A;  2QYJ A;  4DX1 A;  4F1P A;  5EYP F;  2J8S D;  3AAA C;  3UTM A;  4HRM B;  5EN5 D;  3NBN B;  1YCS B;  1WDY A;  4QQI A;  1IKN D;  2DZO A;  3J5P A;  1QYM A;  1N0R A;  4LSZ E;  2XZD G;  4K5C A;  4YDY A;  1K1B A;  2F8Y A;  1S70 B;  3ZNG A;  4DX6 D;  3W9G A;  2BKK B;  1IXV A;  4U8Y D;  4UUC A;  5AAO A;  1AP7 A;  4OAU C;  2ETA A;  1IHB A;  2XEE A;  3W9F A;  2PNN A;  2XEN A;  2P2C P;  2VGE A;  3AJI A;  4RLY A;  3TWU A;  4HB5 A;  4DX2 A;  5CEC B;  3V79 K;  5CEA A;  2NYJ A;  3F6Q A;  2ETB A;  4N5Q A;  4G8K A;  3V31 A;  2KXP C;  3ZU7 B;  4J8Y A;  4HBD A;  1DCQ A;  5JA4 D;  3DEO A;  2ZGG A;  3NOC D;  3UXG A;  1WG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...