2MZ4A

Solution structure of mu-slptx-ssm6a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
ADNKCENSLRREIACGQCRDKVKTDGYFYECCTSDSTFKKCQDLLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mu-scoloptoxin-Ssm6a
publication title Solution Structure of mu-SLPTX-Ssm6a, a Gating Modifier of human Nav1.7 channels
rcsb
source organism Scolopendra mutilans
molecule tags Toxin
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2015-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.60.50 Mainly Alpha Orthogonal Bundle Diphtheria Toxin Repressor; domain 2 Diphtheria Toxin Repressor; domain 2 2mz4A00
2M35A 2MUNA 2MVTA 2MZ4A
chains in the Genus database with same CATH superfamily
2HYGD 2MUNA 1RQ6A 2EV0A 2MVTA 2EV5A 3A52A 5IT9R 1G3SA 4HX4A 2H09A 2QQAA 5A2QR 3J80R 4HX7A 2QQ9A 2P0TA 1FWZA 1BI0A 1BI1A 1ON2A 2M35A 2TDXA 1F5TA 1BI3A 2F5FA 1P92A 4HV5A 2F5EA 4O6JA 1BI2A 1FX7A 1B1BA 1U8RA 4HV6A 2ISZA 5FLXR 1ON1A 3R61A 2F5DA 2QQBA 4O5VA 1XCVA 2EV6A 3R60A 1G3YA 3GLXA 3JAMR 2MZ4A 2DTRA 2HYFA 2X98A 2F5CA 3J81R 1C0WA 4HX8A 3J7AW 1G3WA 1G3TA 1DPRA 1DDNA
chains in the Genus database with same CATH topology
2MUNA 2MVTA 2MZ4A 3A52A 2X98A 2M35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M35 A;  2MUN A;  2MVT A;  2MZ4 A; 
#chains in the Genus database with same CATH topology
 2HYG D;  2MUN A;  1RQ6 A;  2EV0 A;  2MVT A;  2EV5 A;  3A52 A;  5IT9 R;  1G3S A;  4HX4 A;  2H09 A;  2QQA A;  5A2Q R;  3J80 R;  4HX7 A;  2QQ9 A;  2P0T A;  1FWZ A;  1BI0 A;  1BI1 A;  1ON2 A;  2M35 A;  2TDX A;  1F5T A;  1BI3 A;  2F5F A;  1P92 A;  4HV5 A;  2F5E A;  4O6J A;  1BI2 A;  1FX7 A;  1B1B A;  1U8R A;  4HV6 A;  2ISZ A;  5FLX R;  1ON1 A;  3R61 A;  2F5D A;  2QQB A;  4O5V A;  1XCV A;  2EV6 A;  3R60 A;  1G3Y A;  3GLX A;  3JAM R;  2MZ4 A;  2DTR A;  2HYF A;  2X98 A;  2F5C A;  3J81 R;  1C0W A;  4HX8 A;  3J7A W;  1G3W A;  1G3T A;  1DPR A;  1DDN A; 
#chains in the Genus database with same CATH homology
 2MUN A;  2MVT A;  2MZ4 A;  3A52 A;  2X98 A;  2M35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...