2MZEA

Nmr solution structure of the pro form of human matrilysin (prommp-7)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
250
Chain Sequence
b'LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrilysin
publication title Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 250
sequence length 250
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2mzeA00
3OHOA 4JP4A 3USNA 3I7IA 3EDIA 1IAEA 2FV5A 1IAAA 3P1VA 3B92A 3GBOA 1AYKA 4HX3A 3RTSA 5B5OA 3KMEA 1D8FA 1YCMA 4ON1A 2ERPA 2W0DA 4AYKA 5CXAA 1Q3AA 1FLSA 3HDAP 5CUHA 3LUNA 2OVXA 3DWBA 1OS2A 3WV3A 4PKRA 1HY7A 1GKCA 1KUGA 1G05A 1HV5A 5CZMA 1JK3A 1IADA 2HU6A 1JIZA 2DW2A 1MMBA 2OZRA 2YB9A 4XM7A 2FV9A 2J0TA 4AIGA 2W13A 1XFVA 1H71P 2V4BA 1ZS0A 2W14A 4L63A 4DD8A 2K2GA 1MNCA 4ILWD 2D1NA 1C3IA 1GE7A 2WO9A 2O3EA 4EFSA 3DNGA 1ZP5A 4JA1A 1GO8P 3KMCA 1FBLA 4H1QA 3AIGA 2OXWA 1PWUA 1YOUA 2CKIA 1XFYA 1ZTQA 1D8MA 2E3XA 1RM8A 1D5JA 1OO9A 4I35A 1GE6A 1AF0A 2I47A 2DDYA 2L0RA 1S4BP 1JJ9A 4CTHA 3LK8A 2OY2A 3Q2GA 1BZSA 2X3AA 5D1TA 1BKCA 2PJTA 2RJPA 1SLNA 5L7FA 3DPEA 1XUDA 1HFCA 830CA 1CAQA 4HMAA 1HTDA 1KUIA 2W15A 2O36A 3B8ZA 1PWWA 4WK7A 2OW0A 1JIWP 4XBHA 1JKYA 2OXZA 3MA2A 4DF9A 1BQOA 1UTTA 4XCTA 5B5PA 4PKTA 4GQLA 3L0TA 1EB6A 4G9LA 5D7WA 4PKQA 4R3VA 3LKAA 1CGEA 1KAPP 1OS9A 1CGFA 4DV8A 1ZXCA 4GWMA 3AYUA 2TCLA 2K9CA 1R55A 2J83A 5JMYA 1QJJA 2Y6CA 4WKIA 1BSWA 1CQRA 2X7MA 4L6TA 2XS3A 4G0DA 2X3BA 4Q1LA 2ERQA 3HBVP 3F16A 3Q2HA 1UEAA 1ZVXA 1CK7A 1SU3A 1UMSA 1GO7P 5BPAA 3EDGA 5LABA 1G49A 1JAQA 1I76A 3LIKA 4A3WA 5H8XA 1IACA 3P24A 3F18A 1WNIA 4WZVA 2WOAA 2A8HA 1C7KA 1GXDA 1XURA 5I4OA 3LILA 1USNA 1L6JA 1K7QA 4QKZA 1JAOA 1Y0VA 1BQQM 1D7XA 2OW1A 3EDZA 2DDFA 1K7GA 3EDHA 2MZHA 3DSLA 1A86A 1SLMA 4H76A 1Z3JA 4GUYA 1R54A 1G4KA 1QICA 1SMPA 3O64A 1BKCE 5BOYA 1IAGA 2D1OA 1R1JA 4AUOA 4PKSA 3KWVC 5L79A 3K7NA 2JT5A 5D2BA 3LIRA 3TT4A 5D3CA 3KECA 3LUMA 2KRJA 1BUDA 1KUKA 1Y8JA 1I1IP 4FXYP 2DW1A 2Z2DA 1C8TA 3ELMA 1DTHA 1ASTA 3E8RA 1CIZA 3ZVSA 3KRYA 1A85A 1QIAA 3LQBA 1XFWA 3KHIA 2JNPA 5I2ZA 3LQ0A 1MMPA 4IUWA 1QUAA 3G42A 4GR8A 3LEAA 1FM1A 2MLRA 1UMTA 3WV2A 5I0LA 1BUVM 4GR3A 3HY9A 2YIGA 3CKIA 1BKCI 2XS4A 3HYGA 4PKUA 4H30A 4AXQA 1PWPA 2W12A 1MMQA 1QJIA 3DPFA 1PWQA 4WF6A 3N2VA 3HY7A 3KEJA 2RJQA 3RTTA 1OM7A 2WO8A 2AIGP 1R1HA 1KUHA 1G9KA 3F1AA 1O0TA 2JSDA 1EAKA 3EHXA 3ZUKA 3B2ZA 1JANA 2EROA 3LJGA 4GR0A 1OMJA 5BOTA 3HBUP 1CGLA 1ROSA 3EHYA 1IABA 3LJZA 4XM8A 2OI0A 3U1RA 4JQGA 3WV1A 4J4MA 2JIHA 1XFUA 1HFSA 2Y6DA 1QIBA 2QPJA 3VI1A 5D1SA 3F17A 3NX7A 1O0QA 2MZIA 1UTZA 1XUCA 4FVLA 3OHLA 3AYKA 4H84A 1ND1A 1J7NA 4H82A 1KUFA 1SATA 2N8RA 5I3MA 3LMCA 2OW9A 1ATLA 1XFXA 1Y93A 1BIWA 3F19A 1B3DA 3KEKA 1JAPA 2SRTA 1YQYA 3ZXHA 1CXVA 1SRPA 3HB2P 3F15A 3I7GA 2OVZA 3HDBA 4DPEA 1G12A 5D1UA 3TSKA 1YP1A 4IN9A 2JT6A 1JH1A 3K7LA 3VTGA 2E2DA 1HOVA 4L19A 4IJOA 4GWNA 4ZR5A 1EUBA 1OM6A 2OXUA 4GF1A 2CLTA 4XM6A 3LE9A 2X3CA 1ZXVA 3TS4A 4H3XA 1DMTA 1PWVA 456CA 4H49A 2DW0A 3O2XA 3DL1A 1AKLA 3UVCA 2POJA 1I73A 1R1IA 3LJTA 2USNA 1GE5A 1RMZA 4A7BA 1K7IA 1GKDA 4H2EA 2MLSA 5I43A 5I12A 2OY4A 1BM6A 1KBCA 2MZEA 1B8YA 3N2UA 4JIJA 4WKEA 4PKWA 3V96B 4FU4A 1MMRA 4PKVA 3G5CA 3BA0A 3TVCA 1XFZA 4I03A 1OM8A 3L0VA 3EWJA 3LGPA 4JPAA 4FXQA 2AYKA 966CA 3SHIA 2OW2A
chains in the Genus database with same CATH superfamily
3OHOA 4JP4A 3USNA 3I7IA 3EDIA 1IAEA 2FV5A 1IAAA 3P1VA 3B92A 1TVIA 3GBOA 1AYKA 4HX3A 3RTSA 5B5OA 3KMEA 1D8FA 1YCMA 4ON1A 2ERPA 2W0DA 4AYKA 5CXAA 1Q3AA 1FLSA 3HDAP 5CUHA 3LUNA 2OVXA 3DWBA 1OS2A 3WV3A 4PKRA 1HY7A 1GKCA 1KUGA 1G05A 1HV5A 5CZMA 1JK3A 1IADA 2HU6A 1JIZA 2DW2A 1MMBA 2OZRA 2YB9A 4XM7A 2FV9A 2J0TA 4AIGA 2W13A 1XFVA 1H71P 2V4BA 1ZS0A 2W14A 4L63A 4DD8A 2K2GA 1MNCA 4ILWD 2D1NA 1C3IA 1GE7A 2WO9A 2O3EA 4EFSA 3DNGA 1ZP5A 4JA1A 1GO8P 3KMCA 1FBLA 4H1QA 3AIGA 2OXWA 1PWUA 1YOUA 2CKIA 1XFYA 1ZTQA 1D8MA 2E3XA 1RM8A 1D5JA 1OO9A 4I35A 1GE6A 1AF0A 2I47A 2DDYA 2L0RA 1S4BP 1JJ9A 4CTHA 3LK8A 2OY2A 3Q2GA 1BZSA 2X3AA 5D1TA 1BKCA 2PJTA 2RJPA 1SLNA 5L7FA 3DPEA 1XUDA 1HFCA 830CA 1CAQA 4HMAA 1HTDA 1KUIA 2W15A 2O36A 3B8ZA 1PWWA 4WK7A 2OW0A 1JIWP 4XBHA 1JKYA 2OXZA 3MA2A 4DF9A 1BQOA 1UTTA 4XCTA 5B5PA 4PKTA 4GQLA 3L0TA 1EB6A 4G9LA 5D7WA 4PKQA 4R3VA 3LKAA 1CGEA 1KAPP 1OS9A 1CGFA 4DV8A 1ZXCA 4GWMA 3AYUA 2TCLA 3DTIA 2K9CA 1R55A 2J83A 5JMYA 1QJJA 2Y6CA 4WKIA 1BSWA 1CQRA 2X7MA 4L6TA 2YUFA 2XS3A 4G0DA 2X3BA 4Q1LA 2ERQA 3HBVP 3F16A 3Q2HA 1UEAA 1ZVXA 1CK7A 1SU3A 1UMSA 1GO7P 5BPAA 3EDGA 5LABA 1G49A 1JAQA 1I76A 3LIKA 4A3WA 5H8XA 1IACA 3P24A 3F18A 1WNIA 4WZVA 2WOAA 2A8HA 1C7KA 1GXDA 1XURA 5I4OA 3LILA 1USNA 1OZ9A 1L6JA 1K7QA 4QKZA 1JAOA 1Y0VA 1BQQM 1D7XA 2OW1A 3EDZA 2DDFA 1K7GA 3EDHA 2MZHA 3DSLA 1A86A 1SLMA 4H76A 1Z3JA 4GUYA 1R54A 1G4KA 1XM5A 1QICA 1SMPA 3O64A 1BKCE 5BOYA 1IAGA 2D1OA 1R1JA 4AUOA 4PKSA 3KWVC 5L79A 3K7NA 2JT5A 5D2BA 3LIRA 3TT4A 5D3CA 3KECA 3LUMA 2KRJA 1BUDA 1KUKA 1Y8JA 1I1IP 4FXYP 2DW1A 2Z2DA 1C8TA 3ELMA 1DTHA 1ASTA 3E8RA 1CIZA 3ZVSA 3KRYA 1A85A 1QIAA 3LQBA 1XFWA 3KHIA 2JNPA 5I2ZA 3LQ0A 1MMPA 4IUWA 1QUAA 3G42A 4GR8A 3LEAA 1FM1A 2MLRA 1UMTA 3WV2A 5I0LA 1BUVM 4GR3A 3HY9A 2YIGA 3CKIA 1BKCI 2XS4A 3HYGA 4PKUA 4H30A 1XAXA 4AXQA 1PWPA 2W12A 1MMQA 1QJIA 3DPFA 1PWQA 4WF6A 3N2VA 3HY7A 3KEJA 2RJQA 3RTTA 1OM7A 2WO8A 2AIGP 1R1HA 1KUHA 1G9KA 3F1AA 1O0TA 2JSDA 1EAKA 3EHXA 3ZUKA 3B2ZA 1JANA 2EROA 3LJGA 4GR0A 1OMJA 5BOTA 3HBUP 1CGLA 1ROSA 3EHYA 1IABA 3LJZA 4XM8A 2OI0A 3U1RA 4JQGA 3WV1A 4J4MA 2JIHA 1XFUA 1HFSA 2Y6DA 1QIBA 2QPJA 3VI1A 5D1SA 3F17A 3NX7A 1O0QA 2MZIA 1UTZA 1XUCA 4FVLA 3OHLA 3AYKA 4L7AA 4H84A 1ND1A 1J7NA 4H82A 1KUFA 1SATA 2N8RA 5I3MA 3LMCA 2OW9A 1ATLA 1XFXA 1Y93A 1BIWA 3F19A 1B3DA 3KEKA 1JAPA 2SRTA 1YQYA 3DTEA 3ZXHA 1CXVA 1SRPA 3HB2P 3F15A 3I7GA 2OVZA 3HDBA 4DPEA 1G12A 5D1UA 3TSKA 1YP1A 4IN9A 2JT6A 1JH1A 3K7LA 3VTGA 2E2DA 1HOVA 4L19A 4IJOA 4GWNA 4ZR5A 1EUBA 1OM6A 2OXUA 4GF1A 2CLTA 4XM6A 3LE9A 2X3CA 1ZXVA 3TS4A 4H3XA 1DMTA 1PWVA 456CA 4H49A 2DW0A 3O2XA 3DL1A 1AKLA 3UVCA 2POJA 1I73A 1R1IA 3LJTA 2USNA 1GE5A 1RMZA 4A7BA 1K7IA 1GKDA 4H2EA 2MLSA 5I43A 5I12A 2OY4A 1BM6A 1KBCA 2MZEA 1B8YA 3N2UA 4JIJA 4WKEA 4PKWA 3V96B 4FU4A 1MMRA 4PKVA 3G5CA 3BA0A 3TVCA 1XFZA 4I03A 1OM8A 3L0VA 3DTKA 3EWJA 3LGPA 4FXQA 4JPAA 2AYKA 966CA 3SHIA 2OW2A
chains in the Genus database with same CATH topology
3OHOA 4JP4A 3USNA 3I7IA 3EDIA 1IAEA 2FV5A 1IAAA 3P1VA 3B92A 3GBOA 1AYKA 4HX3A 3RTSA 5B5OA 3KMEA 1D8FA 1YCMA 4ON1A 2ERPA 2W0DA 4AYKA 5CXAA 1Q3AA 1FLSA 3HDAP 5CUHA 3LUNA 2OVXA 3DWBA 1OS2A 3WV3A 4PKRA 1HY7A 1GKCA 1KUGA 1G05A 1HV5A 5CZMA 1JK3A 1IADA 2HU6A 1JIZA 2DW2A 1MMBA 2OZRA 2YB9A 4XM7A 2FV9A 2J0TA 4AIGA 2W13A 1XFVA 1H71P 2V4BA 1ZS0A 2W14A 4L63A 4DD8A 2K2GA 1MNCA 4ILWD 2D1NA 1C3IA 1GE7A 2WO9A 2O3EA 4EFSA 3DNGA 1ZP5A 4JA1A 1GO8P 3KMCA 1FBLA 4H1QA 3AIGA 2OXWA 1PWUA 1YOUA 2CKIA 1XFYA 1ZTQA 1D8MA 2E3XA 1RM8A 1D5JA 1OO9A 4I35A 1GE6A 1AF0A 2I47A 2DDYA 2L0RA 1S4BP 1JJ9A 4CTHA 3LK8A 2OY2A 3Q2GA 1BZSA 2X3AA 5D1TA 1BKCA 2PJTA 2RJPA 1SLNA 5L7FA 3DPEA 1XUDA 1HFCA 830CA 1CAQA 4HMAA 1HTDA 1KUIA 2W15A 2O36A 3B8ZA 1PWWA 4WK7A 2OW0A 1JIWP 4XBHA 1JKYA 2OXZA 3MA2A 4DF9A 1BQOA 1UTTA 4XCTA 5B5PA 4PKTA 4GQLA 3L0TA 1EB6A 4G9LA 5D7WA 4PKQA 4R3VA 3LKAA 1CGEA 1KAPP 1OS9A 1CGFA 4DV8A 1ZXCA 4GWMA 3AYUA 2TCLA 3DTIA 2K9CA 1R55A 2J83A 5JMYA 1QJJA 2Y6CA 4WKIA 1BSWA 1CQRA 2X7MA 4L6TA 2YUFA 2XS3A 4G0DA 2X3BA 4Q1LA 2ERQA 3HBVP 3F16A 3Q2HA 1UEAA 1ZVXA 1CK7A 1SU3A 1UMSA 1GO7P 5BPAA 3EDGA 5LABA 1G49A 1JAQA 1I76A 3LIKA 4A3WA 5H8XA 1IACA 3P24A 3F18A 1WNIA 4WZVA 2WOAA 2A8HA 1C7KA 1GXDA 1XURA 5I4OA 3LILA 1USNA 1L6JA 1K7QA 4QKZA 1JAOA 1Y0VA 1BQQM 1D7XA 2OW1A 3EDZA 2DDFA 1K7GA 3EDHA 2MZHA 3DSLA 1A86A 1SLMA 4H76A 1Z3JA 4GUYA 1R54A 1G4KA 1QICA 1SMPA 3O64A 1BKCE 5BOYA 1IAGA 2D1OA 1R1JA 4AUOA 4PKSA 3KWVC 5L79A 3K7NA 2JT5A 5D2BA 3LIRA 3TT4A 5D3CA 3KECA 3LUMA 2KRJA 1BUDA 1KUKA 1Y8JA 1I1IP 4FXYP 2DW1A 2Z2DA 1C8TA 3ELMA 1DTHA 1ASTA 3E8RA 1CIZA 3ZVSA 3KRYA 1A85A 1QIAA 3LQBA 1XFWA 3KHIA 2JNPA 5I2ZA 3LQ0A 1MMPA 4IUWA 1QUAA 3G42A 4GR8A 3LEAA 1FM1A 2MLRA 1UMTA 3WV2A 5I0LA 1BUVM 4GR3A 3HY9A 2YIGA 3CKIA 1BKCI 2XS4A 3HYGA 4PKUA 4H30A 4AXQA 1PWPA 2W12A 1MMQA 1QJIA 3DPFA 1PWQA 4WF6A 3N2VA 3HY7A 3KEJA 2RJQA 3RTTA 1OM7A 2WO8A 2AIGP 1R1HA 1KUHA 1G9KA 3F1AA 1O0TA 2JSDA 1EAKA 3EHXA 3ZUKA 3B2ZA 1JANA 2EROA 3LJGA 4GR0A 1OMJA 5BOTA 3HBUP 1CGLA 1ROSA 3EHYA 1IABA 3LJZA 4XM8A 2OI0A 3U1RA 4JQGA 3WV1A 4J4MA 2JIHA 1XFUA 1HFSA 2Y6DA 1QIBA 2QPJA 3VI1A 5D1SA 3F17A 3NX7A 1O0QA 2MZIA 1UTZA 1XUCA 4FVLA 3OHLA 3AYKA 4L7AA 4H84A 1ND1A 1J7NA 4H82A 1KUFA 1SATA 2N8RA 5I3MA 3LMCA 2OW9A 1ATLA 1XFXA 1Y93A 1BIWA 3F19A 1B3DA 3KEKA 1JAPA 2SRTA 1YQYA 3DTEA 3ZXHA 1CXVA 1SRPA 3HB2P 3F15A 3I7GA 2OVZA 3HDBA 4DPEA 1G12A 5D1UA 3TSKA 1YP1A 4IN9A 2JT6A 1JH1A 3K7LA 3VTGA 2E2DA 1HOVA 4L19A 4IJOA 4GWNA 4ZR5A 1EUBA 1OM6A 2OXUA 4GF1A 2CLTA 4XM6A 3LE9A 2X3CA 1ZXVA 3TS4A 4H3XA 1DMTA 1PWVA 456CA 4H49A 2DW0A 3O2XA 3DL1A 1AKLA 3UVCA 2POJA 1I73A 1R1IA 3LJTA 2USNA 1GE5A 1RMZA 4A7BA 1K7IA 1GKDA 4H2EA 2MLSA 5I43A 5I12A 2OY4A 1BM6A 1KBCA 2MZEA 1B8YA 3N2UA 4JIJA 4WKEA 4PKWA 3V96B 4FU4A 1MMRA 4PKVA 3G5CA 3BA0A 3TVCA 1XFZA 4I03A 1OM8A 3L0VA 3DTKA 3EWJA 3LGPA 4FXQA 4JPAA 2AYKA 966CA 3SHIA 2OW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHO A;  4JP4 A;  3USN A;  3I7I A;  3EDI A;  1IAE A;  2FV5 A;  1IAA A;  3P1V A;  3B92 A;  3GBO A;  1AYK A;  4HX3 A;  3RTS A;  5B5O A;  3KME A;  1D8F A;  1YCM A;  4ON1 A;  2ERP A;  2W0D A;  4AYK A;  5CXA A;  1Q3A A;  1FLS A;  3HDA P;  5CUH A;  3LUN A;  2OVX A;  3DWB A;  1OS2 A;  3WV3 A;  4PKR A;  1HY7 A;  1GKC A;  1KUG A;  1G05 A;  1HV5 A;  5CZM A;  1JK3 A;  1IAD A;  2HU6 A;  1JIZ A;  2DW2 A;  1MMB A;  2OZR A;  2YB9 A;  4XM7 A;  2FV9 A;  2J0T A;  4AIG A;  2W13 A;  1XFV A;  1H71 P;  2V4B A;  1ZS0 A;  2W14 A;  4L63 A;  4DD8 A;  2K2G A;  1MNC A;  4ILW D;  2D1N A;  1C3I A;  1GE7 A;  2WO9 A;  2O3E A;  4EFS A;  3DNG A;  1ZP5 A;  4JA1 A;  1GO8 P;  3KMC A;  1FBL A;  4H1Q A;  3AIG A;  2OXW A;  1PWU A;  1YOU A;  2CKI A;  1XFY A;  1ZTQ A;  1D8M A;  2E3X A;  1RM8 A;  1D5J A;  1OO9 A;  4I35 A;  1GE6 A;  1AF0 A;  2I47 A;  2DDY A;  2L0R A;  1S4B P;  1JJ9 A;  4CTH A;  3LK8 A;  2OY2 A;  3Q2G A;  1BZS A;  2X3A A;  5D1T A;  1BKC A;  2PJT A;  2RJP A;  1SLN A;  5L7F A;  3DPE A;  1XUD A;  1HFC A;  830C A;  1CAQ A;  4HMA A;  1HTD A;  1KUI A;  2W15 A;  2O36 A;  3B8Z A;  1PWW A;  4WK7 A;  2OW0 A;  1JIW P;  4XBH A;  1JKY A;  2OXZ A;  3MA2 A;  4DF9 A;  1BQO A;  1UTT A;  4XCT A;  5B5P A;  4PKT A;  4GQL A;  3L0T A;  1EB6 A;  4G9L A;  5D7W A;  4PKQ A;  4R3V A;  3LKA A;  1CGE A;  1KAP P;  1OS9 A;  1CGF A;  4DV8 A;  1ZXC A;  4GWM A;  3AYU A;  2TCL A;  2K9C A;  1R55 A;  2J83 A;  5JMY A;  1QJJ A;  2Y6C A;  4WKI A;  1BSW A;  1CQR A;  2X7M A;  4L6T A;  2XS3 A;  4G0D A;  2X3B A;  4Q1L A;  2ERQ A;  3HBV P;  3F16 A;  3Q2H A;  1UEA A;  1ZVX A;  1CK7 A;  1SU3 A;  1UMS A;  1GO7 P;  5BPA A;  3EDG A;  5LAB A;  1G49 A;  1JAQ A;  1I76 A;  3LIK A;  4A3W A;  5H8X A;  1IAC A;  3P24 A;  3F18 A;  1WNI A;  4WZV A;  2WOA A;  2A8H A;  1C7K A;  1GXD A;  1XUR A;  5I4O A;  3LIL A;  1USN A;  1L6J A;  1K7Q A;  4QKZ A;  1JAO A;  1Y0V A;  1BQQ M;  1D7X A;  2OW1 A;  3EDZ A;  2DDF A;  1K7G A;  3EDH A;  2MZH A;  3DSL A;  1A86 A;  1SLM A;  4H76 A;  1Z3J A;  4GUY A;  1R54 A;  1G4K A;  1QIC A;  1SMP A;  3O64 A;  1BKC E;  5BOY A;  1IAG A;  2D1O A;  1R1J A;  4AUO A;  4PKS A;  3KWV C;  5L79 A;  3K7N A;  2JT5 A;  5D2B A;  3LIR A;  3TT4 A;  5D3C A;  3KEC A;  3LUM A;  2KRJ A;  1BUD A;  1KUK A;  1Y8J A;  1I1I P;  4FXY P;  2DW1 A;  2Z2D A;  1C8T A;  3ELM A;  1DTH A;  1AST A;  3E8R A;  1CIZ A;  3ZVS A;  3KRY A;  1A85 A;  1QIA A;  3LQB A;  1XFW A;  3KHI A;  2JNP A;  5I2Z A;  3LQ0 A;  1MMP A;  4IUW A;  1QUA A;  3G42 A;  4GR8 A;  3LEA A;  1FM1 A;  2MLR A;  1UMT A;  3WV2 A;  5I0L A;  1BUV M;  4GR3 A;  3HY9 A;  2YIG A;  3CKI A;  1BKC I;  2XS4 A;  3HYG A;  4PKU A;  4H30 A;  4AXQ A;  1PWP A;  2W12 A;  1MMQ A;  1QJI A;  3DPF A;  1PWQ A;  4WF6 A;  3N2V A;  3HY7 A;  3KEJ A;  2RJQ A;  3RTT A;  1OM7 A;  2WO8 A;  2AIG P;  1R1H A;  1KUH A;  1G9K A;  3F1A A;  1O0T A;  2JSD A;  1EAK A;  3EHX A;  3ZUK A;  3B2Z A;  1JAN A;  2ERO A;  3LJG A;  4GR0 A;  1OMJ A;  5BOT A;  3HBU P;  1CGL A;  1ROS A;  3EHY A;  1IAB A;  3LJZ A;  4XM8 A;  2OI0 A;  3U1R A;  4JQG A;  3WV1 A;  4J4M A;  2JIH A;  1XFU A;  1HFS A;  2Y6D A;  1QIB A;  2QPJ A;  3VI1 A;  5D1S A;  3F17 A;  3NX7 A;  1O0Q A;  2MZI A;  1UTZ A;  1XUC A;  4FVL A;  3OHL A;  3AYK A;  4H84 A;  1ND1 A;  1J7N A;  4H82 A;  1KUF A;  1SAT A;  2N8R A;  5I3M A;  3LMC A;  2OW9 A;  1ATL A;  1XFX A;  1Y93 A;  1BIW A;  3F19 A;  1B3D A;  3KEK A;  1JAP A;  2SRT A;  1YQY A;  3ZXH A;  1CXV A;  1SRP A;  3HB2 P;  3F15 A;  3I7G A;  2OVZ A;  3HDB A;  4DPE A;  1G12 A;  5D1U A;  3TSK A;  1YP1 A;  4IN9 A;  2JT6 A;  1JH1 A;  3K7L A;  3VTG A;  2E2D A;  1HOV A;  4L19 A;  4IJO A;  4GWN A;  4ZR5 A;  1EUB A;  1OM6 A;  2OXU A;  4GF1 A;  2CLT A;  4XM6 A;  3LE9 A;  2X3C A;  1ZXV A;  3TS4 A;  4H3X A;  1DMT A;  1PWV A;  456C A;  4H49 A;  2DW0 A;  3O2X A;  3DL1 A;  1AKL A;  3UVC A;  2POJ A;  1I73 A;  1R1I A;  3LJT A;  2USN A;  1GE5 A;  1RMZ A;  4A7B A;  1K7I A;  1GKD A;  4H2E A;  2MLS A;  5I43 A;  5I12 A;  2OY4 A;  1BM6 A;  1KBC A;  2MZE A;  1B8Y A;  3N2U A;  4JIJ A;  4WKE A;  4PKW A;  3V96 B;  4FU4 A;  1MMR A;  4PKV A;  3G5C A;  3BA0 A;  3TVC A;  1XFZ A;  4I03 A;  1OM8 A;  3L0V A;  3EWJ A;  3LGP A;  4JPA A;  4FXQ A;  2AYK A;  966C A;  3SHI A;  2OW2 A; 
#chains in the Genus database with same CATH topology
 3OHO A;  4JP4 A;  3USN A;  3I7I A;  3EDI A;  1IAE A;  2FV5 A;  1IAA A;  3P1V A;  3B92 A;  1TVI A;  3GBO A;  1AYK A;  4HX3 A;  3RTS A;  5B5O A;  3KME A;  1D8F A;  1YCM A;  4ON1 A;  2ERP A;  2W0D A;  4AYK A;  5CXA A;  1Q3A A;  1FLS A;  3HDA P;  5CUH A;  3LUN A;  2OVX A;  3DWB A;  1OS2 A;  3WV3 A;  4PKR A;  1HY7 A;  1GKC A;  1KUG A;  1G05 A;  1HV5 A;  5CZM A;  1JK3 A;  1IAD A;  2HU6 A;  1JIZ A;  2DW2 A;  1MMB A;  2OZR A;  2YB9 A;  4XM7 A;  2FV9 A;  2J0T A;  4AIG A;  2W13 A;  1XFV A;  1H71 P;  2V4B A;  1ZS0 A;  2W14 A;  4L63 A;  4DD8 A;  2K2G A;  1MNC A;  4ILW D;  2D1N A;  1C3I A;  1GE7 A;  2WO9 A;  2O3E A;  4EFS A;  3DNG A;  1ZP5 A;  4JA1 A;  1GO8 P;  3KMC A;  1FBL A;  4H1Q A;  3AIG A;  2OXW A;  1PWU A;  1YOU A;  2CKI A;  1XFY A;  1ZTQ A;  1D8M A;  2E3X A;  1RM8 A;  1D5J A;  1OO9 A;  4I35 A;  1GE6 A;  1AF0 A;  2I47 A;  2DDY A;  2L0R A;  1S4B P;  1JJ9 A;  4CTH A;  3LK8 A;  2OY2 A;  3Q2G A;  1BZS A;  2X3A A;  5D1T A;  1BKC A;  2PJT A;  2RJP A;  1SLN A;  5L7F A;  3DPE A;  1XUD A;  1HFC A;  830C A;  1CAQ A;  4HMA A;  1HTD A;  1KUI A;  2W15 A;  2O36 A;  3B8Z A;  1PWW A;  4WK7 A;  2OW0 A;  1JIW P;  4XBH A;  1JKY A;  2OXZ A;  3MA2 A;  4DF9 A;  1BQO A;  1UTT A;  4XCT A;  5B5P A;  4PKT A;  4GQL A;  3L0T A;  1EB6 A;  4G9L A;  5D7W A;  4PKQ A;  4R3V A;  3LKA A;  1CGE A;  1KAP P;  1OS9 A;  1CGF A;  4DV8 A;  1ZXC A;  4GWM A;  3AYU A;  2TCL A;  3DTI A;  2K9C A;  1R55 A;  2J83 A;  5JMY A;  1QJJ A;  2Y6C A;  4WKI A;  1BSW A;  1CQR A;  2X7M A;  4L6T A;  2YUF A;  2XS3 A;  4G0D A;  2X3B A;  4Q1L A;  2ERQ A;  3HBV P;  3F16 A;  3Q2H A;  1UEA A;  1ZVX A;  1CK7 A;  1SU3 A;  1UMS A;  1GO7 P;  5BPA A;  3EDG A;  5LAB A;  1G49 A;  1JAQ A;  1I76 A;  3LIK A;  4A3W A;  5H8X A;  1IAC A;  3P24 A;  3F18 A;  1WNI A;  4WZV A;  2WOA A;  2A8H A;  1C7K A;  1GXD A;  1XUR A;  5I4O A;  3LIL A;  1USN A;  1OZ9 A;  1L6J A;  1K7Q A;  4QKZ A;  1JAO A;  1Y0V A;  1BQQ M;  1D7X A;  2OW1 A;  3EDZ A;  2DDF A;  1K7G A;  3EDH A;  2MZH A;  3DSL A;  1A86 A;  1SLM A;  4H76 A;  1Z3J A;  4GUY A;  1R54 A;  1G4K A;  1XM5 A;  1QIC A;  1SMP A;  3O64 A;  1BKC E;  5BOY A;  1IAG A;  2D1O A;  1R1J A;  4AUO A;  4PKS A;  3KWV C;  5L79 A;  3K7N A;  2JT5 A;  5D2B A;  3LIR A;  3TT4 A;  5D3C A;  3KEC A;  3LUM A;  2KRJ A;  1BUD A;  1KUK A;  1Y8J A;  1I1I P;  4FXY P;  2DW1 A;  2Z2D A;  1C8T A;  3ELM A;  1DTH A;  1AST A;  3E8R A;  1CIZ A;  3ZVS A;  3KRY A;  1A85 A;  1QIA A;  3LQB A;  1XFW A;  3KHI A;  2JNP A;  5I2Z A;  3LQ0 A;  1MMP A;  4IUW A;  1QUA A;  3G42 A;  4GR8 A;  3LEA A;  1FM1 A;  2MLR A;  1UMT A;  3WV2 A;  5I0L A;  1BUV M;  4GR3 A;  3HY9 A;  2YIG A;  3CKI A;  1BKC I;  2XS4 A;  3HYG A;  4PKU A;  4H30 A;  1XAX A;  4AXQ A;  1PWP A;  2W12 A;  1MMQ A;  1QJI A;  3DPF A;  1PWQ A;  4WF6 A;  3N2V A;  3HY7 A;  3KEJ A;  2RJQ A;  3RTT A;  1OM7 A;  2WO8 A;  2AIG P;  1R1H A;  1KUH A;  1G9K A;  3F1A A;  1O0T A;  2JSD A;  1EAK A;  3EHX A;  3ZUK A;  3B2Z A;  1JAN A;  2ERO A;  3LJG A;  4GR0 A;  1OMJ A;  5BOT A;  3HBU P;  1CGL A;  1ROS A;  3EHY A;  1IAB A;  3LJZ A;  4XM8 A;  2OI0 A;  3U1R A;  4JQG A;  3WV1 A;  4J4M A;  2JIH A;  1XFU A;  1HFS A;  2Y6D A;  1QIB A;  2QPJ A;  3VI1 A;  5D1S A;  3F17 A;  3NX7 A;  1O0Q A;  2MZI A;  1UTZ A;  1XUC A;  4FVL A;  3OHL A;  3AYK A;  4L7A A;  4H84 A;  1ND1 A;  1J7N A;  4H82 A;  1KUF A;  1SAT A;  2N8R A;  5I3M A;  3LMC A;  2OW9 A;  1ATL A;  1XFX A;  1Y93 A;  1BIW A;  3F19 A;  1B3D A;  3KEK A;  1JAP A;  2SRT A;  1YQY A;  3DTE A;  3ZXH A;  1CXV A;  1SRP A;  3HB2 P;  3F15 A;  3I7G A;  2OVZ A;  3HDB A;  4DPE A;  1G12 A;  5D1U A;  3TSK A;  1YP1 A;  4IN9 A;  2JT6 A;  1JH1 A;  3K7L A;  3VTG A;  2E2D A;  1HOV A;  4L19 A;  4IJO A;  4GWN A;  4ZR5 A;  1EUB A;  1OM6 A;  2OXU A;  4GF1 A;  2CLT A;  4XM6 A;  3LE9 A;  2X3C A;  1ZXV A;  3TS4 A;  4H3X A;  1DMT A;  1PWV A;  456C A;  4H49 A;  2DW0 A;  3O2X A;  3DL1 A;  1AKL A;  3UVC A;  2POJ A;  1I73 A;  1R1I A;  3LJT A;  2USN A;  1GE5 A;  1RMZ A;  4A7B A;  1K7I A;  1GKD A;  4H2E A;  2MLS A;  5I43 A;  5I12 A;  2OY4 A;  1BM6 A;  1KBC A;  2MZE A;  1B8Y A;  3N2U A;  4JIJ A;  4WKE A;  4PKW A;  3V96 B;  4FU4 A;  1MMR A;  4PKV A;  3G5C A;  3BA0 A;  3TVC A;  1XFZ A;  4I03 A;  1OM8 A;  3L0V A;  3DTK A;  3EWJ A;  3LGP A;  4FXQ A;  4JPA A;  2AYK A;  966C A;  3SHI A;  2OW2 A; 
#chains in the Genus database with same CATH homology
 3OHO A;  4JP4 A;  3USN A;  3I7I A;  3EDI A;  1IAE A;  2FV5 A;  1IAA A;  3P1V A;  3B92 A;  3GBO A;  1AYK A;  4HX3 A;  3RTS A;  5B5O A;  3KME A;  1D8F A;  1YCM A;  4ON1 A;  2ERP A;  2W0D A;  4AYK A;  5CXA A;  1Q3A A;  1FLS A;  3HDA P;  5CUH A;  3LUN A;  2OVX A;  3DWB A;  1OS2 A;  3WV3 A;  4PKR A;  1HY7 A;  1GKC A;  1KUG A;  1G05 A;  1HV5 A;  5CZM A;  1JK3 A;  1IAD A;  2HU6 A;  1JIZ A;  2DW2 A;  1MMB A;  2OZR A;  2YB9 A;  4XM7 A;  2FV9 A;  2J0T A;  4AIG A;  2W13 A;  1XFV A;  1H71 P;  2V4B A;  1ZS0 A;  2W14 A;  4L63 A;  4DD8 A;  2K2G A;  1MNC A;  4ILW D;  2D1N A;  1C3I A;  1GE7 A;  2WO9 A;  2O3E A;  4EFS A;  3DNG A;  1ZP5 A;  4JA1 A;  1GO8 P;  3KMC A;  1FBL A;  4H1Q A;  3AIG A;  2OXW A;  1PWU A;  1YOU A;  2CKI A;  1XFY A;  1ZTQ A;  1D8M A;  2E3X A;  1RM8 A;  1D5J A;  1OO9 A;  4I35 A;  1GE6 A;  1AF0 A;  2I47 A;  2DDY A;  2L0R A;  1S4B P;  1JJ9 A;  4CTH A;  3LK8 A;  2OY2 A;  3Q2G A;  1BZS A;  2X3A A;  5D1T A;  1BKC A;  2PJT A;  2RJP A;  1SLN A;  5L7F A;  3DPE A;  1XUD A;  1HFC A;  830C A;  1CAQ A;  4HMA A;  1HTD A;  1KUI A;  2W15 A;  2O36 A;  3B8Z A;  1PWW A;  4WK7 A;  2OW0 A;  1JIW P;  4XBH A;  1JKY A;  2OXZ A;  3MA2 A;  4DF9 A;  1BQO A;  1UTT A;  4XCT A;  5B5P A;  4PKT A;  4GQL A;  3L0T A;  1EB6 A;  4G9L A;  5D7W A;  4PKQ A;  4R3V A;  3LKA A;  1CGE A;  1KAP P;  1OS9 A;  1CGF A;  4DV8 A;  1ZXC A;  4GWM A;  3AYU A;  2TCL A;  3DTI A;  2K9C A;  1R55 A;  2J83 A;  5JMY A;  1QJJ A;  2Y6C A;  4WKI A;  1BSW A;  1CQR A;  2X7M A;  4L6T A;  2YUF A;  2XS3 A;  4G0D A;  2X3B A;  4Q1L A;  2ERQ A;  3HBV P;  3F16 A;  3Q2H A;  1UEA A;  1ZVX A;  1CK7 A;  1SU3 A;  1UMS A;  1GO7 P;  5BPA A;  3EDG A;  5LAB A;  1G49 A;  1JAQ A;  1I76 A;  3LIK A;  4A3W A;  5H8X A;  1IAC A;  3P24 A;  3F18 A;  1WNI A;  4WZV A;  2WOA A;  2A8H A;  1C7K A;  1GXD A;  1XUR A;  5I4O A;  3LIL A;  1USN A;  1L6J A;  1K7Q A;  4QKZ A;  1JAO A;  1Y0V A;  1BQQ M;  1D7X A;  2OW1 A;  3EDZ A;  2DDF A;  1K7G A;  3EDH A;  2MZH A;  3DSL A;  1A86 A;  1SLM A;  4H76 A;  1Z3J A;  4GUY A;  1R54 A;  1G4K A;  1QIC A;  1SMP A;  3O64 A;  1BKC E;  5BOY A;  1IAG A;  2D1O A;  1R1J A;  4AUO A;  4PKS A;  3KWV C;  5L79 A;  3K7N A;  2JT5 A;  5D2B A;  3LIR A;  3TT4 A;  5D3C A;  3KEC A;  3LUM A;  2KRJ A;  1BUD A;  1KUK A;  1Y8J A;  1I1I P;  4FXY P;  2DW1 A;  2Z2D A;  1C8T A;  3ELM A;  1DTH A;  1AST A;  3E8R A;  1CIZ A;  3ZVS A;  3KRY A;  1A85 A;  1QIA A;  3LQB A;  1XFW A;  3KHI A;  2JNP A;  5I2Z A;  3LQ0 A;  1MMP A;  4IUW A;  1QUA A;  3G42 A;  4GR8 A;  3LEA A;  1FM1 A;  2MLR A;  1UMT A;  3WV2 A;  5I0L A;  1BUV M;  4GR3 A;  3HY9 A;  2YIG A;  3CKI A;  1BKC I;  2XS4 A;  3HYG A;  4PKU A;  4H30 A;  4AXQ A;  1PWP A;  2W12 A;  1MMQ A;  1QJI A;  3DPF A;  1PWQ A;  4WF6 A;  3N2V A;  3HY7 A;  3KEJ A;  2RJQ A;  3RTT A;  1OM7 A;  2WO8 A;  2AIG P;  1R1H A;  1KUH A;  1G9K A;  3F1A A;  1O0T A;  2JSD A;  1EAK A;  3EHX A;  3ZUK A;  3B2Z A;  1JAN A;  2ERO A;  3LJG A;  4GR0 A;  1OMJ A;  5BOT A;  3HBU P;  1CGL A;  1ROS A;  3EHY A;  1IAB A;  3LJZ A;  4XM8 A;  2OI0 A;  3U1R A;  4JQG A;  3WV1 A;  4J4M A;  2JIH A;  1XFU A;  1HFS A;  2Y6D A;  1QIB A;  2QPJ A;  3VI1 A;  5D1S A;  3F17 A;  3NX7 A;  1O0Q A;  2MZI A;  1UTZ A;  1XUC A;  4FVL A;  3OHL A;  3AYK A;  4L7A A;  4H84 A;  1ND1 A;  1J7N A;  4H82 A;  1KUF A;  1SAT A;  2N8R A;  5I3M A;  3LMC A;  2OW9 A;  1ATL A;  1XFX A;  1Y93 A;  1BIW A;  3F19 A;  1B3D A;  3KEK A;  1JAP A;  2SRT A;  1YQY A;  3DTE A;  3ZXH A;  1CXV A;  1SRP A;  3HB2 P;  3F15 A;  3I7G A;  2OVZ A;  3HDB A;  4DPE A;  1G12 A;  5D1U A;  3TSK A;  1YP1 A;  4IN9 A;  2JT6 A;  1JH1 A;  3K7L A;  3VTG A;  2E2D A;  1HOV A;  4L19 A;  4IJO A;  4GWN A;  4ZR5 A;  1EUB A;  1OM6 A;  2OXU A;  4GF1 A;  2CLT A;  4XM6 A;  3LE9 A;  2X3C A;  1ZXV A;  3TS4 A;  4H3X A;  1DMT A;  1PWV A;  456C A;  4H49 A;  2DW0 A;  3O2X A;  3DL1 A;  1AKL A;  3UVC A;  2POJ A;  1I73 A;  1R1I A;  3LJT A;  2USN A;  1GE5 A;  1RMZ A;  4A7B A;  1K7I A;  1GKD A;  4H2E A;  2MLS A;  5I43 A;  5I12 A;  2OY4 A;  1BM6 A;  1KBC A;  2MZE A;  1B8Y A;  3N2U A;  4JIJ A;  4WKE A;  4PKW A;  3V96 B;  4FU4 A;  1MMR A;  4PKV A;  3G5C A;  3BA0 A;  3TVC A;  1XFZ A;  4I03 A;  1OM8 A;  3L0V A;  3DTK A;  3EWJ A;  3LGP A;  4FXQ A;  4JPA A;  2AYK A;  966C A;  3SHI A;  2OW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...