2MZEA

Nmr solution structure of the pro form of human matrilysin (prommp-7)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
250
structure length
250
Chain Sequence
LPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHALGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrilysin
publication title Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 45
structure length 250
sequence length 250
ec nomenclature ec 3.4.24.23: Matrilysin.
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2mzeA00
1ROSA 4JP4A 2X3AA 5CUHA 1OS9A 4J4MA 4DF9A 1J7NA 4CTHA 3ZVSA 1C8TA 4JQGA 4WF6A 4I03A 1CGLA 1D8FA 3RTTA 1SLNA 1JAOA 1K7GA 1BKCI 3P1VA 1HY7A 1Z3JA 3USNA 1QIAA 2OW0A 3K7LA 2Y6DA 1BKCE 1D8MA 1AF0A 4FXQA 1BUDA 2E3XA 3TVCA 4H30A 5I2ZA 1XFXA 3F16A 1UTTA 3I7GA 3LJGA 2D1NA 1UEAA 1SMPA 1XFYA 3F15A 2OVXA 3EDIA 3HBVP 1XFZA 1I76A 1IAGA 3DWBA 3BA0A 1KUIA 3K7NA 1MMRA 1Y0VA 2K2GA 5B5OA 2OW2A 2L0RA 1YQYA 3B8ZA 2WOAA 1JAPA 3B2ZA 1IAEA 1CQRA 1HV5A 1OM6A 1IADA 2CKIA 5B5PA 5BPAA 2DDYA 2MZEA 1EB6A 3ELMA 3DPFA 2JIHA 3ZXHA 1OM7A 2FV9A 2OY4A 2YB9A 1B3DA 2PJTA 1I73A 3WV2A 1FBLA 1BM6A 2RJQA 1D7XA 2W0DA 4L19A 4GR8A 1HFSA 1GO8P 1G4KA 3OHOA 2CLTA 1DTHA 3MA2A 2JNPA 4H2EA 3SHIA 3LK8A 4AXQA 4A3WA 1QIBA 1ZXCA 1HOVA 4GR0A 1B8YA 2OW1A 5I12A 1G9KA 3DPEA 1SRPA 2QPJA 1MMPA 3TSKA 1CGEA 2WO8A 2Y6CA 3LQ0A 2DW0A 5H8XA 3F1AA 5D1TA 1PWPA 3I7IA 4GWMA 1XUDA 2POJA 2J0TA 3VI1A 3ZUKA 3DNGA 1H71P 5D2BA 1R54A 4PKRA 1MNCA 1YCMA 3O64A 3LIRA 2I47A 1EAKA 1CAQA 3NX7A 5BOYA 4JPAA 2DW1A 4Q1LA 1C7KA 4IUWA 1BZSA 3HBUP 3P24A 2V4BA 4GF1A 5LABA 1PWVA 3F17A 1SATA 4ILWD 4DV8A 2A8HA 3TT4A 2DDFA 1ASTA 1IABA 3EHXA 2JT6A 4FXYP 2KRJA 1OMJA 5BOTA 1KUFA 1YP1A 1HTDA 1ZP5A 3LMCA 4DD8A 1CXVA 1JH1A 3LKAA 1EUBA 5D1SA 2W13A 4G0DA 4WZVA 1XFVA 4XBHA 1USNA 4ON1A 1KBCA 1UMSA 3HB2P 1GE6A 3KECA 1A85A 4HMAA 1PWQA 3LEAA 3B92A 3EDGA 4GWNA 4JIJA 2X7MA 1QJIA 4H84A 2USNA 1IACA 1AKLA 966CA 1ND1A 3KHIA 1MMQA 1JANA 1C3IA 4DPEA 3KWVC 3LGPA 4WKIA 4JA1A 1K7QA 1XFUA 1JJ9A 1IAAA 4A7BA 2RJPA 1WNIA 3LIKA 2MLRA 4AIGA 3HY7A 4GQLA 4GUYA 4PKQA 3N2VA 4PKVA 5D1UA 2W12A 1Y93A 2W14A 1ZXVA 1GXDA 2DW2A 2FV5A 3AYKA 4XM8A 1AYKA 1R55A 2X3CA 4EFSA 2OZRA 1OM8A 1QICA 3TS4A 1PWUA 830CA 5I4OA 4PKWA 5D7WA 5L79A 2N8RA 2HU6A 2X3BA 2XS4A 4ZR5A 2OXWA 1A86A 1JKYA 4G9LA 4AYKA 2W15A 1SLMA 3CKIA 2Z2DA 1KAPP 1BSWA 1I1IP 3EHYA 2SRTA 1BQQM 1G05A 1JIZA 456CA 1CIZA 1JAQA 4GR3A 2WO9A 4IN9A 3F18A 3KEJA 2TCLA 3EDZA 3WV1A 2MZIA 1BIWA 1GE7A 1KUHA 2AIGP 3LUNA 5CXAA 1GKDA 1UTZA 1CGFA 1BQOA 3Q2HA 4IJOA 1MMBA 4XM7A 1ZTQA 5I0LA 2EROA 4PKSA 1L6JA 1ZS0A 3LE9A 1G49A 2YIGA 3RTSA 2K9CA 1CK7A 2O36A 3KMEA 1S4BP 1ZVXA 4HX3A 2JSDA 4XCTA 1FM1A 4WK7A 4XM6A 1YOUA 3UVCA 4R3VA 4H82A 3F19A 1XURA 3U1RA 2OXZA 3DSLA 1O0QA 1QJJA 3LJTA 5CZMA 3HY9A 3O2XA 5L7FA 1OS2A 2OI0A 3KRYA 1RMZA 2O3EA 1QUAA 4H1QA 3V96B 3HYGA 4QKZA 3KEKA 2OXUA 3OHLA 1D5JA 1G12A 4L6TA 3G42A 3Q2GA 1K7IA 2J83A 1R1HA 1SU3A 5D3CA 3HDBA 4WKEA 3LUMA 4PKUA 1Y8JA 3E8RA 3G5CA 3LQBA 1JK3A 3L0VA 2JT5A 1R1JA 2OVZA 1O0TA 5JMYA 3LJZA 2OY2A 1JIWP 4FVLA 2XS3A 1KUGA 1OO9A 3AYUA 1PWWA 1ATLA 2MLSA 1Q3AA 1GKCA 3AIGA 4H76A 3L0TA 3LILA 2OW9A 1BUVM 4H3XA 4I35A 2ERQA 1FLSA 5I43A 3KMCA 3EWJA 1BKCA 2E2DA 1XFWA 3N2UA 1XUCA 1UMTA 3EDHA 5I3MA 2D1OA 1DMTA 1RM8A 1R1IA 2MZHA 3HDAP 4AUOA 4PKTA 2AYKA 1KUKA 3VTGA 1GE5A 2ERPA 3WV3A 4FU4A 3DL1A 4H49A 1HFCA 1GO7P 4L63A 3GBOA
chains in the Genus database with same CATH superfamily
1ROSA 4JP4A 2X3AA 5CUHA 1OS9A 4J4MA 4DF9A 1J7NA 4CTHA 3ZVSA 1C8TA 4JQGA 4WF6A 4I03A 1CGLA 1D8FA 3RTTA 1SLNA 1JAOA 1K7GA 1BKCI 3P1VA 1HY7A 1Z3JA 3USNA 1QIAA 2OW0A 3K7LA 2Y6DA 1BKCE 1D8MA 1AF0A 4FXQA 1BUDA 2E3XA 3TVCA 4H30A 5I2ZA 1XFXA 3F16A 1UTTA 3I7GA 3LJGA 2D1NA 1UEAA 1SMPA 1XFYA 3F15A 2OVXA 3EDIA 3HBVP 1XFZA 1I76A 1IAGA 3DWBA 3BA0A 1KUIA 3K7NA 1MMRA 1Y0VA 2K2GA 5B5OA 2OW2A 2L0RA 1YQYA 3B8ZA 2WOAA 1JAPA 3B2ZA 1IAEA 1CQRA 1HV5A 1OM6A 3DTEA 1IADA 2CKIA 5B5PA 5BPAA 2DDYA 2MZEA 1EB6A 3ELMA 3DPFA 2JIHA 3ZXHA 1OM7A 2FV9A 2OY4A 2YB9A 1B3DA 2PJTA 1I73A 3WV2A 1FBLA 1BM6A 2RJQA 1D7XA 2W0DA 4L19A 4GR8A 1HFSA 1GO8P 1G4KA 3OHOA 2CLTA 1DTHA 3MA2A 2JNPA 4H2EA 3SHIA 3LK8A 4AXQA 4A3WA 1OZ9A 1QIBA 1ZXCA 1HOVA 4GR0A 1B8YA 2OW1A 5I12A 1G9KA 3DPEA 1SRPA 2QPJA 1MMPA 3TSKA 3DTIA 1CGEA 2WO8A 2Y6CA 3LQ0A 2DW0A 5H8XA 3F1AA 5D1TA 1XAXA 1PWPA 3I7IA 4GWMA 1XUDA 2POJA 2J0TA 3VI1A 3ZUKA 3DNGA 1H71P 5D2BA 1R54A 4PKRA 1MNCA 1YCMA 3O64A 3LIRA 2I47A 1EAKA 1CAQA 3NX7A 5BOYA 4JPAA 2DW1A 4Q1LA 1C7KA 4IUWA 1BZSA 3HBUP 3P24A 2V4BA 4GF1A 5LABA 1PWVA 3F17A 1SATA 4ILWD 4DV8A 2A8HA 3TT4A 2DDFA 1ASTA 1IABA 3EHXA 2JT6A 4FXYP 2KRJA 1OMJA 5BOTA 1KUFA 1YP1A 1HTDA 1ZP5A 3LMCA 4DD8A 1CXVA 1JH1A 3LKAA 1EUBA 5D1SA 2W13A 4G0DA 4WZVA 1XFVA 4XBHA 1USNA 4ON1A 1KBCA 1UMSA 3HB2P 1GE6A 3KECA 1A85A 4HMAA 1PWQA 3LEAA 3B92A 3EDGA 4GWNA 4JIJA 2X7MA 1QJIA 4H84A 2USNA 1IACA 1AKLA 966CA 1ND1A 3KHIA 1MMQA 1JANA 1C3IA 4DPEA 3KWVC 3LGPA 4WKIA 4JA1A 1K7QA 1XFUA 1JJ9A 1IAAA 4A7BA 2RJPA 1WNIA 3LIKA 2MLRA 4AIGA 3HY7A 2YUFA 4GQLA 4GUYA 4PKQA 3N2VA 4PKVA 5D1UA 2W12A 4L7AA 1Y93A 2W14A 1ZXVA 1GXDA 1TVIA 2DW2A 2FV5A 3AYKA 4XM8A 1AYKA 1R55A 2X3CA 4EFSA 2OZRA 1OM8A 1QICA 3TS4A 1PWUA 830CA 5I4OA 4PKWA 5D7WA 5L79A 2N8RA 2HU6A 2X3BA 2XS4A 4ZR5A 2OXWA 1A86A 1JKYA 4G9LA 4AYKA 2W15A 1SLMA 3CKIA 2Z2DA 1KAPP 1XM5A 1BSWA 1I1IP 3EHYA 2SRTA 1BQQM 1G05A 1JIZA 456CA 1CIZA 1JAQA 4GR3A 2WO9A 4IN9A 3F18A 3KEJA 2TCLA 3EDZA 3WV1A 2MZIA 1BIWA 1GE7A 1KUHA 2AIGP 3LUNA 5CXAA 1GKDA 1UTZA 1CGFA 1BQOA 3Q2HA 4IJOA 1MMBA 4XM7A 1ZTQA 5I0LA 2EROA 4PKSA 1L6JA 1ZS0A 3LE9A 1G49A 2YIGA 3RTSA 2K9CA 1CK7A 2O36A 3KMEA 1S4BP 1ZVXA 4HX3A 2JSDA 4XCTA 1FM1A 4WK7A 4XM6A 1YOUA 3UVCA 4R3VA 4H82A 3F19A 1XURA 3U1RA 2OXZA 3DSLA 1O0QA 1QJJA 3LJTA 5CZMA 3HY9A 3O2XA 5L7FA 1OS2A 2OI0A 3KRYA 1RMZA 2O3EA 1QUAA 4H1QA 3V96B 3HYGA 4QKZA 3KEKA 2OXUA 3OHLA 1D5JA 1G12A 4L6TA 3G42A 3Q2GA 1K7IA 2J83A 1R1HA 1SU3A 5D3CA 3HDBA 4WKEA 3LUMA 4PKUA 1Y8JA 3E8RA 3G5CA 3LQBA 1JK3A 3L0VA 2JT5A 1R1JA 2OVZA 1O0TA 5JMYA 3LJZA 2OY2A 1JIWP 4FVLA 2XS3A 1KUGA 1OO9A 3AYUA 1PWWA 1ATLA 2MLSA 1Q3AA 1GKCA 3AIGA 4H76A 3L0TA 3LILA 2OW9A 1BUVM 4H3XA 4I35A 2ERQA 1FLSA 5I43A 3KMCA 3EWJA 1BKCA 2E2DA 1XFWA 3N2UA 1XUCA 1UMTA 3EDHA 5I3MA 2D1OA 1DMTA 1RM8A 1R1IA 2MZHA 3HDAP 4AUOA 4PKTA 2AYKA 1KUKA 3VTGA 1GE5A 2ERPA 3WV3A 4FU4A 3DL1A 4H49A 1HFCA 1GO7P 4L63A 3GBOA 3DTKA
chains in the Genus database with same CATH topology
1ROSA 4JP4A 2X3AA 5CUHA 1OS9A 4J4MA 4DF9A 1J7NA 4CTHA 3ZVSA 1C8TA 4JQGA 4WF6A 4I03A 1CGLA 1D8FA 3RTTA 1SLNA 1JAOA 1K7GA 1BKCI 3P1VA 1HY7A 1Z3JA 3USNA 1QIAA 2OW0A 3K7LA 2Y6DA 1BKCE 1D8MA 1AF0A 4FXQA 1BUDA 2E3XA 3TVCA 4H30A 5I2ZA 1XFXA 3F16A 1UTTA 3I7GA 3LJGA 2D1NA 1UEAA 1SMPA 1XFYA 3F15A 2OVXA 3EDIA 3HBVP 1XFZA 1I76A 1IAGA 3DWBA 3BA0A 1KUIA 3K7NA 1MMRA 1Y0VA 2K2GA 5B5OA 2OW2A 2L0RA 1YQYA 3B8ZA 2WOAA 1JAPA 3B2ZA 1IAEA 1CQRA 1HV5A 1OM6A 3DTEA 1IADA 2CKIA 5B5PA 5BPAA 2DDYA 2MZEA 1EB6A 3ELMA 3DPFA 2JIHA 3ZXHA 1OM7A 2FV9A 2OY4A 2YB9A 1B3DA 2PJTA 1I73A 3WV2A 1FBLA 1BM6A 2RJQA 1D7XA 2W0DA 4L19A 4GR8A 1HFSA 1GO8P 1G4KA 3OHOA 2CLTA 1DTHA 3MA2A 2JNPA 4H2EA 3SHIA 3LK8A 4AXQA 4A3WA 1QIBA 1ZXCA 1HOVA 4GR0A 1B8YA 2OW1A 5I12A 1G9KA 3DPEA 1SRPA 2QPJA 1MMPA 3TSKA 3DTIA 1CGEA 2WO8A 2Y6CA 3LQ0A 2DW0A 5H8XA 3F1AA 5D1TA 1PWPA 3I7IA 4GWMA 1XUDA 2POJA 2J0TA 3VI1A 3ZUKA 3DNGA 1H71P 5D2BA 1R54A 4PKRA 1MNCA 1YCMA 3O64A 3LIRA 2I47A 1EAKA 1CAQA 3NX7A 5BOYA 4JPAA 2DW1A 4Q1LA 1C7KA 4IUWA 1BZSA 3HBUP 3P24A 2V4BA 4GF1A 5LABA 1PWVA 3F17A 1SATA 4ILWD 4DV8A 2A8HA 3TT4A 2DDFA 1ASTA 1IABA 3EHXA 2JT6A 4FXYP 2KRJA 1OMJA 5BOTA 1KUFA 1YP1A 1HTDA 1ZP5A 3LMCA 4DD8A 1CXVA 1JH1A 3LKAA 1EUBA 5D1SA 2W13A 4G0DA 4WZVA 1XFVA 4XBHA 1USNA 4ON1A 1KBCA 1UMSA 3HB2P 1GE6A 3KECA 1A85A 4HMAA 1PWQA 3LEAA 3B92A 3EDGA 4GWNA 4JIJA 2X7MA 1QJIA 4H84A 2USNA 1IACA 1AKLA 966CA 1ND1A 3KHIA 1MMQA 1JANA 1C3IA 4DPEA 3KWVC 3LGPA 4WKIA 4JA1A 1K7QA 1XFUA 1JJ9A 1IAAA 4A7BA 2RJPA 1WNIA 3LIKA 2MLRA 4AIGA 3HY7A 2YUFA 4GQLA 4GUYA 4PKQA 3N2VA 4PKVA 5D1UA 2W12A 4L7AA 1Y93A 2W14A 1ZXVA 1GXDA 2DW2A 2FV5A 3AYKA 4XM8A 1AYKA 1R55A 2X3CA 4EFSA 2OZRA 1OM8A 1QICA 3TS4A 1PWUA 830CA 5I4OA 4PKWA 5D7WA 5L79A 2N8RA 2HU6A 2X3BA 2XS4A 4ZR5A 2OXWA 1A86A 1JKYA 4G9LA 4AYKA 2W15A 1SLMA 3CKIA 2Z2DA 1KAPP 1BSWA 1I1IP 3EHYA 2SRTA 1BQQM 1G05A 1JIZA 456CA 1CIZA 1JAQA 4GR3A 2WO9A 4IN9A 3F18A 3KEJA 2TCLA 3EDZA 3WV1A 2MZIA 1BIWA 1GE7A 1KUHA 2AIGP 3LUNA 5CXAA 1GKDA 1UTZA 1CGFA 1BQOA 3Q2HA 4IJOA 1MMBA 4XM7A 1ZTQA 5I0LA 2EROA 4PKSA 1L6JA 1ZS0A 3LE9A 1G49A 2YIGA 3RTSA 2K9CA 1CK7A 2O36A 3KMEA 1S4BP 1ZVXA 4HX3A 2JSDA 4XCTA 1FM1A 4WK7A 4XM6A 1YOUA 3UVCA 4R3VA 4H82A 3F19A 1XURA 3U1RA 2OXZA 3DSLA 1O0QA 1QJJA 3LJTA 5CZMA 3HY9A 3O2XA 5L7FA 1OS2A 2OI0A 3KRYA 1RMZA 2O3EA 1QUAA 4H1QA 3V96B 3HYGA 4QKZA 3KEKA 2OXUA 3OHLA 1D5JA 1G12A 4L6TA 3G42A 3Q2GA 1K7IA 2J83A 1R1HA 1SU3A 5D3CA 3HDBA 4WKEA 3LUMA 4PKUA 1Y8JA 3E8RA 3G5CA 3LQBA 1JK3A 3L0VA 2JT5A 1R1JA 2OVZA 1O0TA 5JMYA 3LJZA 2OY2A 1JIWP 4FVLA 2XS3A 1KUGA 1OO9A 3AYUA 1PWWA 1ATLA 2MLSA 1Q3AA 1GKCA 3AIGA 4H76A 3L0TA 3LILA 2OW9A 1BUVM 4H3XA 4I35A 2ERQA 1FLSA 5I43A 3KMCA 3EWJA 1BKCA 2E2DA 1XFWA 3N2UA 1XUCA 1UMTA 3EDHA 5I3MA 2D1OA 1DMTA 1RM8A 1R1IA 2MZHA 3HDAP 4AUOA 4PKTA 2AYKA 1KUKA 3VTGA 1GE5A 2ERPA 3WV3A 4FU4A 3DL1A 4H49A 1HFCA 1GO7P 4L63A 3GBOA 3DTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROS A;  4JP4 A;  2X3A A;  5CUH A;  1OS9 A;  4J4M A;  4DF9 A;  1J7N A;  4CTH A;  3ZVS A;  1C8T A;  4JQG A;  4WF6 A;  4I03 A;  1CGL A;  1D8F A;  3RTT A;  1SLN A;  1JAO A;  1K7G A;  1BKC I;  3P1V A;  1HY7 A;  1Z3J A;  3USN A;  1QIA A;  2OW0 A;  3K7L A;  2Y6D A;  1BKC E;  1D8M A;  1AF0 A;  4FXQ A;  1BUD A;  2E3X A;  3TVC A;  4H30 A;  5I2Z A;  1XFX A;  3F16 A;  1UTT A;  3I7G A;  3LJG A;  2D1N A;  1UEA A;  1SMP A;  1XFY A;  3F15 A;  2OVX A;  3EDI A;  3HBV P;  1XFZ A;  1I76 A;  1IAG A;  3DWB A;  3BA0 A;  1KUI A;  3K7N A;  1MMR A;  1Y0V A;  2K2G A;  5B5O A;  2OW2 A;  2L0R A;  1YQY A;  3B8Z A;  2WOA A;  1JAP A;  3B2Z A;  1IAE A;  1CQR A;  1HV5 A;  1OM6 A;  1IAD A;  2CKI A;  5B5P A;  5BPA A;  2DDY A;  2MZE A;  1EB6 A;  3ELM A;  3DPF A;  2JIH A;  3ZXH A;  1OM7 A;  2FV9 A;  2OY4 A;  2YB9 A;  1B3D A;  2PJT A;  1I73 A;  3WV2 A;  1FBL A;  1BM6 A;  2RJQ A;  1D7X A;  2W0D A;  4L19 A;  4GR8 A;  1HFS A;  1GO8 P;  1G4K A;  3OHO A;  2CLT A;  1DTH A;  3MA2 A;  2JNP A;  4H2E A;  3SHI A;  3LK8 A;  4AXQ A;  4A3W A;  1QIB A;  1ZXC A;  1HOV A;  4GR0 A;  1B8Y A;  2OW1 A;  5I12 A;  1G9K A;  3DPE A;  1SRP A;  2QPJ A;  1MMP A;  3TSK A;  1CGE A;  2WO8 A;  2Y6C A;  3LQ0 A;  2DW0 A;  5H8X A;  3F1A A;  5D1T A;  1PWP A;  3I7I A;  4GWM A;  1XUD A;  2POJ A;  2J0T A;  3VI1 A;  3ZUK A;  3DNG A;  1H71 P;  5D2B A;  1R54 A;  4PKR A;  1MNC A;  1YCM A;  3O64 A;  3LIR A;  2I47 A;  1EAK A;  1CAQ A;  3NX7 A;  5BOY A;  4JPA A;  2DW1 A;  4Q1L A;  1C7K A;  4IUW A;  1BZS A;  3HBU P;  3P24 A;  2V4B A;  4GF1 A;  5LAB A;  1PWV A;  3F17 A;  1SAT A;  4ILW D;  4DV8 A;  2A8H A;  3TT4 A;  2DDF A;  1AST A;  1IAB A;  3EHX A;  2JT6 A;  4FXY P;  2KRJ A;  1OMJ A;  5BOT A;  1KUF A;  1YP1 A;  1HTD A;  1ZP5 A;  3LMC A;  4DD8 A;  1CXV A;  1JH1 A;  3LKA A;  1EUB A;  5D1S A;  2W13 A;  4G0D A;  4WZV A;  1XFV A;  4XBH A;  1USN A;  4ON1 A;  1KBC A;  1UMS A;  3HB2 P;  1GE6 A;  3KEC A;  1A85 A;  4HMA A;  1PWQ A;  3LEA A;  3B92 A;  3EDG A;  4GWN A;  4JIJ A;  2X7M A;  1QJI A;  4H84 A;  2USN A;  1IAC A;  1AKL A;  966C A;  1ND1 A;  3KHI A;  1MMQ A;  1JAN A;  1C3I A;  4DPE A;  3KWV C;  3LGP A;  4WKI A;  4JA1 A;  1K7Q A;  1XFU A;  1JJ9 A;  1IAA A;  4A7B A;  2RJP A;  1WNI A;  3LIK A;  2MLR A;  4AIG A;  3HY7 A;  4GQL A;  4GUY A;  4PKQ A;  3N2V A;  4PKV A;  5D1U A;  2W12 A;  1Y93 A;  2W14 A;  1ZXV A;  1GXD A;  2DW2 A;  2FV5 A;  3AYK A;  4XM8 A;  1AYK A;  1R55 A;  2X3C A;  4EFS A;  2OZR A;  1OM8 A;  1QIC A;  3TS4 A;  1PWU A;  830C A;  5I4O A;  4PKW A;  5D7W A;  5L79 A;  2N8R A;  2HU6 A;  2X3B A;  2XS4 A;  4ZR5 A;  2OXW A;  1A86 A;  1JKY A;  4G9L A;  4AYK A;  2W15 A;  1SLM A;  3CKI A;  2Z2D A;  1KAP P;  1BSW A;  1I1I P;  3EHY A;  2SRT A;  1BQQ M;  1G05 A;  1JIZ A;  456C A;  1CIZ A;  1JAQ A;  4GR3 A;  2WO9 A;  4IN9 A;  3F18 A;  3KEJ A;  2TCL A;  3EDZ A;  3WV1 A;  2MZI A;  1BIW A;  1GE7 A;  1KUH A;  2AIG P;  3LUN A;  5CXA A;  1GKD A;  1UTZ A;  1CGF A;  1BQO A;  3Q2H A;  4IJO A;  1MMB A;  4XM7 A;  1ZTQ A;  5I0L A;  2ERO A;  4PKS A;  1L6J A;  1ZS0 A;  3LE9 A;  1G49 A;  2YIG A;  3RTS A;  2K9C A;  1CK7 A;  2O36 A;  3KME A;  1S4B P;  1ZVX A;  4HX3 A;  2JSD A;  4XCT A;  1FM1 A;  4WK7 A;  4XM6 A;  1YOU A;  3UVC A;  4R3V A;  4H82 A;  3F19 A;  1XUR A;  3U1R A;  2OXZ A;  3DSL A;  1O0Q A;  1QJJ A;  3LJT A;  5CZM A;  3HY9 A;  3O2X A;  5L7F A;  1OS2 A;  2OI0 A;  3KRY A;  1RMZ A;  2O3E A;  1QUA A;  4H1Q A;  3V96 B;  3HYG A;  4QKZ A;  3KEK A;  2OXU A;  3OHL A;  1D5J A;  1G12 A;  4L6T A;  3G42 A;  3Q2G A;  1K7I A;  2J83 A;  1R1H A;  1SU3 A;  5D3C A;  3HDB A;  4WKE A;  3LUM A;  4PKU A;  1Y8J A;  3E8R A;  3G5C A;  3LQB A;  1JK3 A;  3L0V A;  2JT5 A;  1R1J A;  2OVZ A;  1O0T A;  5JMY A;  3LJZ A;  2OY2 A;  1JIW P;  4FVL A;  2XS3 A;  1KUG A;  1OO9 A;  3AYU A;  1PWW A;  1ATL A;  2MLS A;  1Q3A A;  1GKC A;  3AIG A;  4H76 A;  3L0T A;  3LIL A;  2OW9 A;  1BUV M;  4H3X A;  4I35 A;  2ERQ A;  1FLS A;  5I43 A;  3KMC A;  3EWJ A;  1BKC A;  2E2D A;  1XFW A;  3N2U A;  1XUC A;  1UMT A;  3EDH A;  5I3M A;  2D1O A;  1DMT A;  1RM8 A;  1R1I A;  2MZH A;  3HDA P;  4AUO A;  4PKT A;  2AYK A;  1KUK A;  3VTG A;  1GE5 A;  2ERP A;  3WV3 A;  4FU4 A;  3DL1 A;  4H49 A;  1HFC A;  1GO7 P;  4L63 A;  3GBO A; 
#chains in the Genus database with same CATH topology
 1ROS A;  4JP4 A;  2X3A A;  5CUH A;  1OS9 A;  4J4M A;  4DF9 A;  1J7N A;  4CTH A;  3ZVS A;  1C8T A;  4JQG A;  4WF6 A;  4I03 A;  1CGL A;  1D8F A;  3RTT A;  1SLN A;  1JAO A;  1K7G A;  1BKC I;  3P1V A;  1HY7 A;  1Z3J A;  3USN A;  1QIA A;  2OW0 A;  3K7L A;  2Y6D A;  1BKC E;  1D8M A;  1AF0 A;  4FXQ A;  1BUD A;  2E3X A;  3TVC A;  4H30 A;  5I2Z A;  1XFX A;  3F16 A;  1UTT A;  3I7G A;  3LJG A;  2D1N A;  1UEA A;  1SMP A;  1XFY A;  3F15 A;  2OVX A;  3EDI A;  3HBV P;  1XFZ A;  1I76 A;  1IAG A;  3DWB A;  3BA0 A;  1KUI A;  3K7N A;  1MMR A;  1Y0V A;  2K2G A;  5B5O A;  2OW2 A;  2L0R A;  1YQY A;  3B8Z A;  2WOA A;  1JAP A;  3B2Z A;  1IAE A;  1CQR A;  1HV5 A;  1OM6 A;  3DTE A;  1IAD A;  2CKI A;  5B5P A;  5BPA A;  2DDY A;  2MZE A;  1EB6 A;  3ELM A;  3DPF A;  2JIH A;  3ZXH A;  1OM7 A;  2FV9 A;  2OY4 A;  2YB9 A;  1B3D A;  2PJT A;  1I73 A;  3WV2 A;  1FBL A;  1BM6 A;  2RJQ A;  1D7X A;  2W0D A;  4L19 A;  4GR8 A;  1HFS A;  1GO8 P;  1G4K A;  3OHO A;  2CLT A;  1DTH A;  3MA2 A;  2JNP A;  4H2E A;  3SHI A;  3LK8 A;  4AXQ A;  4A3W A;  1OZ9 A;  1QIB A;  1ZXC A;  1HOV A;  4GR0 A;  1B8Y A;  2OW1 A;  5I12 A;  1G9K A;  3DPE A;  1SRP A;  2QPJ A;  1MMP A;  3TSK A;  3DTI A;  1CGE A;  2WO8 A;  2Y6C A;  3LQ0 A;  2DW0 A;  5H8X A;  3F1A A;  5D1T A;  1XAX A;  1PWP A;  3I7I A;  4GWM A;  1XUD A;  2POJ A;  2J0T A;  3VI1 A;  3ZUK A;  3DNG A;  1H71 P;  5D2B A;  1R54 A;  4PKR A;  1MNC A;  1YCM A;  3O64 A;  3LIR A;  2I47 A;  1EAK A;  1CAQ A;  3NX7 A;  5BOY A;  4JPA A;  2DW1 A;  4Q1L A;  1C7K A;  4IUW A;  1BZS A;  3HBU P;  3P24 A;  2V4B A;  4GF1 A;  5LAB A;  1PWV A;  3F17 A;  1SAT A;  4ILW D;  4DV8 A;  2A8H A;  3TT4 A;  2DDF A;  1AST A;  1IAB A;  3EHX A;  2JT6 A;  4FXY P;  2KRJ A;  1OMJ A;  5BOT A;  1KUF A;  1YP1 A;  1HTD A;  1ZP5 A;  3LMC A;  4DD8 A;  1CXV A;  1JH1 A;  3LKA A;  1EUB A;  5D1S A;  2W13 A;  4G0D A;  4WZV A;  1XFV A;  4XBH A;  1USN A;  4ON1 A;  1KBC A;  1UMS A;  3HB2 P;  1GE6 A;  3KEC A;  1A85 A;  4HMA A;  1PWQ A;  3LEA A;  3B92 A;  3EDG A;  4GWN A;  4JIJ A;  2X7M A;  1QJI A;  4H84 A;  2USN A;  1IAC A;  1AKL A;  966C A;  1ND1 A;  3KHI A;  1MMQ A;  1JAN A;  1C3I A;  4DPE A;  3KWV C;  3LGP A;  4WKI A;  4JA1 A;  1K7Q A;  1XFU A;  1JJ9 A;  1IAA A;  4A7B A;  2RJP A;  1WNI A;  3LIK A;  2MLR A;  4AIG A;  3HY7 A;  2YUF A;  4GQL A;  4GUY A;  4PKQ A;  3N2V A;  4PKV A;  5D1U A;  2W12 A;  4L7A A;  1Y93 A;  2W14 A;  1ZXV A;  1GXD A;  1TVI A;  2DW2 A;  2FV5 A;  3AYK A;  4XM8 A;  1AYK A;  1R55 A;  2X3C A;  4EFS A;  2OZR A;  1OM8 A;  1QIC A;  3TS4 A;  1PWU A;  830C A;  5I4O A;  4PKW A;  5D7W A;  5L79 A;  2N8R A;  2HU6 A;  2X3B A;  2XS4 A;  4ZR5 A;  2OXW A;  1A86 A;  1JKY A;  4G9L A;  4AYK A;  2W15 A;  1SLM A;  3CKI A;  2Z2D A;  1KAP P;  1XM5 A;  1BSW A;  1I1I P;  3EHY A;  2SRT A;  1BQQ M;  1G05 A;  1JIZ A;  456C A;  1CIZ A;  1JAQ A;  4GR3 A;  2WO9 A;  4IN9 A;  3F18 A;  3KEJ A;  2TCL A;  3EDZ A;  3WV1 A;  2MZI A;  1BIW A;  1GE7 A;  1KUH A;  2AIG P;  3LUN A;  5CXA A;  1GKD A;  1UTZ A;  1CGF A;  1BQO A;  3Q2H A;  4IJO A;  1MMB A;  4XM7 A;  1ZTQ A;  5I0L A;  2ERO A;  4PKS A;  1L6J A;  1ZS0 A;  3LE9 A;  1G49 A;  2YIG A;  3RTS A;  2K9C A;  1CK7 A;  2O36 A;  3KME A;  1S4B P;  1ZVX A;  4HX3 A;  2JSD A;  4XCT A;  1FM1 A;  4WK7 A;  4XM6 A;  1YOU A;  3UVC A;  4R3V A;  4H82 A;  3F19 A;  1XUR A;  3U1R A;  2OXZ A;  3DSL A;  1O0Q A;  1QJJ A;  3LJT A;  5CZM A;  3HY9 A;  3O2X A;  5L7F A;  1OS2 A;  2OI0 A;  3KRY A;  1RMZ A;  2O3E A;  1QUA A;  4H1Q A;  3V96 B;  3HYG A;  4QKZ A;  3KEK A;  2OXU A;  3OHL A;  1D5J A;  1G12 A;  4L6T A;  3G42 A;  3Q2G A;  1K7I A;  2J83 A;  1R1H A;  1SU3 A;  5D3C A;  3HDB A;  4WKE A;  3LUM A;  4PKU A;  1Y8J A;  3E8R A;  3G5C A;  3LQB A;  1JK3 A;  3L0V A;  2JT5 A;  1R1J A;  2OVZ A;  1O0T A;  5JMY A;  3LJZ A;  2OY2 A;  1JIW P;  4FVL A;  2XS3 A;  1KUG A;  1OO9 A;  3AYU A;  1PWW A;  1ATL A;  2MLS A;  1Q3A A;  1GKC A;  3AIG A;  4H76 A;  3L0T A;  3LIL A;  2OW9 A;  1BUV M;  4H3X A;  4I35 A;  2ERQ A;  1FLS A;  5I43 A;  3KMC A;  3EWJ A;  1BKC A;  2E2D A;  1XFW A;  3N2U A;  1XUC A;  1UMT A;  3EDH A;  5I3M A;  2D1O A;  1DMT A;  1RM8 A;  1R1I A;  2MZH A;  3HDA P;  4AUO A;  4PKT A;  2AYK A;  1KUK A;  3VTG A;  1GE5 A;  2ERP A;  3WV3 A;  4FU4 A;  3DL1 A;  4H49 A;  1HFC A;  1GO7 P;  4L63 A;  3GBO A;  3DTK A; 
#chains in the Genus database with same CATH homology
 1ROS A;  4JP4 A;  2X3A A;  5CUH A;  1OS9 A;  4J4M A;  4DF9 A;  1J7N A;  4CTH A;  3ZVS A;  1C8T A;  4JQG A;  4WF6 A;  4I03 A;  1CGL A;  1D8F A;  3RTT A;  1SLN A;  1JAO A;  1K7G A;  1BKC I;  3P1V A;  1HY7 A;  1Z3J A;  3USN A;  1QIA A;  2OW0 A;  3K7L A;  2Y6D A;  1BKC E;  1D8M A;  1AF0 A;  4FXQ A;  1BUD A;  2E3X A;  3TVC A;  4H30 A;  5I2Z A;  1XFX A;  3F16 A;  1UTT A;  3I7G A;  3LJG A;  2D1N A;  1UEA A;  1SMP A;  1XFY A;  3F15 A;  2OVX A;  3EDI A;  3HBV P;  1XFZ A;  1I76 A;  1IAG A;  3DWB A;  3BA0 A;  1KUI A;  3K7N A;  1MMR A;  1Y0V A;  2K2G A;  5B5O A;  2OW2 A;  2L0R A;  1YQY A;  3B8Z A;  2WOA A;  1JAP A;  3B2Z A;  1IAE A;  1CQR A;  1HV5 A;  1OM6 A;  3DTE A;  1IAD A;  2CKI A;  5B5P A;  5BPA A;  2DDY A;  2MZE A;  1EB6 A;  3ELM A;  3DPF A;  2JIH A;  3ZXH A;  1OM7 A;  2FV9 A;  2OY4 A;  2YB9 A;  1B3D A;  2PJT A;  1I73 A;  3WV2 A;  1FBL A;  1BM6 A;  2RJQ A;  1D7X A;  2W0D A;  4L19 A;  4GR8 A;  1HFS A;  1GO8 P;  1G4K A;  3OHO A;  2CLT A;  1DTH A;  3MA2 A;  2JNP A;  4H2E A;  3SHI A;  3LK8 A;  4AXQ A;  4A3W A;  1QIB A;  1ZXC A;  1HOV A;  4GR0 A;  1B8Y A;  2OW1 A;  5I12 A;  1G9K A;  3DPE A;  1SRP A;  2QPJ A;  1MMP A;  3TSK A;  3DTI A;  1CGE A;  2WO8 A;  2Y6C A;  3LQ0 A;  2DW0 A;  5H8X A;  3F1A A;  5D1T A;  1PWP A;  3I7I A;  4GWM A;  1XUD A;  2POJ A;  2J0T A;  3VI1 A;  3ZUK A;  3DNG A;  1H71 P;  5D2B A;  1R54 A;  4PKR A;  1MNC A;  1YCM A;  3O64 A;  3LIR A;  2I47 A;  1EAK A;  1CAQ A;  3NX7 A;  5BOY A;  4JPA A;  2DW1 A;  4Q1L A;  1C7K A;  4IUW A;  1BZS A;  3HBU P;  3P24 A;  2V4B A;  4GF1 A;  5LAB A;  1PWV A;  3F17 A;  1SAT A;  4ILW D;  4DV8 A;  2A8H A;  3TT4 A;  2DDF A;  1AST A;  1IAB A;  3EHX A;  2JT6 A;  4FXY P;  2KRJ A;  1OMJ A;  5BOT A;  1KUF A;  1YP1 A;  1HTD A;  1ZP5 A;  3LMC A;  4DD8 A;  1CXV A;  1JH1 A;  3LKA A;  1EUB A;  5D1S A;  2W13 A;  4G0D A;  4WZV A;  1XFV A;  4XBH A;  1USN A;  4ON1 A;  1KBC A;  1UMS A;  3HB2 P;  1GE6 A;  3KEC A;  1A85 A;  4HMA A;  1PWQ A;  3LEA A;  3B92 A;  3EDG A;  4GWN A;  4JIJ A;  2X7M A;  1QJI A;  4H84 A;  2USN A;  1IAC A;  1AKL A;  966C A;  1ND1 A;  3KHI A;  1MMQ A;  1JAN A;  1C3I A;  4DPE A;  3KWV C;  3LGP A;  4WKI A;  4JA1 A;  1K7Q A;  1XFU A;  1JJ9 A;  1IAA A;  4A7B A;  2RJP A;  1WNI A;  3LIK A;  2MLR A;  4AIG A;  3HY7 A;  2YUF A;  4GQL A;  4GUY A;  4PKQ A;  3N2V A;  4PKV A;  5D1U A;  2W12 A;  4L7A A;  1Y93 A;  2W14 A;  1ZXV A;  1GXD A;  2DW2 A;  2FV5 A;  3AYK A;  4XM8 A;  1AYK A;  1R55 A;  2X3C A;  4EFS A;  2OZR A;  1OM8 A;  1QIC A;  3TS4 A;  1PWU A;  830C A;  5I4O A;  4PKW A;  5D7W A;  5L79 A;  2N8R A;  2HU6 A;  2X3B A;  2XS4 A;  4ZR5 A;  2OXW A;  1A86 A;  1JKY A;  4G9L A;  4AYK A;  2W15 A;  1SLM A;  3CKI A;  2Z2D A;  1KAP P;  1BSW A;  1I1I P;  3EHY A;  2SRT A;  1BQQ M;  1G05 A;  1JIZ A;  456C A;  1CIZ A;  1JAQ A;  4GR3 A;  2WO9 A;  4IN9 A;  3F18 A;  3KEJ A;  2TCL A;  3EDZ A;  3WV1 A;  2MZI A;  1BIW A;  1GE7 A;  1KUH A;  2AIG P;  3LUN A;  5CXA A;  1GKD A;  1UTZ A;  1CGF A;  1BQO A;  3Q2H A;  4IJO A;  1MMB A;  4XM7 A;  1ZTQ A;  5I0L A;  2ERO A;  4PKS A;  1L6J A;  1ZS0 A;  3LE9 A;  1G49 A;  2YIG A;  3RTS A;  2K9C A;  1CK7 A;  2O36 A;  3KME A;  1S4B P;  1ZVX A;  4HX3 A;  2JSD A;  4XCT A;  1FM1 A;  4WK7 A;  4XM6 A;  1YOU A;  3UVC A;  4R3V A;  4H82 A;  3F19 A;  1XUR A;  3U1R A;  2OXZ A;  3DSL A;  1O0Q A;  1QJJ A;  3LJT A;  5CZM A;  3HY9 A;  3O2X A;  5L7F A;  1OS2 A;  2OI0 A;  3KRY A;  1RMZ A;  2O3E A;  1QUA A;  4H1Q A;  3V96 B;  3HYG A;  4QKZ A;  3KEK A;  2OXU A;  3OHL A;  1D5J A;  1G12 A;  4L6T A;  3G42 A;  3Q2G A;  1K7I A;  2J83 A;  1R1H A;  1SU3 A;  5D3C A;  3HDB A;  4WKE A;  3LUM A;  4PKU A;  1Y8J A;  3E8R A;  3G5C A;  3LQB A;  1JK3 A;  3L0V A;  2JT5 A;  1R1J A;  2OVZ A;  1O0T A;  5JMY A;  3LJZ A;  2OY2 A;  1JIW P;  4FVL A;  2XS3 A;  1KUG A;  1OO9 A;  3AYU A;  1PWW A;  1ATL A;  2MLS A;  1Q3A A;  1GKC A;  3AIG A;  4H76 A;  3L0T A;  3LIL A;  2OW9 A;  1BUV M;  4H3X A;  4I35 A;  2ERQ A;  1FLS A;  5I43 A;  3KMC A;  3EWJ A;  1BKC A;  2E2D A;  1XFW A;  3N2U A;  1XUC A;  1UMT A;  3EDH A;  5I3M A;  2D1O A;  1DMT A;  1RM8 A;  1R1I A;  2MZH A;  3HDA P;  4AUO A;  4PKT A;  2AYK A;  1KUK A;  3VTG A;  1GE5 A;  2ERP A;  3WV3 A;  4FU4 A;  3DL1 A;  4H49 A;  1HFC A;  1GO7 P;  4L63 A;  3GBO A;  3DTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...